F369442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 187 | 246 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10180745|Ga0081455_101807452 |
| Length | 193 |
| Sequence | MTARGGSDAIGLGMSESELEIVVDDPTAPEEDSPAVTSNRAVDVVVSLLLLALACVLGYDNWRTGAGWDSTGPEPGYFPFYLCVILAGASLYGLIAAFLSRTEAAETFVTRAQLRRVMAVFVPTFLFCLMTQFLGLYVASFLLIAGFMRFVGKIALWKSLLTAFVFTALMFVTFDIAFDVIMPKGPLEAAFGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 5 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 6 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 7 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 8 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 9 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 10 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 11 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 12 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 13 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 14 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 123 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 135 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 184 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 187 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.62 |
| Metatranscriptomes | 0 |
| Isolates | 5.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.62 |
| Nodule | 4.23 |
| Rhizoplane | 2.69 |
| Rhizosphere | 82.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25160J50197_1003864 | 3300003354 | Bacteria | 6576 |
| 2 | Ga0055526_1017797 | 3300003771 | Bacteria | 2693 |
| 3 | Ga0065165_1033372 | 3300005262 | Bacteria | 1602 |
| 4 | Ga0070683_100003163 | 3300005329 | Bacteria | 13275 |
| 5 | Ga0070666_10026969 | 3300005335 | Bacteria | 3758 |
| 6 | Ga0070680_100001667 | 3300005336 | Bacteria | 16258 |
| 7 | Ga0070660_100007554 | 3300005339 | Bacteria | 7576 |
| 8 | Ga0070691_10010014 | 3300005341 | Bacteria | 4320 |
| 9 | Ga0070691_10242901 | 3300005341 | Bacteria | 963 |
| 10 | Ga0070668_100074547 | 3300005347 | Bacteria | 2648 |
| 11 | Ga0070668_100251919 | 3300005347 | Bacteria | 1466 |
| 12 | Ga0070674_100117355 | 3300005356 | Bacteria | 1965 |
| 13 | Ga0070673_100188986 | 3300005364 | Bacteria | 1768 |
| 14 | Ga0070659_100052830 | 3300005366 | Bacteria | 3197 |
| 15 | Ga0070667_100034703 | 3300005367 | Bacteria | 4222 |
| 16 | Ga0070709_10002981 | 3300005434 | Bacteria | 9109 |
| 17 | Ga0070709_10319613 | 3300005434 | Bacteria | 1139 |
| 18 | Ga0070709_10604238 | 3300005434 | Bacteria | 845 |
| 19 | Ga0070714_100004849 | 3300005435 | Bacteria | 10213 |
| 20 | Ga0070714_100461526 | 3300005435 | Bacteria | 1207 |
| 21 | Ga0070714_100777134 | 3300005435 | Bacteria | 926 |
| 22 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 23 | Ga0070713_101123804 | 3300005436 | Bacteria | 760 |
| 24 | Ga0070710_10006567 | 3300005437 | Bacteria | 5594 |
| 25 | Ga0070711_100003697 | 3300005439 | Bacteria | 8958 |
| 26 | Ga0070678_100000991 | 3300005456 | Bacteria | 14681 |
