F370453

General Info

Members Datasets Scaffolds Average Seq Length
261 145 522 134

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100310525|Ga0307416_1003105252
Length 146
Sequence LFALPVWNWLMWAADVTWTRAAHVVLVTHWRGQVTKLGPVMKKLRLSTLSAALALIGFSSLVQANSLPGAERAGSGSPERGGALAEMYDGISLDEAVSRAERQYRARVVRTDVQDEDGRKVYVLKLLSEDGRVFTVRIDGATGRMR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 3.45
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 18.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100310525 3300032002 Bacteria 1573
2 JGI25405J52794_10031249 3300003911 Bacteria 1106
3 Ga0070658_10355377 3300005327 Bacteria 1254
4 Ga0070690_100014847 3300005330 Bacteria 4631
5 Ga0070690_100410065 3300005330 Bacteria 997
6 Ga0070670_100008738 3300005331 Bacteria 8649
7 Ga0070670_101346427 3300005331 Unclassified 654
8 Ga0070677_10058417 3300005333 Bacteria 1584
9 Ga0070677_10148797 3300005333 Unclassified 1087
10 Ga0068869_100014376 3300005334 Bacteria 5285
11 Ga0068869_101472055 3300005334 Unclassified 604
12 Ga0068868_100458224 3300005338 Bacteria 1110
13 Ga0070689_100103395 3300005340 Bacteria 2258
14 Ga0070691_10052192 3300005341 Bacteria 1955
15 Ga0070687_100199199 3300005343 Bacteria 1212
16 Ga0070661_100081912 3300005344 Bacteria 2383
17 Ga0070661_100615387 3300005344 Bacteria 879
18 Ga0070692_10211103 3300005345 Bacteria 1142
19 Ga0070669_101200034 3300005353 Bacteria 655
20 Ga0070675_100160587 3300005354 Bacteria 1932
21 Ga0070675_100834753 3300005354 Bacteria 843
22 Ga0070671_100409064 3300005355 Bacteria 1161
23 Ga0070674_100006773 3300005356 Bacteria 6711
24 Ga0070674_100372743 3300005356 Bacteria 1159
25 Ga0070673_100045779 3300005364 Bacteria 3395
26 Ga0070673_100250394 3300005364 Bacteria 1544
27 Ga0070688_100458974 3300005365 Bacteria 954
28 Ga0070659_100166985 3300005366 Bacteria 1801
29 Ga0070667_100644616 3300005367 Bacteria 978
30 Ga0070701_10149612 3300005438 Bacteria 1343
31 Ga0070700_100405967 3300005441 Bacteria 1026
32 Ga0070663_100424573 3300005455 Bacteria 1091
33 Ga0070663_100507929 3300005455 Unclassified 1002
34 Ga0070678_100095557 3300005456 Bacteria 2290
35 Ga0070678_100200351 3300005456 Bacteria 1647
36 Ga0070662_100664179 3300005457 Bacteria 880
37 Ga0070662_100785115 3300005457 Bacteria 809
38 Ga0070662_100817094 3300005457 Bacteria 793
39 Ga0068867_100645700 3300005459 Bacteria 928
40 Ga0070685_10216033 3300005466 Bacteria 1254
41 Ga0070685_10486171 3300005466 Unclassified 871
42 Ga0070685_10607225 3300005466 Bacteria 788
43 Ga0070672_100028007 3300005543 Bacteria 4210
44 Ga0070672_100187591 3300005543 Unclassified 1725
45 Ga0070672_100471436 3300005543 Unclassified 1083
46 Ga0070672_100567355 3300005543 Unclassified 986
47 Ga0070672_100766315 3300005543 Unclassified 848
48 Ga0070686_100083881 3300005544 Bacteria 2116
49 Ga0070665_100750067 3300005548 Bacteria 989
50 Ga0070704_101133845 3300005549 Bacteria 711
51 Ga0070664_100023411 3300005564 Bacteria 5101
52 Ga0070664_100375381 3300005564 Bacteria 1297
53 Ga0070664_101382475 3300005564 Bacteria 665
54 Ga0070664_101744755 3300005564 Bacteria 590
55 Ga0068859_101202132 3300005617 Bacteria 835
56 Ga0068859_101439052 3300005617 Bacteria 760
57 Ga0068864_100645738 3300005618 Bacteria 1030
