F369773

General Info

Members Datasets Scaffolds Average Seq Length
260 158 520 237

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0156513|Ga0466967_0156513_395_1114
Length 239
Sequence MIGRAVRATICLPTYNELSNLEPMARALQPLLRDGDRLLIVDDGSPDGTGAVADTLAAELPFVDVLHRPRKDGLGPAYLAGFARALADGAELVLEMDCDFSHDPADVPRLIAAAEDGADLVLGSRYAAGGGVSDWGLMRRAISRGASVYTAVFLRMGVKDPTGGFKCFRRQVLETLDLGAITSKGYAFQIETTYRAKRAGFTVVEIPITFADRTRGRSKMSRAIVLEAIWRVPLLRLRV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
99 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
100 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 19.62
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0156513 3300045976 Bacteria 2135
2 Ga0070683_100001446 3300005329 Bacteria 18256
3 Ga0070690_100203755 3300005330 Bacteria 1378
4 Ga0070680_100048052 3300005336 Bacteria 3477
5 Ga0070680_100439399 3300005336 Bacteria 1114
6 Ga0070682_100173139 3300005337 Bacteria 1502
7 Ga0068868_100044332 3300005338 Bacteria 3478
8 Ga0068868_100338601 3300005338 Bacteria 1286
9 Ga0070661_100144142 3300005344 Bacteria 1797
10 Ga0070668_100011671 3300005347 Bacteria 6540
11 Ga0070668_100378040 3300005347 Bacteria 1205
12 Ga0070674_100000969 3300005356 Bacteria 14961
13 Ga0070674_100182920 3300005356 Bacteria 1607
14 Ga0070700_100196192 3300005441 Bacteria 1415
15 Ga0070708_100024788 3300005445 Bacteria 5123
16 Ga0070708_100252431 3300005445 Bacteria 1657
17 Ga0070678_100070780 3300005456 Bacteria 2609
18 Ga0070678_100276127 3300005456 Bacteria 1419
19 Ga0070681_10022825 3300005458 Bacteria 6288
20 Ga0070706_100072503 3300005467 Bacteria 3187
21 Ga0070698_100032557 3300005471 Bacteria 5399
22 Ga0070698_100107132 3300005471 Bacteria 2763
23 Ga0070679_100041046 3300005530 Bacteria 4606
24 Ga0070684_100005250 3300005535 Bacteria 9912
25 Ga0070684_100146458 3300005535 Bacteria 2138
26 Ga0070697_100156349 3300005536 Bacteria 1925
27 Ga0070697_100250076 3300005536 Bacteria 1516
28 Ga0070696_100047562 3300005546 Bacteria 2977
29 Ga0070693_100007458 3300005547 Bacteria 5350
30 Ga0070704_100039300 3300005549 Bacteria 3247
31 Ga0068855_100049567 3300005563 Bacteria 4953
32 Ga0068856_100024924 3300005614 Bacteria 5828
33 Ga0068856_100118804 3300005614 Bacteria 2644
34 Ga0068856_100428295 3300005614 Bacteria 1343
35 Ga0068864_100000035 3300005618 Bacteria 195218
36 Ga0068861_100005908 3300005719 Bacteria 8318
37 Ga0068870_10120271 3300005840 Bacteria 1512
38 Ga0081455_10016478 3300005937 Bacteria 7133
39 Ga0081540_1003264 3300005983 Bacteria 12889
40 Ga0075364_10289296 3300006051 Bacteria 1115
41 Ga0075432_10018687 3300006058 Bacteria 2365
42 Ga0097621_100169369 3300006237 Bacteria 1882
43 Ga0075428_100115031 3300006844 Bacteria 2930
44 Ga0075433_10197452 3300006852 Bacteria 1789
45 Ga0075435_100111292 3300007076 Bacteria 2278
46 Ga0075435_100194972 3300007076 Bacteria 1715
47 Ga0075435_100209079 3300007076 Bacteria 1655
