F370136

General Info

Members Datasets Scaffolds Average Seq Length
261 173 522 269

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100029613|Ga0070714_1000296135
Length 282
Sequence MASARAMSTVGTRYQPITGRWPVIWAFLDALVLAKRSVLETVRVPELIMFVAIQPIMFVLLFRYVFGGAIQVPGGQYVNFLMPGIFVQTVAFGGVTTAIGLAQDMQRGIIDRFRSLPMSSSAVLTGRTIADLARNLFTVVIMLTVGFLVGFRPGGTPFEFLLGILLLLGVSFAFSWISAFIGLLVRSVEAAQSGGFIWLFPLTFASSAFVPVATMPGWLQTFARHNPISVLADALRGLFHVNPALTTADTRSALIQSVAWIVAILLVFVPLSVIRYRRTTAR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
138 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
141 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
142 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 6.9
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100029613 3300005435 Bacteria 4552
2 JGI25407J50210_10012908 3300003373 Bacteria 2143
3 Ga0068869_100231367 3300005334 Bacteria 1469
4 Ga0070666_10027991 3300005335 Bacteria 3696
5 Ga0070682_100007173 3300005337 Bacteria 6277
6 Ga0068868_100220445 3300005338 Bacteria 1588
7 Ga0070692_10140167 3300005345 Bacteria 1368
8 Ga0070671_100403561 3300005355 Bacteria 1169
9 Ga0070674_100437484 3300005356 Bacteria 1077
10 Ga0070659_100011347 3300005366 Bacteria 6589
11 Ga0070667_100379013 3300005367 Bacteria 1285
12 Ga0070709_10060356 3300005434 Bacteria 2410
13 Ga0070709_10191180 3300005434 Unclassified 1444
14 Ga0070714_100000012 3300005435 Bacteria 226258
15 Ga0070714_100038331 3300005435 Bacteria 4029
16 Ga0070714_100504787 3300005435 Unclassified 1154
17 Ga0070714_100574442 3300005435 Bacteria 1081
18 Ga0070713_100191180 3300005436 Bacteria 1844
19 Ga0070710_10071870 3300005437 Bacteria 1996
20 Ga0070710_10134540 3300005437 Unclassified 1510
21 Ga0070701_10081104 3300005438 Bacteria 1756
22 Ga0070711_100002232 3300005439 Bacteria 10987
23 Ga0070705_100135475 3300005440 Bacteria 1613
24 Ga0070700_100058735 3300005441 Bacteria 2418
25 Ga0070694_100015483 3300005444 Bacteria 4792
26 Ga0070708_100006156 3300005445 Bacteria 9544
27 Ga0070708_100021793 3300005445 Bacteria 5425
28 Ga0070708_100188021 3300005445 Bacteria 1931
29 Ga0070708_100259206 3300005445 Bacteria 1634
30 Ga0070708_100310114 3300005445 Bacteria 1486
31 Ga0070708_100360514 3300005445 Bacteria 1370
32 Ga0070663_100217805 3300005455 Bacteria 1497
33 Ga0070678_100031002 3300005456 Bacteria 3682
34 Ga0070681_10066862 3300005458 Bacteria 3563
35 Ga0068867_100254949 3300005459 Bacteria 1428
36 Ga0070706_100000102 3300005467 Bacteria 104490
37 Ga0070706_100001708 3300005467 Bacteria 22829
38 Ga0070706_100002164 3300005467 Bacteria 19999
39 Ga0070706_100010717 3300005467 Bacteria 8509
40 Ga0070706_100013502 3300005467 Bacteria 7555
41 Ga0070706_100019963 3300005467 Bacteria 6178
42 Ga0070706_100061124 3300005467 Bacteria 3478
43 Ga0070706_100127322 3300005467 Bacteria 2375
44 Ga0070707_100003411 3300005468 Bacteria 15013
45 Ga0070707_100030172 3300005468 Bacteria 5160
46 Ga0070707_100032507 3300005468 Bacteria 4972