| 27 | Ga0070698_100211951 | 3300005471 | Bacteria | 1872 |
| 28 | Ga0070679_100053322 | 3300005530 | Bacteria | 4026 |
| 29 | Ga0070679_100121459 | 3300005530 | Bacteria | 2597 |
| 30 | Ga0070684_100005067 | 3300005535 | Bacteria | 10061 |
| 31 | Ga0070684_100006761 | 3300005535 | Bacteria | 8888 |
| 32 | Ga0068853_100019098 | 3300005539 | Bacteria | 5679 |
| 33 | Ga0068853_100343783 | 3300005539 | Bacteria | 1387 |
| 34 | Ga0068853_100513062 | 3300005539 | Bacteria | 1133 |
| 35 | Ga0070672_100007989 | 3300005543 | Bacteria | 7225 |
| 36 | Ga0070696_100145247 | 3300005546 | Bacteria | 1737 |
| 37 | Ga0070665_100013407 | 3300005548 | Bacteria | 8248 |
| 38 | Ga0070665_100142317 | 3300005548 | Bacteria | 2401 |
| 39 | Ga0068855_100026934 | 3300005563 | Bacteria | 6879 |
| 40 | Ga0068855_100296071 | 3300005563 | Bacteria | 1793 |
| 41 | Ga0068857_100010355 | 3300005577 | Bacteria | 8102 |
| 42 | Ga0068856_100102399 | 3300005614 | Bacteria | 2857 |
| 43 | Ga0068856_100315497 | 3300005614 | Bacteria | 1581 |
| 44 | Ga0068852_100022415 | 3300005616 | Bacteria | 5065 |
| 45 | Ga0068859_100082059 | 3300005617 | Bacteria | 3267 |
| 46 | Ga0068859_100508591 | 3300005617 | Bacteria | 1300 |
| 47 | Ga0068851_10004202 | 3300005834 | Bacteria | 6487 |
| 48 | Ga0068863_100417621 | 3300005841 | Bacteria | 1314 |
| 49 | Ga0068860_100161654 | 3300005843 | Bacteria | 2159 |
| 50 | Ga0068860_100969301 | 3300005843 | Bacteria | 868 |
| 51 | Ga0081455_10180745 | 3300005937 | Bacteria | 1597 |
| 52 | Ga0081540_1067081 | 3300005983 | Bacteria | 1678 |
| 53 | Ga0070715_10065572 | 3300006163 | Bacteria | 1608 |
| 54 | Ga0097621_100107239 | 3300006237 | Bacteria | 2357 |
| 55 | Ga0097621_100422477 | 3300006237 | Bacteria | 1197 |
| 56 | Ga0068871_100234125 | 3300006358 | Bacteria | 1595 |
| 57 | Ga0068871_101236863 | 3300006358 | Bacteria | 701 |
| 58 | Ga0075434_100500495 | 3300006871 | Bacteria | 1236 |
| 59 | Ga0097620_100082058 | 3300006931 | Bacteria | 3267 |
| 60 | Ga0097620_100508588 | 3300006931 | Bacteria | 1300 |
| 61 | Ga0105240_10354414 | 3300009093 | Bacteria | 1664 |
| 62 | Ga0105240_10798837 | 3300009093 | Bacteria | 1022 |
| 63 | Ga0105247_10028150 | 3300009101 | Bacteria | 3400 |
| 64 | Ga0105241_10860473 | 3300009174 | Bacteria | 839 |
| 65 | Ga0105242_10376925 | 3300009176 | Bacteria | 1318 |
| 66 | Ga0105242_11527823 | 3300009176 | Bacteria | 699 |
| 67 | Ga0105237_10020532 | 3300009545 | Bacteria | 6807 |
| 68 | Ga0105237_10520603 | 3300009545 | Bacteria | 1196 |
| 69 | Ga0105237_10848956 | 3300009545 | Bacteria | 920 |
| 70 | Ga0105237_11111090 | 3300009545 | Bacteria | 797 |
| 71 | Ga0105238_10355254 | 3300009551 | Bacteria | 1455 |
| 72 | Ga0105239_10050052 | 3300010375 | Bacteria | 4583 |
| 73 | Ga0157370_10103622 | 3300013104 | Bacteria | 2663 |
| 74 | Ga0157370_10394063 | 3300013104 | Bacteria | 1275 |
| 75 | Ga0157369_10033390 | 3300013105 | Bacteria | 5656 |
| 76 | Ga0157369_10059326 | 3300013105 | Bacteria | 4126 |