48 Ga0111539_10057101 3300009094 Bacteria 4636
49 Ga0111539_10480235 3300009094 Bacteria 1447
50 Ga0105245_10010436 3300009098 Bacteria 8087
51 Ga0105245_10048648 3300009098 Bacteria 3793
52 Ga0105245_10169176 3300009098 Bacteria 2080
53 Ga0105245_10509820 3300009098 Bacteria 1220
54 Ga0105245_10769810 3300009098 Bacteria 999
55 Ga0114129_10130155 3300009147 Bacteria 3457
56 Ga0114129_10194411 3300009147 Bacteria 2752
57 Ga0105243_10139239 3300009148 Bacteria 2068
58 Ga0105242_10014401 3300009176 Bacteria 6128
59 Ga0105248_10538805 3300009177 Bacteria 1317
60 Ga0105249_10087710 3300009553 Bacteria 2904
61 Ga0105249_10109082 3300009553 Bacteria 2614
62 Ga0105239_10144598 3300010375 Bacteria 2651
63 Ga0157323_1002448 3300012495 Bacteria 1034
64 Ga0157374_10221568 3300013296 Bacteria 1856
65 Ga0163162_10272207 3300013306 Bacteria 1825
66 Ga0163162_10812478 3300013306 Bacteria 1052
67 Ga0157375_10196956 3300013308 Bacteria 2170
68 Ga0163163_10376562 3300014325 Bacteria 1477
69 Ga0157377_10229310 3300014745 Bacteria 1193
70 Ga0157379_10178213 3300014968 Bacteria 1920
71 Ga0206353_10398085 3300020082 Bacteria 1985
72 Ga0207642_10041844 3300025899 Bacteria 2009
73 Ga0207684_10215118 3300025910 Bacteria 1658
74 Ga0207707_10076318 3300025912 Bacteria 2925
75 Ga0207660_10051868 3300025917 Bacteria 2918
76 Ga0207649_10048686 3300025920 Bacteria 2615
77 Ga0207652_10034754 3300025921 Bacteria 4250
78 Ga0207687_10014294 3300025927 Bacteria 5193
79 Ga0207687_10102701 3300025927 Bacteria 2107
80 Ga0207687_10538685 3300025927 Bacteria 978
81 Ga0207706_10530173 3300025933 Bacteria 1015
82 Ga0207706_10637628 3300025933 Bacteria 913
83 Ga0207686_10062237 3300025934 Bacteria 2369
84 Ga0207686_10280010 3300025934 Bacteria 1231
85 Ga0207709_10022006 3300025935 Bacteria 3613
86 Ga0207709_10258459 3300025935 Bacteria 1276
87 Ga0207669_10005522 3300025937 Bacteria 5683
88 Ga0207704_10103433 3300025938 Bacteria 1905
89 Ga0207661_10005210 3300025944 Bacteria 9141
90 Ga0207679_10016661 3300025945 Bacteria 4882
91 Ga0207679_10880538 3300025945 Bacteria 818
92 Ga0207668_10058435 3300025972 Bacteria 2696
93 Ga0207640_10237155 3300025981 Bacteria 1407
94 Ga0207677_10047412 3300026023 Bacteria 2885
95 Ga0207677_10066220 3300026023 Bacteria 2525
96 Ga0207708_10194193 3300026075 Bacteria 1617
97 Ga0207702_10006553 3300026078 Bacteria 10017
98 Ga0207702_10675456 3300026078 Bacteria 1017
99 Ga0207702_10748972 3300026078 Bacteria 964
100 Ga0207648_10578766 3300026089 Bacteria 1033
101 Ga0207648_10647916 3300026089 Bacteria 976
102 Ga0207676_10000026 3300026095 Bacteria 248593
103 Ga0207675_100000962 3300026118 Bacteria 28741
104 Ga0207675_100695942 3300026118 Bacteria 1025
105 Ga0207675_100851643 3300026118 Bacteria 927
106 Ga0207683_10032640 3300026121 Bacteria 4523
107 Ga0207428_10009640 3300027907 Bacteria 8648
108 Ga0207428_10051694 3300027907 Bacteria 3284
109 Ga0207428_10161873 3300027907 Bacteria 1699
