F369470

General Info

Members Datasets Scaffolds Average Seq Length
260 172 520 114

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100468468|Ga0075431_1004684682
Length 130
Sequence MVVEWLLHMAKRTKYENRIELVQGTLDMLVLRTLQWGPQHGHGIGVAIRASSDEALQIDHGSLYPALHRLERQGWIDSDWKTSENNQRAKYYRLTAAGKKQLAAEQSRWNRIVDVIGRVMQGKAPAKERA

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
155 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
156 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 2.69
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 53.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100468468 3300006847 Unclassified 1254
2 JGI25406J46586_10167578 3300003203 Unclassified 640
3 Ga0070658_11152712 3300005327 Unclassified 674
4 Ga0070677_10399014 3300005333 Unclassified 724
5 Ga0068869_100206266 3300005334 Bacteria 1552
6 Ga0070680_100185816 3300005336 Bacteria 1751
7 Ga0070682_101130467 3300005337 Unclassified 657
8 Ga0070660_100272384 3300005339 Bacteria 1384
9 Ga0070661_100121493 3300005344 Unclassified 1957
10 Ga0070692_10086582 3300005345 Unclassified 1696
11 Ga0070668_101755062 3300005347 Unclassified 570
12 Ga0070688_100071578 3300005365 Bacteria 2220
13 Ga0070688_101635439 3300005365 Unclassified 526
14 Ga0070659_100037744 3300005366 Unclassified 3767
15 Ga0070659_100056360 3300005366 Bacteria 3099
16 Ga0070714_100047619 3300005435 Bacteria 3643
17 Ga0070705_100320334 3300005440 Bacteria 1119
18 Ga0070700_100338096 3300005441 Bacteria 1112
19 Ga0070708_100093584 3300005445 Unclassified 2740
20 Ga0070663_100256279 3300005455 Unclassified 1386
21 Ga0070678_101212882 3300005456 Unclassified 700
22 Ga0070662_100788697 3300005457 Bacteria 807
23 Ga0070685_10134882 3300005466 Bacteria 1547
24 Ga0070699_100101884 3300005518 Bacteria 2517
25 Ga0070679_100258149 3300005530 Bacteria 1698
26 Ga0070684_100367844 3300005535 Bacteria 1324
27 Ga0070672_100379840 3300005543 Bacteria 1208
28 Ga0070686_101399083 3300005544 Bacteria 587
29 Ga0070695_100563996 3300005545 Unclassified 889
30 Ga0070695_100739023 3300005545 Unclassified 784
31 Ga0070695_101155964 3300005545 Bacteria 635
32 Ga0070696_100000742 3300005546 Bacteria 20827
33 Ga0070665_100576903 3300005548 Unclassified 1138
34 Ga0070665_101870636 3300005548 Unclassified 606
35 Ga0068855_100006742 3300005563 Bacteria 13927
36 Ga0068855_100244689 3300005563 Bacteria 2002
37 Ga0068855_101331339 3300005563 Unclassified 742
38 Ga0070664_100630259 3300005564 Bacteria 996
39 Ga0068857_100204669 3300005577 Unclassified 1800
40 Ga0068856_100063854 3300005614 Unclassified 3638
41 Ga0068856_100419712 3300005614 Bacteria 1358
42 Ga0068852_101054541 3300005616 Unclassified 832
43 Ga0068852_102199061 3300005616 Unclassified 573
44 Ga0068859_101686139 3300005617 Bacteria 700
45 Ga0081455_10021641 3300005937 Bacteria 6025
46 Ga0070717_10004825 3300006028 Bacteria 9811
47 Ga0070717_10089275 3300006028 Bacteria 2599
48 Ga0070712_100852019 3300006175 Unclassified 784