47 Ga0070707_100042199 3300005468 Bacteria 4367
48 Ga0070707_100151084 3300005468 Bacteria 2261
49 Ga0070707_100192789 3300005468 Bacteria 1987
50 Ga0070698_100001082 3300005471 Bacteria 29940
51 Ga0070698_100001292 3300005471 Bacteria 27926
52 Ga0070698_100017823 3300005471 Bacteria 7480
53 Ga0070698_100019371 3300005471 Bacteria 7148
54 Ga0070698_100047624 3300005471 Bacteria 4382
55 Ga0070698_100249916 3300005471 Bacteria 1706
56 Ga0070698_100250353 3300005471 Bacteria 1704
57 Ga0070698_100301341 3300005471 Bacteria 1533
58 Ga0070698_100322386 3300005471 Bacteria 1476
59 Ga0070698_100685565 3300005471 Bacteria 966
60 Ga0070699_100002301 3300005518 Bacteria 17189
61 Ga0070699_100009064 3300005518 Bacteria 8623
62 Ga0070699_100012047 3300005518 Bacteria 7464
63 Ga0070699_100188808 3300005518 Bacteria 1830
64 Ga0070699_100208439 3300005518 Bacteria 1739
65 Ga0070699_100380252 3300005518 Bacteria 1275
66 Ga0070684_100489138 3300005535 Bacteria 1139
67 Ga0070697_100000020 3300005536 Bacteria 138980
68 Ga0070697_100005119 3300005536 Bacteria 10069
69 Ga0070697_100005925 3300005536 Bacteria 9442
70 Ga0070697_100008247 3300005536 Bacteria 8130
71 Ga0070697_100229913 3300005536 Bacteria 1582
72 Ga0068853_100047941 3300005539 Bacteria 3668
73 Ga0070695_100019935 3300005545 Bacteria 4089
74 Ga0070696_100023759 3300005546 Bacteria 4166
75 Ga0070693_100008424 3300005547 Bacteria 5082
76 Ga0070665_100074961 3300005548 Bacteria 3389
77 Ga0070665_100269861 3300005548 Bacteria 1703
78 Ga0068855_100057348 3300005563 Bacteria 4565
79 Ga0068857_100022399 3300005577 Bacteria 5558
80 Ga0068856_100424275 3300005614 Bacteria 1350
81 Ga0070702_100016819 3300005615 Bacteria 3761
82 Ga0068852_100055029 3300005616 Bacteria 3432
83 Ga0068859_100031010 3300005617 Bacteria 5366
84 Ga0068864_100493911 3300005618 Bacteria 1176
85 Ga0068861_100019194 3300005719 Bacteria 4884
86 Ga0068863_100051618 3300005841 Bacteria 3897
87 Ga0068860_100035816 3300005843 Bacteria 4758
88 Ga0081455_10056143 3300005937 Bacteria 3345
89 Ga0081538_10005216 3300005981 Bacteria 11739
90 Ga0081540_1011984 3300005983 Bacteria 5746
91 Ga0081540_1019507 3300005983 Bacteria 4115
92 Ga0081539_10126496 3300005985 Bacteria 1262
93 Ga0070717_10005026 3300006028 Bacteria 9633
94 Ga0070717_10009324 3300006028 Bacteria 7375
95 Ga0070717_10049074 3300006028 Bacteria 3465
96 Ga0070717_10080190 3300006028 Bacteria 2738
97 Ga0070717_10158320 3300006028 Bacteria 1963
98 Ga0075432_10092983 3300006058 Bacteria 1106
99 Ga0070716_100006766 3300006173 Bacteria 5617
100 Ga0070712_100057647 3300006175 Bacteria 2729
101 Ga0070712_100353577 3300006175 Bacteria 1203
102 Ga0070712_100435077 3300006175 Bacteria 1090
103 Ga0075431_100359045 3300006847 Bacteria 1464
104 Ga0075434_100049758 3300006871 Bacteria 4162
105 Ga0075436_100319311 3300006914 Bacteria 1116
106 Ga0097620_100031011 3300006931 Bacteria 5366
107 Ga0075435_100039164 3300007076 Bacteria 3782