110 Ga0265334_10052001 3300028573 Bacteria 1569
111 Ga0265322_10005348 3300028654 Bacteria 3802
112 Ga0265338_10026859 3300028800 Bacteria 5792
113 Ga0265330_10016499 3300031235 Bacteria 3406
114 Ga0265325_10005673 3300031241 Bacteria 7678
115 Ga0265340_10055752 3300031247 Bacteria 1903
116 Ga0265339_10105680 3300031249 Bacteria 1461
117 Ga0265331_10044347 3300031250 Bacteria 2151
118 Ga0265327_10018057 3300031251 Bacteria 4388
119 Ga0265316_10025770 3300031344 Bacteria 4901
120 Ga0265313_10006663 3300031595 Bacteria 8099
121 Ga0265314_10021385 3300031711 Bacteria 4974
122 Ga0265342_10028664 3300031712 Bacteria 3465
123 Ga0307412_10129304 3300031911 Bacteria 1832
124 Ga0307416_100355467 3300032002 Bacteria 1485
125 Ga0307415_100191531 3300032126 Bacteria 1614
126 Ga0395899_0001850 3300037312 Bacteria 17517
127 Ga0395899_0006282 3300037312 Bacteria 9199
128 Ga0395899_0248404 3300037312 Bacteria 1222
129 Ga0395899_0253472 3300037312 Bacteria 1207
130 Ga0395899_0359790 3300037312 Bacteria 971
131 Ga0395900_0017295 3300037418 Bacteria 7359
132 Ga0395900_0097407 3300037418 Bacteria 3022
133 Ga0395900_0162719 3300037418 Bacteria 2275
134 Ga0395898_0085353 3300037466 Bacteria 3043
135 Ga0395898_0098702 3300037466 Bacteria 2804
136 Ga0395898_0113372 3300037466 Bacteria 2598
137 Ga0395898_0117741 3300037466 Bacteria 2545
138 Ga0395898_0154276 3300037466 Bacteria 2197
139 Ga0395898_0401622 3300037466 Bacteria 1307
140 Ga0395905_0002227 3300037471 Bacteria 21873
141 Ga0395905_0054893 3300037471 Bacteria 3728
142 Ga0395901_0000244 3300038443 Bacteria 67684
143 Ga0395901_0028144 3300038443 Bacteria 5781
144 Ga0395901_0320166 3300038443 Bacteria 1605
145 Ga0395901_0343316 3300038443 Bacteria 1542
146 Ga0395901_0603818 3300038443 Bacteria 1106
147 Ga0436362_1152412 3300039453 Bacteria 4084
148 Ga0439448_0004265 3300042005 Bacteria 4031
149 Ga0439451_005613 3300042009 Bacteria 2562
150 Ga0439454_001312 3300042011 Bacteria 2355
151 Ga0450905_029161 3300042142 Bacteria 845
152 Ga0439446_0036564 3300042156 Bacteria 1435
153 Ga0439458_0027637 3300042157 Bacteria 1339
154 Ga0439464_0014631 3300042439 Bacteria 2111
155 Ga0466960_0069379 3300044901 Bacteria 1751
156 Ga0495603_0052365 3300046455 Bacteria 2424
157 Ga0495629_0323332 3300046459 Bacteria 1054
158 Ga0495641_0220872 3300046461 Bacteria 850
159 Ga0495651_0007432 3300046462 Bacteria 8379
160 Ga0495653_0006673 3300046463 Bacteria 9471
161 Ga0495639_0139447 3300046475 Bacteria 1165
162 Ga0495662_0135323 3300046476 Bacteria 1212
163 Ga0495664_0053831 3300046477 Bacteria 2393
164 Ga0495664_0085603 3300046477 Bacteria 1893
165 Ga0495584_0055445 3300046491 Bacteria 1995
166 Ga0495608_0018058 3300046511 Bacteria 4873
167 Ga0495618_0030279 3300046514 Bacteria 3380
168 Ga0495628_0019952 3300046516 Bacteria 5537
169 Ga0495609_0077138 3300046538 Bacteria 1460
170 Ga0495645_0120779 3300046543 Bacteria 1845