49 Ga0070712_101236827 3300006175 Unclassified 650
50 Ga0075427_10073674 3300006194 Unclassified 611
51 Ga0097621_100457761 3300006237 Unclassified 1150
52 Ga0097621_102203207 3300006237 Unclassified 527
53 Ga0068871_100869924 3300006358 Unclassified 834
54 Ga0075428_100009508 3300006844 Bacteria 10795
55 Ga0075428_100264290 3300006844 Bacteria 1852
56 Ga0075428_102397222 3300006844 Unclassified 542
57 Ga0075430_100035294 3300006846 Unclassified 4242
58 Ga0075430_100101414 3300006846 Unclassified 2403
59 Ga0075430_100442068 3300006846 Unclassified 1073
60 Ga0075431_100014410 3300006847 Bacteria 7997
61 Ga0075431_100173590 3300006847 Unclassified 2214
62 Ga0075431_100192908 3300006847 Bacteria 2087
63 Ga0075431_101190136 3300006847 Bacteria 725
64 Ga0075433_10000326 3300006852 Bacteria 29253
65 Ga0075433_10123316 3300006852 Unclassified 2302
66 Ga0075433_11666523 3300006852 Bacteria 549
67 Ga0075434_100008108 3300006871 Bacteria 9742
68 Ga0075434_101521825 3300006871 Unclassified 678
69 Ga0075429_100041795 3300006880 Unclassified 3992
70 Ga0075429_100129468 3300006880 Unclassified 2207
71 Ga0075429_100564576 3300006880 Bacteria 997
72 Ga0075429_101438765 3300006880 Unclassified 600
73 Ga0097620_101686282 3300006931 Bacteria 700
74 Ga0075435_100423584 3300007076 Unclassified 1146
75 Ga0105240_10055309 3300009093 Unclassified 4968
76 Ga0105240_11324907 3300009093 Unclassified 759
77 Ga0105240_11473176 3300009093 Bacteria 714
78 Ga0111539_10001416 3300009094 Bacteria 31960
79 Ga0114129_10143823 3300009147 Unclassified 3267
80 Ga0114129_10147618 3300009147 Unclassified 3220
81 Ga0114129_11198796 3300009147 Bacteria 946
82 Ga0105243_10642094 3300009148 Unclassified 1028
83 Ga0105241_11363396 3300009174 Unclassified 678
84 Ga0105242_10161554 3300009176 Bacteria 1962
85 Ga0105248_10997005 3300009177 Bacteria 946
86 Ga0105248_11893162 3300009177 Unclassified 677
87 Ga0105237_10016556 3300009545 Bacteria 7660
88 Ga0105237_11818006 3300009545 Unclassified 617
89 Ga0105239_12680433 3300010375 Unclassified 581
90 Ga0105246_11194550 3300011119 Bacteria 700
91 Ga0157373_10235795 3300013100 Unclassified 1293
92 Ga0157371_10081457 3300013102 Bacteria 2292
93 Ga0157370_10097831 3300013104 Unclassified 2753
94 Ga0157370_10106828 3300013104 Unclassified 2619
95 Ga0157370_10184375 3300013104 Unclassified 1938
96 Ga0157370_10436529 3300013104 Bacteria 1204
97 Ga0157370_10584364 3300013104 Unclassified 1023
98 Ga0157369_10003833 3300013105 Bacteria 17861
99 Ga0157369_10372970 3300013105 Bacteria 1481
100 Ga0157374_10041570 3300013296 Unclassified 4238
101 Ga0157374_10279052 3300013296 Bacteria 1649
102 Ga0163162_11604269 3300013306 Unclassified 742
103 Ga0163162_11914403 3300013306 Unclassified 679
104 Ga0157372_10078134 3300013307 Unclassified 3739
105 Ga0157372_11121349 3300013307 Bacteria 910
106 Ga0157372_12649367 3300013307 Unclassified 575
107 Ga0163163_10003998 3300014325 Bacteria 12578