| 77 | Ga0157369_11175396 | 3300013105 | Bacteria | 783 |
| 78 | Ga0157369_11281489 | 3300013105 | Bacteria | 747 |
| 79 | Ga0157374_10306214 | 3300013296 | Bacteria | 1573 |
| 80 | Ga0157372_10115748 | 3300013307 | Bacteria | 3074 |
| 81 | Ga0157372_11152943 | 3300013307 | Bacteria | 896 |
| 82 | Ga0157375_10032914 | 3300013308 | Bacteria | 4921 |
| 83 | Ga0157375_10350251 | 3300013308 | Bacteria | 1643 |
| 84 | Ga0157379_11209788 | 3300014968 | Bacteria | 727 |
| 85 | Ga0209564_1003348 | 3300025295 | Bacteria | 11109 |
| 86 | Ga0209758_1006245 | 3300025297 | Bacteria | 8679 |
| 87 | Ga0209256_1001337 | 3300025299 | Bacteria | 26265 |
| 88 | Ga0207426_1001389 | 3300025302 | Bacteria | 20453 |
| 89 | Ga0207656_10004689 | 3300025321 | Bacteria | 4793 |
| 90 | Ga0207710_10022294 | 3300025900 | Bacteria | 2718 |
| 91 | Ga0207680_10249261 | 3300025903 | Bacteria | 1226 |
| 92 | Ga0207685_10052035 | 3300025905 | Bacteria | 1585 |
| 93 | Ga0207699_10009654 | 3300025906 | Bacteria | 4815 |
| 94 | Ga0207699_10044493 | 3300025906 | Bacteria | 2585 |
| 95 | Ga0207707_10001745 | 3300025912 | Bacteria | 19977 |
| 96 | Ga0207707_10071840 | 3300025912 | Bacteria | 3016 |
| 97 | Ga0207707_10245231 | 3300025912 | Bacteria | 1557 |
| 98 | Ga0207695_10051679 | 3300025913 | Bacteria | 4312 |
| 99 | Ga0207695_10675783 | 3300025913 | Bacteria | 913 |
| 100 | Ga0207671_10021059 | 3300025914 | Bacteria | 4953 |
| 101 | Ga0207671_10312959 | 3300025914 | Bacteria | 1241 |
| 102 | Ga0207671_10434920 | 3300025914 | Bacteria | 1044 |
| 103 | Ga0207671_10503435 | 3300025914 | Bacteria | 966 |
| 104 | Ga0207671_10504933 | 3300025914 | Bacteria | 964 |
| 105 | Ga0207671_10582401 | 3300025914 | Bacteria | 892 |
| 106 | Ga0207693_10146008 | 3300025915 | Bacteria | 1860 |
| 107 | Ga0207663_10024077 | 3300025916 | Bacteria | 3503 |
| 108 | Ga0207663_10651029 | 3300025916 | Bacteria | 831 |
| 109 | Ga0207660_10001256 | 3300025917 | Bacteria | 16995 |
| 110 | Ga0207657_10009190 | 3300025919 | Bacteria | 9966 |
| 111 | Ga0207649_10470806 | 3300025920 | Bacteria | 951 |
| 112 | Ga0207652_10003897 | 3300025921 | Bacteria | 12206 |
| 113 | Ga0207652_10095144 | 3300025921 | Bacteria | 2623 |
| 114 | Ga0207646_11209966 | 3300025922 | Bacteria | 662 |
| 115 | Ga0207694_10015295 | 3300025924 | Bacteria | 5790 |
| 116 | Ga0207694_10247754 | 3300025924 | Bacteria | 1457 |
| 117 | Ga0207664_10053468 | 3300025929 | Bacteria | 3197 |
| 118 | Ga0207664_10178473 | 3300025929 | Bacteria | 1822 |
| 119 | Ga0207664_10307852 | 3300025929 | Bacteria | 1395 |
| 120 | Ga0207664_10531234 | 3300025929 | Bacteria | 1055 |
| 121 | Ga0207706_10558608 | 3300025933 | Bacteria | 985 |
| 122 | Ga0207686_10031491 | 3300025934 | Bacteria | 3150 |
| 123 | Ga0207661_10031739 | 3300025944 | Bacteria | 4085 |
| 124 | Ga0207661_10589359 | 3300025944 | Bacteria | 1020 |
| 125 | Ga0207667_10014314 | 3300025949 | Bacteria | 9047 |
| 126 | Ga0207667_10107188 | 3300025949 | Bacteria | 2882 |