58 Ga0068864_100906447 3300005618 Bacteria 871
59 Ga0068866_10190561 3300005718 Bacteria 1218
60 Ga0068866_10324791 3300005718 Bacteria 969
61 Ga0068866_10341811 3300005718 Bacteria 948
62 Ga0068866_10446381 3300005718 Unclassified 845
63 Ga0068861_100030271 3300005719 Bacteria 3965
64 Ga0068861_100163281 3300005719 Bacteria 1839
65 Ga0068861_100186821 3300005719 Bacteria 1729
66 Ga0068861_100196641 3300005719 Bacteria 1689
67 Ga0068861_100302758 3300005719 Bacteria 1385
68 Ga0068861_101584557 3300005719 Bacteria 645
69 Ga0068870_10028228 3300005840 Bacteria 2815
70 Ga0068870_10193738 3300005840 Bacteria 1228
71 Ga0068870_10208405 3300005840 Unclassified 1189
72 Ga0068863_100242335 3300005841 Bacteria 1740
73 Ga0068863_100247714 3300005841 Bacteria 1721
74 Ga0068860_100205852 3300005843 Bacteria 1908
75 Ga0068860_101173697 3300005843 Bacteria 788
76 Ga0068860_101447020 3300005843 Bacteria 709
77 Ga0068860_102705045 3300005843 Unclassified 515
78 Ga0068862_100200392 3300005844 Bacteria 1800
79 Ga0068862_100402324 3300005844 Bacteria 1281
80 Ga0068862_101313019 3300005844 Bacteria 725
81 Ga0068862_101618345 3300005844 Bacteria 655
82 Ga0081455_10003780 3300005937 Bacteria 17286
83 Ga0075364_10753389 3300006051 Unclassified 664
84 Ga0075366_10145093 3300006195 Bacteria 1436
85 Ga0097621_100047890 3300006237 Bacteria 3465
86 Ga0097621_101170616 3300006237 Bacteria 723
87 Ga0068871_100074777 3300006358 Bacteria 2795
88 Ga0068871_100225168 3300006358 Unclassified 1626
89 Ga0068871_100244417 3300006358 Bacteria 1561
90 Ga0068871_100425678 3300006358 Bacteria 1186
91 Ga0075428_101741194 3300006844 Unclassified 650
92 Ga0068865_100048298 3300006881 Bacteria 2928
93 Ga0068865_100064902 3300006881 Bacteria 2570
94 Ga0068865_100072490 3300006881 Bacteria 2447
95 Ga0068865_101315622 3300006881 Unclassified 643
96 Ga0097620_101202196 3300006931 Bacteria 835
97 Ga0097620_101438914 3300006931 Bacteria 760
98 Ga0111539_10055893 3300009094 Bacteria 4692
99 Ga0111539_10421094 3300009094 Bacteria 1555
100 Ga0105242_10944144 3300009176 Bacteria 866
101 Ga0105242_11109448 3300009176 Bacteria 806
102 Ga0105242_11850998 3300009176 Unclassified 643
103 Ga0163163_10032401 3300014325 Bacteria 5047
104 Ga0163163_10907574 3300014325 Unclassified 944
105 Ga0157380_10132293 3300014326 Bacteria 2130
106 Ga0157380_10208509 3300014326 Unclassified 1740
107 Ga0157380_10428784 3300014326 Bacteria 1263
108 Ga0157380_10484882 3300014326 Bacteria 1197
109 Ga0157380_12298044 3300014326 Bacteria 604
110 Ga0157376_10408182 3300014969 Bacteria 1315
111 Ga0163161_10211369 3300017792 Bacteria 1499
112 Ga0163161_10519805 3300017792 Bacteria 972
113 Ga0163161_10702650 3300017792 Bacteria 842
114 Ga0207656_10417202 3300025321 Unclassified 676
115 Ga0207682_10004850 3300025893 Bacteria 5561
116 Ga0207682_10012365 3300025893 Bacteria 3333
117 Ga0207642_10209669 3300025899 Bacteria 1082
118 Ga0207645_10122608 3300025907 Bacteria 1688
119 Ga0207643_10032926 3300025908 Bacteria 2898
120 Ga0207643_10037017 3300025908 Bacteria 2737
121 Ga0207705_10910103 3300025909 Bacteria 681
122 Ga0207657_10474603 3300025919 Unclassified 981
123 Ga0207649_10445182 3300025920 Bacteria 977