171 Ga0495656_0222795 3300046615 Bacteria 944
172 Ga0495656_0255206 3300046615 Bacteria 887
173 Ga0495634_0018539 3300046642 Bacteria 4954
174 Ga0495599_0150968 3300046678 Bacteria 1439
175 Ga0495624_0161811 3300046690 Bacteria 1367
176 Ga0495604_0189877 3300047317 Bacteria 1432
177 Ga0495636_0097909 3300047318 Bacteria 1280
178 Ga0495674_0000604 3300047319 Bacteria 33665
179 Ga0495676_0075454 3300047321 Bacteria 2579
180 Ga0495676_0121442 3300047321 Bacteria 1900
181 Ga0495680_0001294 3300047322 Bacteria 27286
182 Ga0495684_0003511 3300047471 Bacteria 12266
183 Ga0496100_0003355 3300048903 Bacteria 8344
184 Ga0496100_0137991 3300048903 Bacteria 1725
185 Ga0496100_0294618 3300048903 Bacteria 1213
186 Ga0496101_0000511 3300048904 Bacteria 24342
187 Ga0496101_0097263 3300048904 Bacteria 2198
188 Ga0496102_0003301 3300048905 Bacteria 13675
189 Ga0496102_0057379 3300048905 Bacteria 3555
190 Ga0496102_0220693 3300048905 Bacteria 1787
191 Ga0496102_0657949 3300048905 Bacteria 971
192 Ga0496103_0051907 3300048906 Bacteria 2539
193 Ga0496103_0268572 3300048906 Bacteria 1097
194 Ga0496103_0354648 3300048906 Bacteria 943
195 Ga0496104_0000085 3300048907 Bacteria 90352
196 Ga0496104_0186961 3300048907 Bacteria 1982
197 Ga0496104_0195240 3300048907 Bacteria 1936
198 Ga0496104_0237815 3300048907 Bacteria 1733
199 Ga0496105_0002537 3300048908 Bacteria 13250
200 Ga0496105_0009504 3300048908 Bacteria 7606
201 Ga0496105_0051864 3300048908 Bacteria 3387
202 Ga0496105_0209280 3300048908 Bacteria 1590
203 Ga0496106_0171856 3300048909 Bacteria 1718
204 Ga0496107_0140790 3300048910 Bacteria 1783
205 Ga0496107_0305776 3300048910 Bacteria 1183
206 Ga0496108_0026898 3300048911 Bacteria 4747
207 Ga0496108_0269049 3300048911 Bacteria 1483
208 Ga0496109_0000212 3300048912 Bacteria 56945
209 Ga0496109_0007042 3300048912 Bacteria 9487
210 Ga0496109_0007980 3300048912 Bacteria 8974
211 Ga0496109_0154930 3300048912 Bacteria 2146
212 Ga0496109_0328351 3300048912 Bacteria 1444
213 Ga0496110_0000288 3300048913 Bacteria 32994
214 Ga0496110_0000488 3300048913 Bacteria 26929
215 Ga0496110_0012649 3300048913 Bacteria 6944
216 Ga0496110_0095187 3300048913 Bacteria 2667
217 Ga0496111_0000178 3300048914 Bacteria 28805
218 Ga0496111_0000284 3300048914 Bacteria 24558
219 Ga0496111_0056931 3300048914 Bacteria 2829
220 Ga0496111_0114996 3300048914 Bacteria 1983
221 Ga0496112_0000231 3300048915 Bacteria 35940
222 Ga0496112_0018598 3300048915 Bacteria 6546
223 Ga0496112_0062500 3300048915 Bacteria 3673
224 Ga0496113_0000010 3300048916 Bacteria 86561
225 Ga0496113_0018349 3300048916 Bacteria 4870
226 Ga0496113_0199576 3300048916 Bacteria 1590
227 Ga0496113_0312638 3300048916 Bacteria 1259
228 Ga0496114_0000943 3300048917 Bacteria 21746
229 Ga0496114_0007657 3300048917 Bacteria 8540
230 Ga0496114_0070216 3300048917 Bacteria 2941
231 Ga0496114_0163836 3300048917 Bacteria 1935
232 Ga0496114_0309222 3300048917 Bacteria 1396