| 127 | Ga0207667_10253008 | 3300025949 | Bacteria | 1802 |
| 128 | Ga0207667_10316069 | 3300025949 | Bacteria | 1595 |
| 129 | Ga0207651_10174637 | 3300025960 | Bacteria | 1698 |
| 130 | Ga0207668_10055699 | 3300025972 | Bacteria | 2750 |
| 131 | Ga0207640_10228774 | 3300025981 | Bacteria | 1429 |
| 132 | Ga0207658_10007272 | 3300025986 | Bacteria | 7550 |
| 133 | Ga0207658_10216023 | 3300025986 | Bacteria | 1610 |
| 134 | Ga0207703_10047023 | 3300026035 | Bacteria | 3478 |
| 135 | Ga0207703_10450992 | 3300026035 | Bacteria | 1201 |
| 136 | Ga0207639_10007834 | 3300026041 | Bacteria | 7295 |
| 137 | Ga0207639_10332038 | 3300026041 | Bacteria | 1353 |
| 138 | Ga0207678_10838458 | 3300026067 | Bacteria | 812 |
| 139 | Ga0207641_11629250 | 3300026088 | Unclassified | 647 |
| 140 | Ga0207674_10054532 | 3300026116 | Bacteria | 4069 |
| 141 | Ga0207674_10095323 | 3300026116 | Bacteria | 2962 |
| 142 | Ga0207674_10668457 | 3300026116 | Bacteria | 1003 |
| 143 | Ga0207683_10001221 | 3300026121 | Bacteria | 23317 |
| 144 | Ga0207698_10260627 | 3300026142 | Bacteria | 1592 |
| 145 | Ga0207698_11091302 | 3300026142 | Bacteria | 811 |
| 146 | Ga0268266_10149707 | 3300028379 | Bacteria | 2102 |
| 147 | Ga0268266_10265886 | 3300028379 | Bacteria | 1591 |
| 148 | Ga0268264_10021721 | 3300028381 | Bacteria | 5239 |
| 149 | Ga0265337_1005145 | 3300028556 | Bacteria | 5262 |
| 150 | Ga0265326_10002419 | 3300028558 | Bacteria | 6287 |
| 151 | Ga0265319_1008268 | 3300028563 | Bacteria | 4578 |
| 152 | Ga0265334_10008736 | 3300028573 | Bacteria | 4303 |
| 153 | Ga0265334_10199052 | 3300028573 | Bacteria | 696 |
| 154 | Ga0265323_10000837 | 3300028653 | Bacteria | 16432 |
| 155 | Ga0265336_10000593 | 3300028666 | Bacteria | 20297 |
| 156 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 157 | Ga0265330_10060662 | 3300031235 | Bacteria | 1646 |
| 158 | Ga0265340_10052571 | 3300031247 | Bacteria | 1969 |
| 159 | Ga0265331_10313057 | 3300031250 | Bacteria | 703 |
| 160 | Ga0265314_10199381 | 3300031711 | Bacteria | 1185 |
| 161 | Ga0373934_0117820 | 3300035086 | Bacteria | 1080 |
| 162 | Ga0373944_0223456 | 3300035089 | Bacteria | 688 |
| 163 | Ga0373936_0055010 | 3300035113 | Bacteria | 1615 |
| 164 | Ga0373945_0030918 | 3300035116 | Bacteria | 1889 |
| 165 | Ga0373943_0070321 | 3300035170 | Bacteria | 1771 |
| 166 | Ga0373942_0085103 | 3300035207 | Bacteria | 944 |
| 167 | Ga0373961_0198170 | 3300035241 | Bacteria | 707 |
| 168 | Ga0373935_0162698 | 3300035692 | Bacteria | 1522 |
| 169 | Ga0373927_0094914 | 3300035695 | Bacteria | 1938 |
| 170 | Ga0373927_0275199 | 3300035695 | Bacteria | 1107 |
| 171 | Ga0373947_0013012 | 3300035725 | Bacteria | 4771 |
| 172 | Ga0373947_0281092 | 3300035725 | Bacteria | 1106 |
| 173 | Ga0373925_0123770 | 3300037068 | Bacteria | 2010 |
| 174 | Ga0395900_0328820 | 3300037418 | Bacteria | 1507 |
| 175 | Ga0395898_0019680 | 3300037466 | Bacteria | 6866 |