108 Ga0105250_10061522 3300009092 Bacteria 1510
109 Ga0105240_10016431 3300009093 Bacteria 10021
110 Ga0105245_10218851 3300009098 Bacteria 1836
111 Ga0105243_10006458 3300009148 Bacteria 9068
112 Ga0105241_10036750 3300009174 Bacteria 3687
113 Ga0105242_10469041 3300009176 Bacteria 1191
114 Ga0105248_10009297 3300009177 Bacteria 10823
115 Ga0105237_10026295 3300009545 Bacteria 5947
116 Ga0105238_10053855 3300009551 Bacteria 4043
117 Ga0105249_10002831 3300009553 Bacteria 14964
118 Ga0105239_10472874 3300010375 Bacteria 1423
119 Ga0105246_10004485 3300011119 Bacteria 8493
120 Ga0157371_10076507 3300013102 Bacteria 2370
121 Ga0157370_10115080 3300013104 Bacteria 2512
122 Ga0157369_10617490 3300013105 Bacteria 1119
123 Ga0157374_10004617 3300013296 Bacteria 11555
124 Ga0157378_10023457 3300013297 Bacteria 5430
125 Ga0163162_10434787 3300013306 Bacteria 1444
126 Ga0157372_10395192 3300013307 Bacteria 1611
127 Ga0157375_10166022 3300013308 Bacteria 2352
128 Ga0163163_10022652 3300014325 Bacteria 5953
129 Ga0157380_10010477 3300014326 Bacteria 6670
130 Ga0157379_10051316 3300014968 Bacteria 3684
131 Ga0157376_10276774 3300014969 Bacteria 1579
132 Ga0163161_10008807 3300017792 Bacteria 6976
133 Ga0207653_10015480 3300025885 Bacteria 2393
134 Ga0207710_10009901 3300025900 Bacteria 4008
135 Ga0207685_10150725 3300025905 Bacteria 1052
136 Ga0207684_10000087 3300025910 Bacteria 173557
137 Ga0207684_10000553 3300025910 Bacteria 46035
138 Ga0207684_10001248 3300025910 Bacteria 28201
139 Ga0207684_10003997 3300025910 Bacteria 14106
140 Ga0207684_10011958 3300025910 Bacteria 7560
141 Ga0207684_10015999 3300025910 Bacteria 6443
142 Ga0207684_10018316 3300025910 Bacteria 5994
143 Ga0207684_10019141 3300025910 Bacteria 5856
144 Ga0207684_10037392 3300025910 Bacteria 4119
145 Ga0207684_10091523 3300025910 Bacteria 2592
146 Ga0207654_10023736 3300025911 Bacteria 3290
147 Ga0207707_10064570 3300025912 Bacteria 3187
148 Ga0207671_10067546 3300025914 Bacteria 2663
149 Ga0207693_10004085 3300025915 Bacteria 12400
150 Ga0207693_10207851 3300025915 Bacteria 1539
151 Ga0207663_10166315 3300025916 Bacteria 1562
152 Ga0207657_10001324 3300025919 Bacteria 26328
153 Ga0207646_10001607 3300025922 Bacteria 27577
154 Ga0207646_10001679 3300025922 Bacteria 26968
155 Ga0207646_10008579 3300025922 Bacteria 10215
156 Ga0207646_10009487 3300025922 Bacteria 9616
157 Ga0207646_10010233 3300025922 Bacteria 9185
158 Ga0207646_10016846 3300025922 Bacteria 6854
159 Ga0207646_10022432 3300025922 Bacteria 5815
160 Ga0207646_10049225 3300025922 Bacteria 3775
161 Ga0207646_10054653 3300025922 Bacteria 3571
162 Ga0207646_10152787 3300025922 Bacteria 2082
163 Ga0207646_10176846 3300025922 Bacteria 1928
164 Ga0207694_10174724 3300025924 Bacteria 1740
165 Ga0207687_10156599 3300025927 Bacteria 1744
166 Ga0207687_10428258 3300025927 Bacteria 1093
167 Ga0207700_10218296 3300025928 Bacteria 1615
168 Ga0207700_10312422 3300025928 Unclassified 1360
169 Ga0207700_10355483 3300025928 Unclassified 1276