233 Ga0496114_0638015 3300048917 Bacteria 938
234 Ga0501040_0410930 3300049576 Bacteria 972
235 Ga0501042_0282599 3300049578 Bacteria 1199
236 Ga0501048_0287508 3300049582 Bacteria 1169
237 Ga0501076_0252939 3300049592 Bacteria 1442
238 Ga0501077_0183209 3300049593 Bacteria 1331
239 Ga0501077_0318307 3300049593 Bacteria 992
240 Ga0501077_0594874 3300049593 Unclassified 710
241 Ga0501081_0016243 3300049743 Bacteria 4920
242 nmdc:mga00v17_343721_c1 3300050491 Bacteria 970
243 nmdc:mga05p37_49610_c1 3300050507 Bacteria 5163
244 nmdc:mga05p37_782037_c1 3300050507 Bacteria 1047
245 nmdc:mga05p37_87351_c1 3300050507 Bacteria 3843
246 nmdc:mga08y16_112978_c1 3300050511 Bacteria 2828
247 nmdc:mga08y16_161426_c1 3300050511 Bacteria 2329
248 nmdc:mga0n895_212139_c1 3300050512 Bacteria 1966
249 nmdc:mga0n895_404840_c1 3300050512 Bacteria 1380
250 nmdc:mga0n895_58521_c1 3300050512 Bacteria 3800
251 nmdc:mga0rr50_122680_c1 3300050513 Bacteria 2070
252 nmdc:mga0rr50_467377_c1 3300050513 Bacteria 1070
253 nmdc:mga08x19_39640_c1 3300050514 Bacteria 2995
254 nmdc:mga0a205_377694_c1 3300050515 Bacteria 1283
255 nmdc:mga0a205_457941_c1 3300050515 Bacteria 1135
256 nmdc:mga0a205_469306_c1 3300050515 Bacteria 1117
257 Ga0495619_0082987 3300053085 Bacteria 2161
258 Ga0495619_0108374 3300053085 Bacteria 1896
259 Ga0501082_0008223 3300060353 Bacteria 8998
260 Ga0501082_0338153 3300060353 Bacteria 1312
261 Ga0466967_0156513
262 Ga0070683_100001446
263 Ga0070690_100203755
264 Ga0070680_100048052
265 Ga0070680_100439399
266 Ga0070682_100173139
267 Ga0068868_100044332
268 Ga0068868_100338601
269 Ga0070661_100144142
270 Ga0070668_100011671
271 Ga0070668_100378040
272 Ga0070674_100000969
273 Ga0070674_100182920
274 Ga0070700_100196192
275 Ga0070708_100024788
276 Ga0070708_100252431
277 Ga0070678_100070780
278 Ga0070678_100276127
279 Ga0070681_10022825
280 Ga0070706_100072503
281 Ga0070698_100032557
282 Ga0070698_100107132
283 Ga0070679_100041046
284 Ga0070684_100005250
285 Ga0070684_100146458
286 Ga0070697_100156349
287 Ga0070697_100250076
288 Ga0070696_100047562
289 Ga0070693_100007458
290 Ga0070704_100039300
291 Ga0068855_100049567
292 Ga0068856_100024924
293 Ga0068856_100118804
294 Ga0068856_100428295
295 Ga0068864_100000035
296 Ga0068861_100005908
297 Ga0068870_10120271
298 Ga0081455_10016478
299 Ga0081540_1003264
300 Ga0075364_10289296
301 Ga0075432_10018687
302 Ga0097621_100169369
303 Ga0075428_100115031
304 Ga0075433_10197452
305 Ga0075435_100111292
306 Ga0075435_100194972
307 Ga0075435_100209079
308 Ga0111539_10057101
309 Ga0111539_10480235
310 Ga0105245_10010436
311 Ga0105245_10048648
312 Ga0105245_10169176
313 Ga0105245_10509820
314 Ga0105245_10769810
315 Ga0114129_10130155
316 Ga0114129_10194411
317 Ga0105243_10139239
318 Ga0105242_10014401
319 Ga0105248_10538805
320 Ga0105249_10087710
321 Ga0105249_10109082
322 Ga0105239_10144598
323 Ga0157323_1002448