| 176 | Ga0395898_0521617 | 3300037466 | Bacteria | 1129 |
| 177 | Ga0436364_1379571 | 3300037853 | Bacteria | 817 |
| 178 | Ga0436365_1535963 | 3300039437 | Bacteria | 1902 |
| 179 | Ga0436365_1605560 | 3300039437 | Bacteria | 999 |
| 180 | Ga0436365_1612979 | 3300039437 | Bacteria | 1312 |
| 181 | Ga0436363_0608756 | 3300039450 | Bacteria | 1122 |
| 182 | Ga0451807_2488207 | 3300041486 | Bacteria | 957 |
| 183 | Ga0466963_0507637 | 3300044694 | Bacteria | 851 |
| 184 | Ga0466957_0043912 | 3300044842 | Bacteria | 2708 |
| 185 | Ga0466967_0589927 | 3300045976 | Bacteria | 1096 |
| 186 | Ga0495592_0095856 | 3300046454 | Bacteria | 2121 |
| 187 | Ga0495603_0066997 | 3300046455 | Bacteria | 2114 |
| 188 | Ga0495629_0016024 | 3300046459 | Bacteria | 5386 |
| 189 | Ga0495629_0341605 | 3300046459 | Bacteria | 1022 |
| 190 | Ga0495641_0032993 | 3300046461 | Bacteria | 2461 |
| 191 | Ga0495641_0115886 | 3300046461 | Bacteria | 1195 |
| 192 | Ga0495651_0199019 | 3300046462 | Bacteria | 1404 |
| 193 | Ga0495580_0050434 | 3300046472 | Bacteria | 2943 |
| 194 | Ga0495639_0010555 | 3300046475 | Bacteria | 3978 |
| 195 | Ga0495618_0181824 | 3300046514 | Bacteria | 1336 |
| 196 | Ga0495620_0092306 | 3300046515 | Bacteria | 1214 |
| 197 | Ga0495628_0269814 | 3300046516 | Bacteria | 1266 |
| 198 | Ga0495630_0355953 | 3300046517 | Bacteria | 1120 |
| 199 | Ga0495630_0623922 | 3300046517 | Bacteria | 826 |
| 200 | Ga0495666_0087556 | 3300046526 | Bacteria | 1471 |
| 201 | Ga0495665_0001580 | 3300046531 | Bacteria | 12182 |
| 202 | Ga0495640_0020780 | 3300046533 | Bacteria | 4827 |
| 203 | Ga0495586_0154365 | 3300046535 | Bacteria | 1293 |
| 204 | Ga0495622_0016052 | 3300046557 | Bacteria | 3484 |
| 205 | Ga0495634_0080873 | 3300046642 | Bacteria | 2126 |
| 206 | Ga0495635_0416030 | 3300046663 | Bacteria | 891 |
| 207 | Ga0495588_0191867 | 3300046674 | Bacteria | 1079 |
| 208 | Ga0495657_0293547 | 3300046675 | Bacteria | 970 |
| 209 | Ga0495599_0334810 | 3300046678 | Bacteria | 909 |
| 210 | Ga0495623_0174708 | 3300046679 | Bacteria | 1252 |
| 211 | Ga0495647_0032501 | 3300046681 | Bacteria | 1945 |
| 212 | Ga0495600_0122214 | 3300046809 | Bacteria | 1693 |
| 213 | Ga0495581_0031557 | 3300047315 | Bacteria | 3069 |
| 214 | Ga0495674_0147783 | 3300047319 | Bacteria | 1972 |
| 215 | Ga0495674_0178819 | 3300047319 | Bacteria | 1768 |
| 216 | Ga0495676_0422689 | 3300047321 | Bacteria | 882 |
| 217 | Ga0495680_0090420 | 3300047322 | Bacteria | 2296 |
| 218 | Ga0495680_0126033 | 3300047322 | Bacteria | 1886 |
| 219 | Ga0495673_0247923 | 3300047469 | Bacteria | 651 |
| 220 | Ga0495684_0298691 | 3300047471 | Bacteria | 1157 |
| 221 | Ga0495686_0334164 | 3300047472 | Bacteria | 827 |
| 222 | Ga0495593_0024285 | 3300047673 | Bacteria | 3360 |
| 223 | Ga0495602_0269049 | 3300048088 | Bacteria | 1260 |
| 224 | Ga0496104_0668512 | 3300048907 | Bacteria | 947 |
| 225 | Ga0496110_0142668 | 3300048913 | Bacteria | 2166 |