108 Ga0163163_10101344 3300014325 Unclassified 2902
109 Ga0163163_10765755 3300014325 Unclassified 1029
110 Ga0157380_12063443 3300014326 Bacteria 633
111 Ga0157380_12593247 3300014326 Unclassified 573
112 Ga0157376_10341360 3300014969 Unclassified 1430
113 Ga0157376_10388705 3300014969 Unclassified 1346
114 Ga0157376_13056543 3300014969 Unclassified 507
115 Ga0213873_10040742 3300021358 Bacteria 1195
116 Ga0213876_10454494 3300021384 Unclassified 681
117 Ga0213875_10060178 3300021388 Bacteria 1777
118 Ga0224712_10594121 3300022467 Unclassified 540
119 Ga0207705_11139578 3300025909 Unclassified 600
120 Ga0207695_10088862 3300025913 Unclassified 3109
121 Ga0207695_10577483 3300025913 Bacteria 1005
122 Ga0207671_10925475 3300025914 Bacteria 689
123 Ga0207693_10727943 3300025915 Unclassified 767
124 Ga0207663_10138962 3300025916 Bacteria 1689
125 Ga0207660_10383626 3300025917 Bacteria 1130
126 Ga0207657_10382472 3300025919 Bacteria 1108
127 Ga0207649_10597537 3300025920 Unclassified 848
128 Ga0207652_10347503 3300025921 Bacteria 1339
129 Ga0207652_10536571 3300025921 Bacteria 1052
130 Ga0207681_10850808 3300025923 Unclassified 763
131 Ga0207664_10044520 3300025929 Bacteria 3476
132 Ga0207664_11060130 3300025929 Bacteria 725
133 Ga0207690_10080906 3300025932 Bacteria 2268
134 Ga0207690_10287327 3300025932 Unclassified 1283
135 Ga0207706_10233521 3300025933 Bacteria 1608
136 Ga0207686_11183440 3300025934 Unclassified 625
137 Ga0207670_10266447 3300025936 Unclassified 1330
138 Ga0207691_10618986 3300025940 Bacteria 916
139 Ga0207689_10129592 3300025942 Bacteria 2076
140 Ga0207679_10823822 3300025945 Unclassified 847
141 Ga0207667_10011963 3300025949 Bacteria 10046
142 Ga0207667_11731656 3300025949 Unclassified 591
143 Ga0207640_12064749 3300025981 Unclassified 517
144 Ga0207677_11848823 3300026023 Bacteria 561
145 Ga0207678_10388035 3300026067 Unclassified 1208
146 Ga0207678_11376960 3300026067 Unclassified 624
147 Ga0207708_10272680 3300026075 Bacteria 1369
148 Ga0207702_10034032 3300026078 Unclassified 4258
149 Ga0207702_10331827 3300026078 Bacteria 1451
150 Ga0207674_10969901 3300026116 Bacteria 819
151 Ga0207674_11661352 3300026116 Bacteria 607
152 Ga0207698_10669289 3300026142 Bacteria 1030
153 Ga0207698_11883832 3300026142 Unclassified 613
154 Ga0207428_10005238 3300027907 Bacteria 12122
155 Ga0268266_10819137 3300028379 Unclassified 899
156 Ga0268266_11838814 3300028379 Unclassified 580
157 Ga0268265_11418826 3300028380 Unclassified 697
158 Ga0268265_11464768 3300028380 Unclassified 686
159 Ga0307509_10351276 3300031507 Unclassified 1198
160 Ga0373944_0058835 3300035089 Bacteria 1228
161 Ga0373944_0083422 3300035089 Unclassified 1059
162 Ga0373936_0021470 3300035113 Bacteria 2511
163 Ga0373945_0068916 3300035116 Bacteria 1335
164 Ga0373943_0007257 3300035170 Bacteria 4972
165 Ga0373955_0129116 3300035172 Bacteria 1474
166 Ga0373924_0001553 3300035410 Bacteria 7491
167 Ga0373935_0008718 3300035692 Bacteria 6075