170 Ga0207664_10076560 3300025929 Bacteria 2708
171 Ga0207664_10548844 3300025929 Unclassified 1037
172 Ga0207665_10002197 3300025939 Bacteria 13177
173 Ga0207665_10109838 3300025939 Bacteria 1936
174 Ga0207711_10401062 3300025941 Bacteria 1274
175 Ga0207689_10244819 3300025942 Bacteria 1482
176 Ga0207712_10108315 3300025961 Bacteria 2079
177 Ga0207712_10654532 3300025961 Bacteria 913
178 Ga0207658_10321323 3300025986 Bacteria 1340
179 Ga0207703_10350759 3300026035 Bacteria 1358
180 Ga0207639_10069942 3300026041 Bacteria 2740
181 Ga0207678_10082590 3300026067 Bacteria 2749
182 Ga0207702_10298477 3300026078 Bacteria 1528
183 Ga0207675_100014409 3300026118 Bacteria 7370
184 Ga0207683_10006485 3300026121 Bacteria 10013
185 Ga0268266_10470390 3300028379 Bacteria 1197
186 Ga0268264_10153610 3300028381 Bacteria 2066
187 Ga0265318_10108886 3300028577 Bacteria 1018
188 Ga0265338_10009839 3300028800 Bacteria 11329
189 Ga0265338_10092879 3300028800 Bacteria 2488
190 Ga0265338_10151784 3300028800 Bacteria 1799
191 Ga0265320_10135108 3300031240 Bacteria 1119
192 Ga0265325_10135220 3300031241 Bacteria 1177
193 Ga0265340_10025809 3300031247 Bacteria 2973
194 Ga0316576_10011991 3300031727 Bacteria 5706
195 Ga0316576_10016636 3300031727 Bacteria 4974
196 Ga0316578_10057438 3300031728 Bacteria 2286
197 Ga0316578_10073678 3300031728 Bacteria 2024
198 Ga0307413_10376819 3300031824 Bacteria 1104
199 Ga0307409_100212771 3300031995 Bacteria 1739
200 Ga0373930_0017714 3300034816 Bacteria 1361
201 Ga0373929_0024975 3300035085 Bacteria 1238
202 Ga0373951_0075792 3300035091 Bacteria 863
203 Ga0373939_0003868 3300035114 Bacteria 3524
204 Ga0373943_0238735 3300035170 Bacteria 1018
205 Ga0316574_0229560 3300035398 Bacteria 1188
206 Ga0373931_0002495 3300035691 Bacteria 8165
207 Ga0316584_0001856 3300036712 Bacteria 13089
208 Ga0316584_0005548 3300036712 Bacteria 8485
209 Ga0395900_0023628 3300037418 Bacteria 6289
210 Ga0395898_0090245 3300037466 Bacteria 2949
211 Ga0436364_0996463 3300037853 Bacteria 1309
212 Ga0395901_0214819 3300038443 Bacteria 2012
213 Ga0436365_0817396 3300039437 Bacteria 3414
214 Ga0436365_1430061 3300039437 Bacteria 1572
215 Ga0436365_1545715 3300039437 Bacteria 1160
216 Ga0436362_0269004 3300039453 Bacteria 2566
217 Ga0451793_0821335 3300041452 Bacteria 961
218 Ga0439448_0005015 3300042005 Bacteria 3762
219 Ga0439450_006347 3300042008 Bacteria 2125
220 Ga0439454_022933 3300042011 Bacteria 933
221 Ga0439463_007684 3300042016 Bacteria 2662
222 Ga0450913_000779 3300042117 Bacteria 1516
223 Ga0450902_002730 3300042137 Bacteria 2518
224 Ga0450889_006893 3300042144 Bacteria 1143
225 Ga0439444_0014929 3300042437 Bacteria 1304
226 Ga0439464_0002478 3300042439 Bacteria 4547
227 Ga0450916_001779 3300042530 Bacteria 2198
228 Ga0466966_0029044 3300044684 Bacteria 3600
229 Ga0466963_0388793 3300044694 Bacteria 983
230 Ga0466958_0225944 3300045836 Bacteria 1195
231 Ga0466967_0075930 3300045976 Bacteria 3021