| 226 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 227 | Ga0496115_0066702 | 3300048918 | Bacteria | 2909 |
| 228 | Ga0496115_0110407 | 3300048918 | Bacteria | 2259 |
| 229 | Ga0496115_0795973 | 3300048918 | Bacteria | 736 |
| 230 | Ga0496120_0143626 | 3300048923 | Bacteria | 1208 |
| 231 | Ga0496121_0093368 | 3300048924 | Bacteria | 2343 |
| 232 | Ga0496121_0154542 | 3300048924 | Bacteria | 1685 |
| 233 | Ga0496124_0130988 | 3300048927 | Bacteria | 1992 |
| 234 | Ga0496125_0023632 | 3300048928 | Bacteria | 5668 |
| 235 | Ga0496126_0196644 | 3300048929 | Bacteria | 1705 |
| 236 | Ga0496126_0260650 | 3300048929 | Bacteria | 1442 |
| 237 | Ga0496126_0807226 | 3300048929 | Bacteria | 719 |
| 238 | nmdc:mga0n895_163259_c1 | 3300050512 | Bacteria | 2259 |
| 239 | nmdc:mga0a205_495129_c1 | 3300050515 | Bacteria | 1079 |
| 240 | nmdc:mga0a205_600351_c1 | 3300050515 | Bacteria | 954 |
| 241 | Ga0495619_0269801 | 3300053085 | Bacteria | 1179 |
| 242 | Ga0500572_000492 | 3300053111 | Bacteria | 13605 |
| 243 | Ga0500559_0003494 | 3300053136 | Bacteria | 7710 |
| 244 | Ga0500564_082115 | 3300053138 | Bacteria | 1443 |
| 245 | Ga0500639_025515 | 3300053163 | Bacteria | 3125 |
| 246 | Ga0500596_008565 | 3300053735 | Bacteria | 1627 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_100082059 | Ga0068859_1000820592 | 147 |
| 2 | 3300005841 | Ga0068863_100417621 | Ga0068863_1004176211 | 147 |
| 3 | 3300005843 | Ga0068860_100161654 | Ga0068860_1001616542 | 147 |
| 4 | 3300006931 | Ga0097620_100082058 | Ga0097620_1000820582 | 147 |
| 5 | 3300025986 | Ga0207658_10216023 | Ga0207658_102160232 | 147 |
| 6 | 3300026035 | Ga0207703_10450992 | Ga0207703_104509921 | 147 |
| 7 | 3300026088 | Ga0207641_11629250 | Ga0207641_116292501 | 147 |
| 8 | 3300028381 | Ga0268264_10021721 | Ga0268264_100217213 | 147 |
| 9 | 3300009176 | Ga0105242_10376925 | Ga0105242_103769252 | 155 |
| 10 | 3300025934 | Ga0207686_10031491 | Ga0207686_100314912 | 155 |
| 11 | 3300046515 | Ga0495620_0092306 | Ga0495620_0092306_31_501 | 156 |
| 12 | 3300039437 | Ga0436365_1612979 | Ga0436365_1612979_405_947 | 159 |
| 13 | 3300005335 | Ga0070666_10026969 | Ga0070666_100269692 | 160 |
| 14 | 3300005347 | Ga0070668_100251919 | Ga0070668_1002519192 | 160 |
| 15 | 3300005356 | Ga0070674_100117355 | Ga0070674_1001173552 | 160 |
| 16 | 3300005364 | Ga0070673_100188986 | Ga0070673_1001889862 | 160 |
| 17 | 3300005367 | Ga0070667_100034703 | Ga0070667_1000347034 | 160 |
| 18 | 3300005456 | Ga0070678_100000991 | Ga0070678_1000009915 | 160 |
| 19 | 3300005548 | Ga0070665_100013407 | Ga0070665_1000134071 | 160 |
| 20 | 3300006237 | Ga0097621_100107239 | Ga0097621_1001072392 | 160 |
| 21 | 3300025903 | Ga0207680_10249261 | Ga0207680_102492612 | 160 |
| 22 | 3300025933 | Ga0207706_10558608 | Ga0207706_105586082 | 160 |
| 23 | 3300025960 | Ga0207651_10174637 | Ga0207651_101746372 | 160 |
| 24 | 3300025986 | Ga0207658_10007272 | Ga0207658_100072724 | 160 |
| 25 | 3300026121 | Ga0207683_10001221 | Ga0207683_1000122110 | 160 |