168 Ga0373935_0071719 3300035692 Unclassified 2235
169 Ga0373927_0692238 3300035695 Unclassified 673
170 Ga0373947_0254509 3300035725 Unclassified 1162
171 Ga0373937_1895685 3300036401 Bacteria 542
172 Ga0373925_0038526 3300037068 Bacteria 3535
173 Ga0395898_0707961 3300037466 Unclassified 949
174 Ga0436364_0173426 3300037853 Bacteria 3559
175 Ga0436364_0505318 3300037853 Unclassified 770
176 Ga0436364_0532988 3300037853 Unclassified 693
177 Ga0436364_0702843 3300037853 Unclassified 1034
178 Ga0436365_1606779 3300039437 Unclassified 533
179 Ga0436365_1702995 3300039437 Unclassified 4166
180 Ga0436360_0004930 3300039438 Unclassified 1026
181 Ga0436363_1718066 3300039450 Unclassified 826
182 Ga0436362_0965377 3300039453 Unclassified 1391
183 Ga0436362_1118842 3300039453 Bacteria 1196
184 Ga0439462_0110762 3300042015 Bacteria 760
185 Ga0451576_0913605 3300045051 Bacteria 921
186 Ga0466967_0335341 3300045976 Bacteria 1461
187 Ga0466967_1013462 3300045976 Unclassified 827
188 Ga0495639_0154326 3300046475 Bacteria 1109
189 Ga0495594_0513868 3300046499 Bacteria 680
190 Ga0495665_0629086 3300046531 Unclassified 535
191 Ga0495587_0294617 3300046536 Bacteria 908
192 Ga0495658_0573243 3300046683 Bacteria 723
193 Ga0495613_0695950 3300046689 Bacteria 669
194 Ga0495604_0157589 3300047317 Bacteria 1607
195 Ga0495684_0691606 3300047471 Bacteria 677
196 Ga0496102_1696623 3300048905 Unclassified 550
197 Ga0496104_0512453 3300048907 Bacteria 1111
198 Ga0496104_0715347 3300048907 Unclassified 909
199 Ga0496104_0846824 3300048907 Unclassified 820
200 Ga0496105_0800946 3300048908 Unclassified 716
201 Ga0496112_0039765 3300048915 Bacteria 4597
202 Ga0496114_0640891 3300048917 Unclassified 935
203 Ga0501032_0438897 3300049569 Unclassified 837
204 Ga0501033_0150246 3300049570 Unclassified 1681
205 Ga0501034_0033728 3300049571 Bacteria 5190
206 Ga0501038_0061406 3300049574 Unclassified 3214
207 Ga0501038_0832724 3300049574 Unclassified 684
208 Ga0501039_0356138 3300049575 Unclassified 1150
209 Ga0501039_0876817 3300049575 Unclassified 699
210 Ga0501040_0249985 3300049576 Bacteria 1264
211 Ga0501042_0060568 3300049578 Bacteria 2704
212 Ga0501043_0451021 3300049579 Unclassified 966
213 Ga0501046_0033990 3300049580 Bacteria 4117
214 Ga0501046_1154066 3300049580 Unclassified 534
215 Ga0501047_0009475 3300049581 Bacteria 9200
216 Ga0501048_0358637 3300049582 Unclassified 1040
217 Ga0501070_0214069 3300049586 Bacteria 1581
218 Ga0501070_0736843 3300049586 Unclassified 777
219 Ga0501071_0260293 3300049587 Bacteria 1310
220 Ga0501073_0268320 3300049589 Unclassified 1178
221 Ga0501073_0898593 3300049589 Unclassified 610
222 Ga0501073_1048075 3300049589 Unclassified 561
223 Ga0501074_0825356 3300049590 Unclassified 653
224 Ga0501075_0056634 3300049591 Unclassified 2951
225 Ga0501076_0028841 3300049592 Bacteria 4313
226 Ga0501077_0111011 3300049593 Bacteria 1738
227 Ga0501247_003685 3300049677 Bacteria 1651
228 Ga0501248_029949 3300049678 Unclassified 616