324 Ga0157374_10221568
325 Ga0163162_10272207
326 Ga0163162_10812478
327 Ga0157375_10196956
328 Ga0163163_10376562
329 Ga0157377_10229310
330 Ga0157379_10178213
331 Ga0206353_10398085
332 Ga0207642_10041844
333 Ga0207684_10215118
334 Ga0207707_10076318
335 Ga0207660_10051868
336 Ga0207649_10048686
337 Ga0207652_10034754
338 Ga0207687_10014294
339 Ga0207687_10102701
340 Ga0207687_10538685
341 Ga0207706_10530173
342 Ga0207706_10637628
343 Ga0207686_10062237
344 Ga0207686_10280010
345 Ga0207709_10022006
346 Ga0207709_10258459
347 Ga0207669_10005522
348 Ga0207704_10103433
349 Ga0207661_10005210
350 Ga0207679_10016661
351 Ga0207679_10880538
352 Ga0207668_10058435
353 Ga0207640_10237155
354 Ga0207677_10047412
355 Ga0207677_10066220
356 Ga0207708_10194193
357 Ga0207702_10006553
358 Ga0207702_10675456
359 Ga0207702_10748972
360 Ga0207648_10578766
361 Ga0207648_10647916
362 Ga0207676_10000026
363 Ga0207675_100000962
364 Ga0207675_100695942
365 Ga0207675_100851643
366 Ga0207683_10032640
367 Ga0207428_10009640
368 Ga0207428_10051694
369 Ga0207428_10161873
370 Ga0265334_10052001
371 Ga0265322_10005348
372 Ga0265338_10026859
373 Ga0265330_10016499
374 Ga0265325_10005673
375 Ga0265340_10055752
376 Ga0265339_10105680
377 Ga0265331_10044347
378 Ga0265327_10018057
379 Ga0265316_10025770
380 Ga0265313_10006663
381 Ga0265314_10021385
382 Ga0265342_10028664
383 Ga0307412_10129304
384 Ga0307416_100355467
385 Ga0307415_100191531
386 Ga0395899_0001850
387 Ga0395899_0006282
388 Ga0395899_0248404
389 Ga0395899_0253472
390 Ga0395899_0359790
391 Ga0395900_0017295
392 Ga0395900_0097407
393 Ga0395900_0162719
394 Ga0395898_0085353
395 Ga0395898_0098702
396 Ga0395898_0113372
397 Ga0395898_0117741
398 Ga0395898_0154276
399 Ga0395898_0401622
400 Ga0395905_0002227
401 Ga0395905_0054893
402 Ga0395901_0000244
403 Ga0395901_0028144
404 Ga0395901_0320166
405 Ga0395901_0343316
406 Ga0395901_0603818
407 Ga0436362_1152412
408 Ga0439448_0004265
409 Ga0439451_005613
410 Ga0439454_001312
411 Ga0450905_029161
412 Ga0439446_0036564
413 Ga0439458_0027637
414 Ga0439464_0014631
415 Ga0466960_0069379
416 Ga0495603_0052365
417 Ga0495629_0323332
418 Ga0495641_0220872
419 Ga0495651_0007432
420 Ga0495653_0006673
421 Ga0495639_0139447
422 Ga0495662_0135323
423 Ga0495664_0053831
424 Ga0495664_0085603
425 Ga0495584_0055445
426 Ga0495608_0018058
427 Ga0495618_0030279
428 Ga0495628_0019952
429 Ga0495609_0077138
430 Ga0495645_0120779
431 Ga0495656_0222795
432 Ga0495656_0255206
433 Ga0495634_0018539
434 Ga0495599_0150968
435 Ga0495624_0161811
436 Ga0495604_0189877
437 Ga0495636_0097909
438 Ga0495674_0000604
439 Ga0495676_0075454
440 Ga0495676_0121442
441 Ga0495680_0001294
442 Ga0495684_0003511
443 Ga0496100_0003355
444 Ga0496100_0137991
445 Ga0496100_0294618
446 Ga0496101_0000511
447 Ga0496101_0097263
448 Ga0496102_0003301
449 Ga0496102_0057379
450 Ga0496102_0220693
451 Ga0496102_0657949
452 Ga0496103_0051907