| 26 | 3300028379 | Ga0268266_10149707 | Ga0268266_101497072 | 160 |
| 27 | 3300013308 | Ga0157375_10032914 | Ga0157375_100329142 | 161 |
| 28 | 3300005435 | Ga0070714_100777134 | Ga0070714_1007771342 | 162 |
| 29 | 3300005543 | Ga0070672_100007989 | Ga0070672_1000079893 | 162 |
| 30 | 3300006358 | Ga0068871_100234125 | Ga0068871_1002341252 | 162 |
| 31 | 3300025929 | Ga0207664_10531234 | Ga0207664_105312342 | 162 |
| 32 | 3300005329 | Ga0070683_100003163 | Ga0070683_1000031633 | 166 |
| 33 | 3300005336 | Ga0070680_100001667 | Ga0070680_1000016673 | 166 |
| 34 | 3300005339 | Ga0070660_100007554 | Ga0070660_1000075546 | 166 |
| 35 | 3300005341 | Ga0070691_10010014 | Ga0070691_100100142 | 166 |
| 36 | 3300005366 | Ga0070659_100052830 | Ga0070659_1000528303 | 166 |
| 37 | 3300005530 | Ga0070679_100053322 | Ga0070679_1000533222 | 166 |
| 38 | 3300005535 | Ga0070684_100006761 | Ga0070684_1000067613 | 166 |
| 39 | 3300005539 | Ga0068853_100019098 | Ga0068853_1000190982 | 166 |
| 40 | 3300005563 | Ga0068855_100026934 | Ga0068855_1000269342 | 166 |
| 41 | 3300005577 | Ga0068857_100010355 | Ga0068857_1000103556 | 166 |
| 42 | 3300005616 | Ga0068852_100022415 | Ga0068852_1000224156 | 166 |
| 43 | 3300005834 | Ga0068851_10004202 | Ga0068851_100042022 | 166 |
| 44 | 3300025321 | Ga0207656_10004689 | Ga0207656_100046892 | 166 |
| 45 | 3300025912 | Ga0207707_10001745 | Ga0207707_1000174518 | 166 |
| 46 | 3300025913 | Ga0207695_10051679 | Ga0207695_100516792 | 166 |
| 47 | 3300025914 | Ga0207671_10021059 | Ga0207671_100210593 | 166 |
| 48 | 3300025917 | Ga0207660_10001256 | Ga0207660_100012563 | 166 |
| 49 | 3300025919 | Ga0207657_10009190 | Ga0207657_100091906 | 166 |
| 50 | 3300025920 | Ga0207649_10470806 | Ga0207649_104708062 | 166 |
| 51 | 3300025921 | Ga0207652_10003897 | Ga0207652_100038973 | 166 |
| 52 | 3300025924 | Ga0207694_10015295 | Ga0207694_100152953 | 166 |
| 53 | 3300025944 | Ga0207661_10031739 | Ga0207661_100317392 | 166 |
| 54 | 3300025949 | Ga0207667_10014314 | Ga0207667_100143146 | 166 |
| 55 | 3300026041 | Ga0207639_10007834 | Ga0207639_100078343 | 166 |
| 56 | 3300026116 | Ga0207674_10054532 | Ga0207674_100545322 | 166 |
| 57 | 3300026142 | Ga0207698_10260627 | Ga0207698_102606272 | 166 |
| 58 | 3300053138 | Ga0500564_082115 | Ga0500564_082115_272_814 | 166 |
| 59 | 3300050515 | nmdc:mga0a205_495129_c1 | nmdc:mga0a205_495129_c1_21_527 | 168 |
| 60 | 3300044694 | Ga0466963_0507637 | Ga0466963_0507637_36_578 | 171 |
| 61 | 3300045976 | Ga0466967_0589927 | Ga0466967_0589927_95_637 | 171 |
| 62 | 3300053111 | Ga0500572_000492 | Ga0500572_000492_6506_7048 | 171 |
| 63 | 3300053136 | Ga0500559_0003494 | Ga0500559_0003494_583_1125 | 171 |
| 64 | 3300053163 | Ga0500639_025515 | Ga0500639_025515_2029_2571 | 171 |
| 65 | 3300053735 | Ga0500596_008565 | Ga0500596_008565_986_1528 | 171 |
| 66 | 3300035241 | Ga0373961_0198170 | Ga0373961_0198170_175_693 | 172 |
| 67 | 3300039450 | Ga0436363_0608756 | Ga0436363_0608756_535_1077 | 172 |