124 Ga0207649_10446663 3300025920 Unclassified 975
125 Ga0207649_10785152 3300025920 Bacteria 743
126 Ga0207681_10024550 3300025923 Bacteria 3870
127 Ga0207650_10017936 3300025925 Bacteria 4960
128 Ga0207650_10182724 3300025925 Bacteria 1672
129 Ga0207659_10046649 3300025926 Bacteria 3061
130 Ga0207659_10268196 3300025926 Bacteria 1392
131 Ga0207659_10749932 3300025926 Bacteria 837
132 Ga0207644_10417955 3300025931 Bacteria 1098
133 Ga0207644_10591311 3300025931 Bacteria 921
134 Ga0207644_10700226 3300025931 Bacteria 845
135 Ga0207706_10225642 3300025933 Bacteria 1640
136 Ga0207706_10261979 3300025933 Bacteria 1509
137 Ga0207706_10727658 3300025933 Bacteria 846
138 Ga0207670_10465714 3300025936 Bacteria 1021
139 Ga0207669_10019035 3300025937 Bacteria 3566
140 Ga0207669_10100664 3300025937 Bacteria 1909
141 Ga0207669_10267080 3300025937 Bacteria 1283
142 Ga0207704_10036143 3300025938 Bacteria 2839
143 Ga0207704_10060229 3300025938 Bacteria 2348
144 Ga0207691_10002557 3300025940 Bacteria 17780
145 Ga0207691_10003484 3300025940 Bacteria 15315
146 Ga0207691_10041667 3300025940 Bacteria 4238
147 Ga0207691_10731819 3300025940 Unclassified 833
148 Ga0207711_10889280 3300025941 Unclassified 828
149 Ga0207689_11621316 3300025942 Unclassified 538
150 Ga0207679_10047705 3300025945 Bacteria 3114
151 Ga0207679_10117361 3300025945 Unclassified 2112
152 Ga0207679_10317037 3300025945 Bacteria 1349
153 Ga0207651_10053241 3300025960 Bacteria 2765
154 Ga0207651_10161306 3300025960 Bacteria 1758
155 Ga0207651_10192792 3300025960 Bacteria 1627
156 Ga0207668_11543382 3300025972 Bacteria 599
157 Ga0207658_10283353 3300025986 Bacteria 1421
158 Ga0207677_10085965 3300026023 Bacteria 2272
159 Ga0207678_10099713 3300026067 Bacteria 2481
160 Ga0207678_10401019 3300026067 Bacteria 1188
161 Ga0207708_10043843 3300026075 Bacteria 3410
162 Ga0207708_10427508 3300026075 Unclassified 1099
163 Ga0207708_10928715 3300026075 Unclassified 754
164 Ga0207641_10193957 3300026088 Bacteria 1868
165 Ga0207641_12448693 3300026088 Bacteria 521
166 Ga0207648_10009434 3300026089 Bacteria 9350
167 Ga0207648_10114898 3300026089 Bacteria 2365
168 Ga0207648_10387162 3300026089 Bacteria 1265
169 Ga0207648_10612619 3300026089 Bacteria 1004
170 Ga0207676_10652326 3300026095 Bacteria 1016
171 Ga0207676_10904426 3300026095 Unclassified 866
172 Ga0207675_100011112 3300026118 Bacteria 8436
173 Ga0207675_100062015 3300026118 Bacteria 3491
174 Ga0207675_100232069 3300026118 Bacteria 1781
175 Ga0207675_100289540 3300026118 Bacteria 1593
176 Ga0207683_10145344 3300026121 Bacteria 2138
177 Ga0207683_10331559 3300026121 Bacteria 1395
178 Ga0207683_10382337 3300026121 Bacteria 1294
179 Ga0207683_10982925 3300026121 Unclassified 784
180 Ga0207428_10570282 3300027907 Unclassified 817
181 Ga0268266_10109440 3300028379 Bacteria 2447
182 Ga0268265_10392663 3300028380 Bacteria 1280
183 Ga0268265_10684994 3300028380 Bacteria 989
184 Ga0268265_10820035 3300028380 Bacteria 908
185 Ga0268265_10942477 3300028380 Bacteria 850
186 Ga0268264_10082582 3300028381 Bacteria 2750
187 Ga0268264_10682629 3300028381 Bacteria 1019
188 Ga0307515_10156564 3300028794 Bacteria 2348
189 Ga0307513_10001966 3300031456 Bacteria 29093
190 Ga0307513_10034628 3300031456 Bacteria 5664