232 Ga0466967_0115759 3300045976 Bacteria 2469
233 Ga0466967_0153985 3300045976 Bacteria 2151
234 Ga0466967_0608497 3300045976 Bacteria 1079
235 Ga0495586_0315626 3300046535 Unclassified 896
236 Ga0496100_0068420 3300048903 Bacteria 2361
237 Ga0496101_0645863 3300048904 Bacteria 836
238 Ga0496103_0133433 3300048906 Bacteria 1586
239 Ga0496104_0041654 3300048907 Bacteria 4307
240 Ga0496104_0115464 3300048907 Bacteria 2576
241 Ga0496105_0004375 3300048908 Bacteria 10635
242 Ga0496107_0151689 3300048910 Bacteria 1714
243 Ga0496108_0013056 3300048911 Bacteria 6769
244 Ga0496109_0032368 3300048912 Bacteria 4700
245 Ga0496110_0179661 3300048913 Bacteria 1921
246 Ga0496111_0012057 3300048914 Bacteria 5844
247 Ga0496112_0025358 3300048915 Bacteria 5693
248 Ga0496112_0149872 3300048915 Bacteria 2300
249 Ga0496113_0008060 3300048916 Bacteria 6836
250 Ga0496114_0055039 3300048917 Bacteria 3317
251 Ga0496114_0067779 3300048917 Bacteria 2994
252 Ga0496115_0069520 3300048918 Bacteria 2852
253 Ga0501034_0378210 3300049571 Bacteria 1341
254 Ga0501070_0159207 3300049586 Bacteria 1862
255 nmdc:mga07m45_175898_c1 3300050496 Bacteria 1244
256 nmdc:mga0qj67_333316_c1 3300050509 Bacteria 1228
257 nmdc:mga0n895_276002_c1 3300050512 Bacteria 1705
258 nmdc:mga0rr50_10858_c1 3300050513 Bacteria 5806
259 nmdc:mga0a205_31736_c1 3300050515 Bacteria 5063
260 Ga0500568_0002516 3300053139 Bacteria 10726
261 2623500360 2622736605 Bacteria 4992138
262 Ga0070714_100029613
263 JGI25407J50210_10012908
264 Ga0068869_100231367
265 Ga0070666_10027991
266 Ga0070682_100007173
267 Ga0068868_100220445
268 Ga0070692_10140167
269 Ga0070671_100403561
270 Ga0070674_100437484
271 Ga0070659_100011347
272 Ga0070667_100379013
273 Ga0070709_10060356
274 Ga0070709_10191180
275 Ga0070714_100000012
276 Ga0070714_100038331
277 Ga0070714_100504787
278 Ga0070714_100574442
279 Ga0070713_100191180
280 Ga0070710_10071870
281 Ga0070710_10134540
282 Ga0070701_10081104
283 Ga0070711_100002232
284 Ga0070705_100135475
285 Ga0070700_100058735
286 Ga0070694_100015483
287 Ga0070708_100006156
288 Ga0070708_100021793
289 Ga0070708_100188021
290 Ga0070708_100259206
291 Ga0070708_100310114
292 Ga0070708_100360514
293 Ga0070663_100217805
294 Ga0070678_100031002
295 Ga0070681_10066862
296 Ga0068867_100254949
297 Ga0070706_100000102
298 Ga0070706_100001708
299 Ga0070706_100002164
300 Ga0070706_100010717
301 Ga0070706_100013502
302 Ga0070706_100019963
303 Ga0070706_100061124
304 Ga0070706_100127322
305 Ga0070707_100003411
306 Ga0070707_100030172
307 Ga0070707_100032507
308 Ga0070707_100042199
309 Ga0070707_100151084
310 Ga0070707_100192789
311 Ga0070698_100001082
312 Ga0070698_100001292
313 Ga0070698_100017823
314 Ga0070698_100019371
315 Ga0070698_100047624
316 Ga0070698_100249916
317 Ga0070698_100250353
318 Ga0070698_100301341
319 Ga0070698_100322386
320 Ga0070698_100685565
321 Ga0070699_100002301
322 Ga0070699_100009064
323 Ga0070699_100012047
324 Ga0070699_100188808