229 Ga0501245_036251 3300049708 Unclassified 833
230 Ga0501079_0113886 3300049741 Unclassified 2102
231 Ga0501080_1339172 3300049742 Bacteria 612
232 Ga0501081_1330295 3300049743 Bacteria 545
233 Ga0501263_092373 3300049760 Unclassified 512
234 Ga0501035_0187025 3300049822 Unclassified 1782
235 Ga0501035_0267672 3300049822 Bacteria 1447
236 Ga0501044_0001104 3300049823 Bacteria 32100
237 Ga0501044_0527126 3300049823 Unclassified 1080
238 Ga0501045_0094041 3300049824 Unclassified 2217
239 nmdc:mga05p37_28953_c1 3300050507 Bacteria 6758
240 nmdc:mga05p37_436628_c1 3300050507 Unclassified 1520
241 nmdc:mga09592_1458976_c1 3300050508 Unclassified 558
242 nmdc:mga0qj67_1226036_c1 3300050509 Bacteria 583
243 nmdc:mga0qj67_12599_c1 3300050509 Bacteria 6374
244 nmdc:mga0qj67_178498_c1 3300050509 Unclassified 1725
245 nmdc:mga0qj67_208064_c1 3300050509 Bacteria 1589
246 nmdc:mga0qj67_29649_c1 3300050509 Unclassified 4251
247 nmdc:mga06r32_1265267_c1 3300050510 Bacteria 682
248 nmdc:mga06r32_1332818_c1 3300050510 Bacteria 661
249 nmdc:mga06r32_140572_c1 3300050510 Bacteria 2390
250 nmdc:mga06r32_338023_c1 3300050510 Bacteria 1491
251 nmdc:mga06r32_44336_c1 3300050510 Unclassified 4235
252 nmdc:mga06r32_46619_c1 3300050510 Unclassified 4136
253 nmdc:mga06r32_522504_c1 3300050510 Unclassified 1163
254 nmdc:mga06r32_968355_c1 3300050510 Unclassified 805
255 nmdc:mga08y16_11005_c1 3300050511 Bacteria 9499
256 nmdc:mga0rr50_55964_c1 3300050513 Bacteria 2945
257 nmdc:mga0a205_167575_c1 3300050515 Unclassified 2092
258 nmdc:mga0a205_53474_c1 3300050515 Bacteria 3898
259 Ga0500556_0056660 3300053104 Bacteria 1432
260 Ga0500616_0149200 3300053153 Unclassified 1084
261 Ga0075431_100468468
262 JGI25406J46586_10167578
263 Ga0070658_11152712
264 Ga0070677_10399014
265 Ga0068869_100206266
266 Ga0070680_100185816
267 Ga0070682_101130467
268 Ga0070660_100272384
269 Ga0070661_100121493
270 Ga0070692_10086582
271 Ga0070668_101755062
272 Ga0070688_100071578
273 Ga0070688_101635439
274 Ga0070659_100037744
275 Ga0070659_100056360
276 Ga0070714_100047619
277 Ga0070705_100320334
278 Ga0070700_100338096
279 Ga0070708_100093584
280 Ga0070663_100256279
281 Ga0070678_101212882
282 Ga0070662_100788697
283 Ga0070685_10134882
284 Ga0070699_100101884
285 Ga0070679_100258149
286 Ga0070684_100367844
287 Ga0070672_100379840
288 Ga0070686_101399083
289 Ga0070695_100563996
290 Ga0070695_100739023
291 Ga0070695_101155964
292 Ga0070696_100000742
293 Ga0070665_100576903
294 Ga0070665_101870636
295 Ga0068855_100006742
296 Ga0068855_100244689
297 Ga0068855_101331339
298 Ga0070664_100630259
299 Ga0068857_100204669
300 Ga0068856_100063854
301 Ga0068856_100419712
302 Ga0068852_101054541
303 Ga0068852_102199061
304 Ga0068859_101686139
305 Ga0081455_10021641
306 Ga0070717_10004825
307 Ga0070717_10089275
308 Ga0070712_100852019
309 Ga0070712_101236827
310 Ga0075427_10073674
311 Ga0097621_100457761
312 Ga0097621_102203207
313 Ga0068871_100869924