191 Ga0307513_10099570 3300031456 Bacteria 2935
192 Ga0307513_10111250 3300031456 Bacteria 2732
193 Ga0307513_10138363 3300031456 Bacteria 2366
194 Ga0307405_10751527 3300031731 Bacteria 812
195 Ga0307413_10003338 3300031824 Bacteria 6741
196 Ga0307413_10016231 3300031824 Bacteria 3840
197 Ga0307410_10177142 3300031852 Bacteria 1611
198 Ga0307410_10213630 3300031852 Bacteria 1479
199 Ga0307406_10005987 3300031901 Bacteria 6675
200 Ga0307407_10015264 3300031903 Bacteria 3790
201 Ga0307407_10180298 3300031903 Bacteria 1399
202 Ga0307409_100002716 3300031995 Bacteria 9341
203 Ga0307416_100020898 3300032002 Bacteria 4684
204 Ga0307416_100690731 3300032002 Bacteria 1109
205 Ga0307411_10001463 3300032005 Bacteria 9683
206 Ga0307411_11408229 3300032005 Unclassified 638
207 Ga0307415_100011509 3300032126 Bacteria 5068
208 Ga0307415_100909249 3300032126 Unclassified 812
209 Ga0373941_0153051 3300035115 Bacteria 848
210 Ga0373957_0302880 3300035120 Unclassified 678
211 Ga0373946_0220423 3300035171 Bacteria 916
212 Ga0373947_0342710 3300035725 Unclassified 1002
213 Ga0373937_1539637 3300036401 Bacteria 612
214 Ga0373925_0433806 3300037068 Bacteria 1075
215 Ga0451789_0493432 3300041443 Unclassified 1050
216 Ga0451791_0039973 3300041451 Bacteria 666
217 Ga0451791_0136097 3300041451 Unclassified 589
218 Ga0451791_0280057 3300041451 Bacteria 1537
219 Ga0451791_1840363 3300041451 Bacteria 693
220 Ga0451793_0837016 3300041452 Unclassified 682
221 Ga0451802_1379183 3300041460 Unclassified 797
222 Ga0451807_0682968 3300041486 Bacteria 955
223 Ga0451807_1219939 3300041486 Bacteria 1032
224 Ga0451837_1342968 3300041494 Unclassified 735
225 Ga0451839_0636405 3300041496 Bacteria 782
226 Ga0451853_1659745 3300041512 Unclassified 828
227 Ga0495590_0002389 3300046457 Bacteria 7778
228 Ga0495638_0085714 3300046460 Bacteria 1905
229 Ga0495641_0089036 3300046461 Bacteria 1380
230 Ga0495616_0307333 3300046513 Bacteria 668
231 Ga0495632_0052020 3300046519 Bacteria 2015
232 Ga0495621_0301993 3300046539 Bacteria 664
233 Ga0495634_0157503 3300046642 Unclassified 1434
234 Ga0495625_0050540 3300046660 Bacteria 2983
235 Ga0495625_0395920 3300046660 Bacteria 864
236 Ga0495613_0459429 3300046689 Unclassified 862
237 Ga0495686_0107313 3300047472 Bacteria 1678
238 Ga0495686_0108442 3300047472 Unclassified 1668
239 Ga0495615_0166878 3300048090 Bacteria 664
240 Ga0501032_0599330 3300049569 Bacteria 701
241 Ga0501036_0337730 3300049572 Bacteria 1258
242 Ga0501039_0231426 3300049575 Bacteria 1453
243 Ga0501041_0868146 3300049577 Unclassified 579
244 Ga0501042_0271853 3300049578 Bacteria 1224
245 Ga0501067_0778899 3300049583 Unclassified 538
246 Ga0501068_0048290 3300049584 Bacteria 2569
247 Ga0501071_0021302 3300049587 Bacteria 4512
248 Ga0501072_0068806 3300049588 Bacteria 2794
249 Ga0501073_0002713 3300049589 Bacteria 13265
250 Ga0501075_0540589 3300049591 Bacteria 889
251 Ga0501079_0437693 3300049741 Bacteria 1026
252 Ga0501080_0003298 3300049742 Bacteria 14261
253 nmdc:mga00v17_368935_c1 3300050491 Bacteria 933
254 nmdc:mga08y16_1214386_c1 3300050511 Bacteria 724
255 nmdc:mga08y16_482616_c1 3300050511 Bacteria 1261
256 nmdc:mga08y16_629419_c1 3300050511 Bacteria 1079