325 Ga0070699_100208439
326 Ga0070699_100380252
327 Ga0070684_100489138
328 Ga0070697_100000020
329 Ga0070697_100005119
330 Ga0070697_100005925
331 Ga0070697_100008247
332 Ga0070697_100229913
333 Ga0068853_100047941
334 Ga0070695_100019935
335 Ga0070696_100023759
336 Ga0070693_100008424
337 Ga0070665_100074961
338 Ga0070665_100269861
339 Ga0068855_100057348
340 Ga0068857_100022399
341 Ga0068856_100424275
342 Ga0070702_100016819
343 Ga0068852_100055029
344 Ga0068859_100031010
345 Ga0068864_100493911
346 Ga0068861_100019194
347 Ga0068863_100051618
348 Ga0068860_100035816
349 Ga0081455_10056143
350 Ga0081538_10005216
351 Ga0081540_1011984
352 Ga0081540_1019507
353 Ga0081539_10126496
354 Ga0070717_10005026
355 Ga0070717_10009324
356 Ga0070717_10049074
357 Ga0070717_10080190
358 Ga0070717_10158320
359 Ga0075432_10092983
360 Ga0070716_100006766
361 Ga0070712_100057647
362 Ga0070712_100353577
363 Ga0070712_100435077
364 Ga0075431_100359045
365 Ga0075434_100049758
366 Ga0075436_100319311
367 Ga0097620_100031011
368 Ga0075435_100039164
369 Ga0105250_10061522
370 Ga0105240_10016431
371 Ga0105245_10218851
372 Ga0105243_10006458
373 Ga0105241_10036750
374 Ga0105242_10469041
375 Ga0105248_10009297
376 Ga0105237_10026295
377 Ga0105238_10053855
378 Ga0105249_10002831
379 Ga0105239_10472874
380 Ga0105246_10004485
381 Ga0157371_10076507
382 Ga0157370_10115080
383 Ga0157369_10617490
384 Ga0157374_10004617
385 Ga0157378_10023457
386 Ga0163162_10434787
387 Ga0157372_10395192
388 Ga0157375_10166022
389 Ga0163163_10022652
390 Ga0157380_10010477
391 Ga0157379_10051316
392 Ga0157376_10276774
393 Ga0163161_10008807
394 Ga0207653_10015480
395 Ga0207710_10009901
396 Ga0207685_10150725
397 Ga0207684_10000087
398 Ga0207684_10000553
399 Ga0207684_10001248
400 Ga0207684_10003997
401 Ga0207684_10011958
402 Ga0207684_10015999
403 Ga0207684_10018316
404 Ga0207684_10019141
405 Ga0207684_10037392
406 Ga0207684_10091523
407 Ga0207654_10023736
408 Ga0207707_10064570
409 Ga0207671_10067546
410 Ga0207693_10004085
411 Ga0207693_10207851
412 Ga0207663_10166315
413 Ga0207657_10001324
414 Ga0207646_10001607
415 Ga0207646_10001679
416 Ga0207646_10008579
417 Ga0207646_10009487
418 Ga0207646_10010233
419 Ga0207646_10016846
420 Ga0207646_10022432
421 Ga0207646_10049225
422 Ga0207646_10054653
423 Ga0207646_10152787
424 Ga0207646_10176846
425 Ga0207694_10174724
426 Ga0207687_10156599
427 Ga0207687_10428258
428 Ga0207700_10218296
429 Ga0207700_10312422
430 Ga0207700_10355483
431 Ga0207664_10076560
432 Ga0207664_10548844
433 Ga0207665_10002197
434 Ga0207665_10109838
435 Ga0207711_10401062
436 Ga0207689_10244819
437 Ga0207712_10108315
438 Ga0207712_10654532
439 Ga0207658_10321323
440 Ga0207703_10350759
441 Ga0207639_10069942
442 Ga0207678_10082590
443 Ga0207702_10298477
444 Ga0207675_100014409
445 Ga0207683_10006485
446 Ga0268266_10470390
447 Ga0268264_10153610
448 Ga0265318_10108886
449 Ga0265338_10009839
450 Ga0265338_10092879
451 Ga0265338_10151784