453 Ga0496103_0268572
454 Ga0496103_0354648
455 Ga0496104_0000085
456 Ga0496104_0186961
457 Ga0496104_0195240
458 Ga0496104_0237815
459 Ga0496105_0002537
460 Ga0496105_0009504
461 Ga0496105_0051864
462 Ga0496105_0209280
463 Ga0496106_0171856
464 Ga0496107_0140790
465 Ga0496107_0305776
466 Ga0496108_0026898
467 Ga0496108_0269049
468 Ga0496109_0000212
469 Ga0496109_0007042
470 Ga0496109_0007980
471 Ga0496109_0154930
472 Ga0496109_0328351
473 Ga0496110_0000288
474 Ga0496110_0000488
475 Ga0496110_0012649
476 Ga0496110_0095187
477 Ga0496111_0000178
478 Ga0496111_0000284
479 Ga0496111_0056931
480 Ga0496111_0114996
481 Ga0496112_0000231
482 Ga0496112_0018598
483 Ga0496112_0062500
484 Ga0496113_0000010
485 Ga0496113_0018349
486 Ga0496113_0199576
487 Ga0496113_0312638
488 Ga0496114_0000943
489 Ga0496114_0007657
490 Ga0496114_0070216
491 Ga0496114_0163836
492 Ga0496114_0309222
493 Ga0496114_0638015
494 Ga0501040_0410930
495 Ga0501042_0282599
496 Ga0501048_0287508
497 Ga0501076_0252939
498 Ga0501077_0183209
499 Ga0501077_0318307
500 Ga0501077_0594874
501 Ga0501081_0016243
502 nmdc:mga00v17_343721_c1
503 nmdc:mga05p37_49610_c1
504 nmdc:mga05p37_782037_c1
505 nmdc:mga05p37_87351_c1
506 nmdc:mga08y16_112978_c1
507 nmdc:mga08y16_161426_c1
508 nmdc:mga0n895_212139_c1
509 nmdc:mga0n895_404840_c1
510 nmdc:mga0n895_58521_c1
511 nmdc:mga0rr50_122680_c1
512 nmdc:mga0rr50_467377_c1
513 nmdc:mga08x19_39640_c1
514 nmdc:mga0a205_377694_c1
515 nmdc:mga0a205_457941_c1
516 nmdc:mga0a205_469306_c1
517 Ga0495619_0082987
518 Ga0495619_0108374
519 Ga0501082_0008223
520 Ga0501082_0338153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

9

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.874 4 239
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8688 4 238
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8263 4 239
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8015 4 238
5ekp-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7797 1 226
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9551 3 239 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9361 3 239 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8756 4 228 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8647 4 228 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8548 4 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V9CXQ7-F1-model_v4 Polyprenol monophosphomannose synthase 0.9859 20 240 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V9KKX8-F1-model_v4 Polyprenol monophosphomannose synthase 0.9823 1 198 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V9CXQ7-F1-model_v4 Polyprenol monophosphomannose synthase 0.9814 20 240 GO:0004582
GO:0009247
GO:0016020
AF-A0A3C1FE35-F1-model_v4 Dolichol-phosphate mannosyltransferase 0.9808 3 169 GO:0004582
GO:0009247
GO:0016020
AF-A0A535XPX7-F1-model_v4 Polyprenol monophosphomannose synthase 0.9804 2 231 GO:0004582
GO:0009247
GO:0016020

Map