257 Ga0495655_0124286 3300053083 Bacteria 789
258 Ga0500644_0154987 3300053088 Unclassified 921
259 Ga0501084_0019123 3300054114 Bacteria 5706
260 Ga0501082_0053105 3300060353 Bacteria 3493
261 Ga0530510_0046540 3300061734 Bacteria 3134
262 Ga0307416_100310525
263 JGI25405J52794_10031249
264 Ga0070658_10355377
265 Ga0070690_100014847
266 Ga0070690_100410065
267 Ga0070670_100008738
268 Ga0070670_101346427
269 Ga0070677_10058417
270 Ga0070677_10148797
271 Ga0068869_100014376
272 Ga0068869_101472055
273 Ga0068868_100458224
274 Ga0070689_100103395
275 Ga0070691_10052192
276 Ga0070687_100199199
277 Ga0070661_100081912
278 Ga0070661_100615387
279 Ga0070692_10211103
280 Ga0070669_101200034
281 Ga0070675_100160587
282 Ga0070675_100834753
283 Ga0070671_100409064
284 Ga0070674_100006773
285 Ga0070674_100372743
286 Ga0070673_100045779
287 Ga0070673_100250394
288 Ga0070688_100458974
289 Ga0070659_100166985
290 Ga0070667_100644616
291 Ga0070701_10149612
292 Ga0070700_100405967
293 Ga0070663_100424573
294 Ga0070663_100507929
295 Ga0070678_100095557
296 Ga0070678_100200351
297 Ga0070662_100664179
298 Ga0070662_100785115
299 Ga0070662_100817094
300 Ga0068867_100645700
301 Ga0070685_10216033
302 Ga0070685_10486171
303 Ga0070685_10607225
304 Ga0070672_100028007
305 Ga0070672_100187591
306 Ga0070672_100471436
307 Ga0070672_100567355
308 Ga0070672_100766315
309 Ga0070686_100083881
310 Ga0070665_100750067
311 Ga0070704_101133845
312 Ga0070664_100023411
313 Ga0070664_100375381
314 Ga0070664_101382475
315 Ga0070664_101744755
316 Ga0068859_101202132
317 Ga0068859_101439052
318 Ga0068864_100645738
319 Ga0068864_100906447
320 Ga0068866_10190561
321 Ga0068866_10324791
322 Ga0068866_10341811
323 Ga0068866_10446381
324 Ga0068861_100030271
325 Ga0068861_100163281
326 Ga0068861_100186821
327 Ga0068861_100196641
328 Ga0068861_100302758
329 Ga0068861_101584557
330 Ga0068870_10028228
331 Ga0068870_10193738
332 Ga0068870_10208405
333 Ga0068863_100242335
334 Ga0068863_100247714
335 Ga0068860_100205852
336 Ga0068860_101173697
337 Ga0068860_101447020
338 Ga0068860_102705045
339 Ga0068862_100200392
340 Ga0068862_100402324
341 Ga0068862_101313019
342 Ga0068862_101618345
343 Ga0081455_10003780
344 Ga0075364_10753389
345 Ga0075366_10145093
346 Ga0097621_100047890
347 Ga0097621_101170616
348 Ga0068871_100074777
349 Ga0068871_100225168
350 Ga0068871_100244417
351 Ga0068871_100425678
352 Ga0075428_101741194
353 Ga0068865_100048298
354 Ga0068865_100064902
355 Ga0068865_100072490
356 Ga0068865_101315622
357 Ga0097620_101202196
358 Ga0097620_101438914
359 Ga0111539_10055893
360 Ga0111539_10421094
361 Ga0105242_10944144
362 Ga0105242_11109448
363 Ga0105242_11850998
364 Ga0163163_10032401
365 Ga0163163_10907574
366 Ga0157380_10132293
367 Ga0157380_10208509
368 Ga0157380_10428784
369 Ga0157380_10484882
370 Ga0157380_12298044
371 Ga0157376_10408182
372 Ga0163161_10211369
373 Ga0163161_10519805
374 Ga0163161_10702650
375 Ga0207656_10417202
376 Ga0207682_10004850
377 Ga0207682_10012365
378 Ga0207642_10209669
379 Ga0207645_10122608
380 Ga0207643_10032926
381 Ga0207643_10037017
382 Ga0207705_10910103
383 Ga0207657_10474603
384 Ga0207649_10445182
385 Ga0207649_10446663
386 Ga0207649_10785152
387 Ga0207681_10024550