452 Ga0265320_10135108
453 Ga0265325_10135220
454 Ga0265340_10025809
455 Ga0316576_10011991
456 Ga0316576_10016636
457 Ga0316578_10057438
458 Ga0316578_10073678
459 Ga0307413_10376819
460 Ga0307409_100212771
461 Ga0373930_0017714
462 Ga0373929_0024975
463 Ga0373951_0075792
464 Ga0373939_0003868
465 Ga0373943_0238735
466 Ga0316574_0229560
467 Ga0373931_0002495
468 Ga0316584_0001856
469 Ga0316584_0005548
470 Ga0395900_0023628
471 Ga0395898_0090245
472 Ga0436364_0996463
473 Ga0395901_0214819
474 Ga0436365_0817396
475 Ga0436365_1430061
476 Ga0436365_1545715
477 Ga0436362_0269004
478 Ga0451793_0821335
479 Ga0439448_0005015
480 Ga0439450_006347
481 Ga0439454_022933
482 Ga0439463_007684
483 Ga0450913_000779
484 Ga0450902_002730
485 Ga0450889_006893
486 Ga0439444_0014929
487 Ga0439464_0002478
488 Ga0450916_001779
489 Ga0466966_0029044
490 Ga0466963_0388793
491 Ga0466958_0225944
492 Ga0466967_0075930
493 Ga0466967_0115759
494 Ga0466967_0153985
495 Ga0466967_0608497
496 Ga0495586_0315626
497 Ga0496100_0068420
498 Ga0496101_0645863
499 Ga0496103_0133433
500 Ga0496104_0041654
501 Ga0496104_0115464
502 Ga0496105_0004375
503 Ga0496107_0151689
504 Ga0496108_0013056
505 Ga0496109_0032368
506 Ga0496110_0179661
507 Ga0496111_0012057
508 Ga0496112_0025358
509 Ga0496112_0149872
510 Ga0496113_0008060
511 Ga0496114_0055039
512 Ga0496114_0067779
513 Ga0496115_0069520
514 Ga0501034_0378210
515 Ga0501070_0159207
516 nmdc:mga07m45_175898_c1
517 nmdc:mga0qj67_333316_c1
518 nmdc:mga0n895_276002_c1
519 nmdc:mga0rr50_10858_c1
520 nmdc:mga0a205_31736_c1
521 Ga0500568_0002516
522 2623500360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

29

240

0.91

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

54

274

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p03-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation without nucleotides 0.6176 25 210
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.5812 27 248
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.5798 27 248
8wba-assembly1.cif.gz_A cryo-em structure of the abcg25 bound to chs 0.5795 24 216
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.5785 27 248
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6733 77 242 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6706 56 229 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6613 79 242 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4911 56 229 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4763 77 242 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A0J7ZPY4-F1-model_v4 Transport permease protein 0.8848 22 249 GO:0043190
GO:0140359
AF-A0A372JM27-F1-model_v4 Transport permease protein 0.8697 30 249 GO:0043190
GO:0140359
AF-A0A5N0E5X0-F1-model_v4 ABC transporter permease 0.867 26 158 GO:0016020
GO:0140359
AF-A0A1J7BHB3-F1-model_v4 Transport permease protein 0.8669 27 247 GO:0043190
GO:0140359
AF-A0A7K2XKS1-F1-model_v4 ABC transporter permease 0.8648 26 140 GO:0016020
GO:0140359

Map