314 Ga0075428_100009508
315 Ga0075428_100264290
316 Ga0075428_102397222
317 Ga0075430_100035294
318 Ga0075430_100101414
319 Ga0075430_100442068
320 Ga0075431_100014410
321 Ga0075431_100173590
322 Ga0075431_100192908
323 Ga0075431_101190136
324 Ga0075433_10000326
325 Ga0075433_10123316
326 Ga0075433_11666523
327 Ga0075434_100008108
328 Ga0075434_101521825
329 Ga0075429_100041795
330 Ga0075429_100129468
331 Ga0075429_100564576
332 Ga0075429_101438765
333 Ga0097620_101686282
334 Ga0075435_100423584
335 Ga0105240_10055309
336 Ga0105240_11324907
337 Ga0105240_11473176
338 Ga0111539_10001416
339 Ga0114129_10143823
340 Ga0114129_10147618
341 Ga0114129_11198796
342 Ga0105243_10642094
343 Ga0105241_11363396
344 Ga0105242_10161554
345 Ga0105248_10997005
346 Ga0105248_11893162
347 Ga0105237_10016556
348 Ga0105237_11818006
349 Ga0105239_12680433
350 Ga0105246_11194550
351 Ga0157373_10235795
352 Ga0157371_10081457
353 Ga0157370_10097831
354 Ga0157370_10106828
355 Ga0157370_10184375
356 Ga0157370_10436529
357 Ga0157370_10584364
358 Ga0157369_10003833
359 Ga0157369_10372970
360 Ga0157374_10041570
361 Ga0157374_10279052
362 Ga0163162_11604269
363 Ga0163162_11914403
364 Ga0157372_10078134
365 Ga0157372_11121349
366 Ga0157372_12649367
367 Ga0163163_10003998
368 Ga0163163_10101344
369 Ga0163163_10765755
370 Ga0157380_12063443
371 Ga0157380_12593247
372 Ga0157376_10341360
373 Ga0157376_10388705
374 Ga0157376_13056543
375 Ga0213873_10040742
376 Ga0213876_10454494
377 Ga0213875_10060178
378 Ga0224712_10594121
379 Ga0207705_11139578
380 Ga0207695_10088862
381 Ga0207695_10577483
382 Ga0207671_10925475
383 Ga0207693_10727943
384 Ga0207663_10138962
385 Ga0207660_10383626
386 Ga0207657_10382472
387 Ga0207649_10597537
388 Ga0207652_10347503
389 Ga0207652_10536571
390 Ga0207681_10850808
391 Ga0207664_10044520
392 Ga0207664_11060130
393 Ga0207690_10080906
394 Ga0207690_10287327
395 Ga0207706_10233521
396 Ga0207686_11183440
397 Ga0207670_10266447
398 Ga0207691_10618986
399 Ga0207689_10129592
400 Ga0207679_10823822
401 Ga0207667_10011963
402 Ga0207667_11731656
403 Ga0207640_12064749
404 Ga0207677_11848823
405 Ga0207678_10388035
406 Ga0207678_11376960
407 Ga0207708_10272680
408 Ga0207702_10034032
409 Ga0207702_10331827
410 Ga0207674_10969901
411 Ga0207674_11661352
412 Ga0207698_10669289
413 Ga0207698_11883832
414 Ga0207428_10005238
415 Ga0268266_10819137
416 Ga0268266_11838814
417 Ga0268265_11418826
418 Ga0268265_11464768
419 Ga0307509_10351276
420 Ga0373944_0058835
421 Ga0373944_0083422
422 Ga0373936_0021470
423 Ga0373945_0068916
424 Ga0373943_0007257
425 Ga0373955_0129116
426 Ga0373924_0001553
427 Ga0373935_0008718
428 Ga0373935_0071719
429 Ga0373927_0692238
430 Ga0373947_0254509
431 Ga0373937_1895685
432 Ga0373925_0038526
433 Ga0395898_0707961
434 Ga0436364_0173426
435 Ga0436364_0505318
436 Ga0436364_0532988
437 Ga0436364_0702843
438 Ga0436365_1606779
439 Ga0436365_1702995
440 Ga0436360_0004930
441 Ga0436363_1718066