388 Ga0207650_10017936
389 Ga0207650_10182724
390 Ga0207659_10046649
391 Ga0207659_10268196
392 Ga0207659_10749932
393 Ga0207644_10417955
394 Ga0207644_10591311
395 Ga0207644_10700226
396 Ga0207706_10225642
397 Ga0207706_10261979
398 Ga0207706_10727658
399 Ga0207670_10465714
400 Ga0207669_10019035
401 Ga0207669_10100664
402 Ga0207669_10267080
403 Ga0207704_10036143
404 Ga0207704_10060229
405 Ga0207691_10002557
406 Ga0207691_10003484
407 Ga0207691_10041667
408 Ga0207691_10731819
409 Ga0207711_10889280
410 Ga0207689_11621316
411 Ga0207679_10047705
412 Ga0207679_10117361
413 Ga0207679_10317037
414 Ga0207651_10053241
415 Ga0207651_10161306
416 Ga0207651_10192792
417 Ga0207668_11543382
418 Ga0207658_10283353
419 Ga0207677_10085965
420 Ga0207678_10099713
421 Ga0207678_10401019
422 Ga0207708_10043843
423 Ga0207708_10427508
424 Ga0207708_10928715
425 Ga0207641_10193957
426 Ga0207641_12448693
427 Ga0207648_10009434
428 Ga0207648_10114898
429 Ga0207648_10387162
430 Ga0207648_10612619
431 Ga0207676_10652326
432 Ga0207676_10904426
433 Ga0207675_100011112
434 Ga0207675_100062015
435 Ga0207675_100232069
436 Ga0207675_100289540
437 Ga0207683_10145344
438 Ga0207683_10331559
439 Ga0207683_10382337
440 Ga0207683_10982925
441 Ga0207428_10570282
442 Ga0268266_10109440
443 Ga0268265_10392663
444 Ga0268265_10684994
445 Ga0268265_10820035
446 Ga0268265_10942477
447 Ga0268264_10082582
448 Ga0268264_10682629
449 Ga0307515_10156564
450 Ga0307513_10001966
451 Ga0307513_10034628
452 Ga0307513_10099570
453 Ga0307513_10111250
454 Ga0307513_10138363
455 Ga0307405_10751527
456 Ga0307413_10003338
457 Ga0307413_10016231
458 Ga0307410_10177142
459 Ga0307410_10213630
460 Ga0307406_10005987
461 Ga0307407_10015264
462 Ga0307407_10180298
463 Ga0307409_100002716
464 Ga0307416_100020898
465 Ga0307416_100690731
466 Ga0307411_10001463
467 Ga0307411_11408229
468 Ga0307415_100011509
469 Ga0307415_100909249
470 Ga0373941_0153051
471 Ga0373957_0302880
472 Ga0373946_0220423
473 Ga0373947_0342710
474 Ga0373937_1539637
475 Ga0373925_0433806
476 Ga0451789_0493432
477 Ga0451791_0039973
478 Ga0451791_0136097
479 Ga0451791_0280057
480 Ga0451791_1840363
481 Ga0451793_0837016
482 Ga0451802_1379183
483 Ga0451807_0682968
484 Ga0451807_1219939
485 Ga0451837_1342968
486 Ga0451839_0636405
487 Ga0451853_1659745
488 Ga0495590_0002389
489 Ga0495638_0085714
490 Ga0495641_0089036
491 Ga0495616_0307333
492 Ga0495632_0052020
493 Ga0495621_0301993
494 Ga0495634_0157503
495 Ga0495625_0050540
496 Ga0495625_0395920
497 Ga0495613_0459429
498 Ga0495686_0107313
499 Ga0495686_0108442
500 Ga0495615_0166878
501 Ga0501032_0599330
502 Ga0501036_0337730
503 Ga0501039_0231426
504 Ga0501041_0868146
505 Ga0501042_0271853
506 Ga0501067_0778899
507 Ga0501068_0048290
508 Ga0501071_0021302
509 Ga0501072_0068806
510 Ga0501073_0002713
511 Ga0501075_0540589
512 Ga0501079_0437693
513 Ga0501080_0003298
514 nmdc:mga00v17_368935_c1
515 nmdc:mga08y16_1214386_c1
516 nmdc:mga08y16_482616_c1
517 nmdc:mga08y16_629419_c1
518 Ga0495655_0124286
519 Ga0500644_0154987
520 Ga0501084_0019123
521 Ga0501082_0053105
522 Ga0530510_0046540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03413

PepSY

Peptidase propeptide and YPEB domain

90

145

0.95

Map