442 Ga0436362_0965377
443 Ga0436362_1118842
444 Ga0439462_0110762
445 Ga0451576_0913605
446 Ga0466967_0335341
447 Ga0466967_1013462
448 Ga0495639_0154326
449 Ga0495594_0513868
450 Ga0495665_0629086
451 Ga0495587_0294617
452 Ga0495658_0573243
453 Ga0495613_0695950
454 Ga0495604_0157589
455 Ga0495684_0691606
456 Ga0496102_1696623
457 Ga0496104_0512453
458 Ga0496104_0715347
459 Ga0496104_0846824
460 Ga0496105_0800946
461 Ga0496112_0039765
462 Ga0496114_0640891
463 Ga0501032_0438897
464 Ga0501033_0150246
465 Ga0501034_0033728
466 Ga0501038_0061406
467 Ga0501038_0832724
468 Ga0501039_0356138
469 Ga0501039_0876817
470 Ga0501040_0249985
471 Ga0501042_0060568
472 Ga0501043_0451021
473 Ga0501046_0033990
474 Ga0501046_1154066
475 Ga0501047_0009475
476 Ga0501048_0358637
477 Ga0501070_0214069
478 Ga0501070_0736843
479 Ga0501071_0260293
480 Ga0501073_0268320
481 Ga0501073_0898593
482 Ga0501073_1048075
483 Ga0501074_0825356
484 Ga0501075_0056634
485 Ga0501076_0028841
486 Ga0501077_0111011
487 Ga0501247_003685
488 Ga0501248_029949
489 Ga0501245_036251
490 Ga0501079_0113886
491 Ga0501080_1339172
492 Ga0501081_1330295
493 Ga0501263_092373
494 Ga0501035_0187025
495 Ga0501035_0267672
496 Ga0501044_0001104
497 Ga0501044_0527126
498 Ga0501045_0094041
499 nmdc:mga05p37_28953_c1
500 nmdc:mga05p37_436628_c1
501 nmdc:mga09592_1458976_c1
502 nmdc:mga0qj67_1226036_c1
503 nmdc:mga0qj67_12599_c1
504 nmdc:mga0qj67_178498_c1
505 nmdc:mga0qj67_208064_c1
506 nmdc:mga0qj67_29649_c1
507 nmdc:mga06r32_1265267_c1
508 nmdc:mga06r32_1332818_c1
509 nmdc:mga06r32_140572_c1
510 nmdc:mga06r32_338023_c1
511 nmdc:mga06r32_44336_c1
512 nmdc:mga06r32_46619_c1
513 nmdc:mga06r32_522504_c1
514 nmdc:mga06r32_968355_c1
515 nmdc:mga08y16_11005_c1
516 nmdc:mga0rr50_55964_c1
517 nmdc:mga0a205_167575_c1
518 nmdc:mga0a205_53474_c1
519 Ga0500556_0056660
520 Ga0500616_0149200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

30

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9381 16 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9207 13 111
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9183 7 109
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9126 12 109
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9088 13 111
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9357 13 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 13 112 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9127 9 109 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9088 13 111 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 16 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y3IAF1-F1-model_v4 PadR family transcriptional regulator 0.9908 12 110
AF-A0A2V7J1F6-F1-model_v4 PadR family transcriptional regulator 0.9904 13 85
AF-A0A7V0Y143-F1-model_v4 PadR family transcriptional regulator 0.9842 13 113
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.9834 13 100
AF-A0A6J4LNB7-F1-model_v4 Transcriptional regulator, PadR family 0.983 13 113

Map