| 68 | iso_pu_bacteria | 2508501128 | 2509153163 | 175 |
| 69 | iso_pu_bacteria | 2513237094 | 2513640250 | 176 |
| 70 | iso_pu_bacteria | 2513237095 | 2513648655 | 176 |
| 71 | iso_pu_bacteria | 2513237161 | 2514017633 | 176 |
| 72 | iso_pu_bacteria | 2617270735 | 2617349938 | 176 |
| 73 | iso_pu_bacteria | 2791355197 | 2793071493 | 176 |
| 74 | iso_pu_bacteria | 2816332527 | 2818241931 | 176 |
| 75 | iso_pu_bacteria | 2841983080 | 2841989033 | 176 |
| 76 | iso_pu_bacteria | 2847939898 | 2847944733 | 176 |
| 77 | iso_pu_bacteria | 2879127579 | 2879129819 | 176 |
| 78 | iso_pu_bacteria | 2879142872 | 2879146144 | 176 |
| 79 | iso_pu_bacteria | 2888378607 | 2888382064 | 176 |
| 80 | iso_pu_bacteria | 2935959822 | 2935963609 | 176 |
| 81 | iso_pu_bacteria | 3005506211 | 3005512188 | 176 |
| 82 | 3300035725 | Ga0373947_0281092 | Ga0373947_0281092_301_840 | 179 |
| 83 | 3300046461 | Ga0495641_0115886 | Ga0495641_0115886_245_784 | 179 |
| 84 | 3300046517 | Ga0495630_0623922 | Ga0495630_0623922_203_742 | 179 |
| 85 | 3300048918 | Ga0496115_0110407 | Ga0496115_0110407_1306_1845 | 179 |
| 86 | 3300003354 | JGI25160J50197_1003864 | JGI25160J50197_10038644 | 180 |
| 87 | 3300003771 | Ga0055526_1017797 | Ga0055526_10177972 | 180 |
| 88 | 3300005262 | Ga0065165_1033372 | Ga0065165_10333722 | 180 |
| 89 | 3300005341 | Ga0070691_10242901 | Ga0070691_102429011 | 180 |
| 90 | 3300005347 | Ga0070668_100074547 | Ga0070668_1000745473 | 180 |
| 91 | 3300005434 | Ga0070709_10002981 | Ga0070709_100029815 | 180 |
| 92 | 3300005434 | Ga0070709_10319613 | Ga0070709_103196131 | 180 |
| 93 | 3300005434 | Ga0070709_10604238 | Ga0070709_106042381 | 180 |
| 94 | 3300005435 | Ga0070714_100004849 | Ga0070714_1000048493 | 180 |
| 95 | 3300005435 | Ga0070714_100461526 | Ga0070714_1004615263 | 180 |
| 96 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003969 | 180 |
| 97 | 3300005436 | Ga0070713_101123804 | Ga0070713_1011238041 | 180 |
| 98 | 3300005437 | Ga0070710_10006567 | Ga0070710_100065675 | 180 |
| 99 | 3300005439 | Ga0070711_100003697 | Ga0070711_1000036974 | 180 |
| 100 | 3300005471 | Ga0070698_100211951 | Ga0070698_1002119512 | 180 |
| 101 | 3300005530 | Ga0070679_100121459 | Ga0070679_1001214592 | 180 |
| 102 | 3300005535 | Ga0070684_100005067 | Ga0070684_1000050675 | 180 |
| 103 | 3300005539 | Ga0068853_100343783 | Ga0068853_1003437832 | 180 |
| 104 | 3300005539 | Ga0068853_100513062 | Ga0068853_1005130622 | 180 |
| 105 | 3300005546 | Ga0070696_100145247 | Ga0070696_1001452472 | 180 |
| 106 | 3300005548 | Ga0070665_100142317 | Ga0070665_1001423172 | 180 |
| 107 | 3300005563 | Ga0068855_100296071 | Ga0068855_1002960712 | 180 |
| 108 | 3300005614 | Ga0068856_100102399 | Ga0068856_1001023992 | 180 |
| 109 | 3300005614 | Ga0068856_100315497 | Ga0068856_1003154972 | 180 |
| 110 | 3300005617 | Ga0068859_100508591 | Ga0068859_1005085913 | 180 |
| 111 | 3300005843 | Ga0068860_100969301 | Ga0068860_1009693012 | 180 |
| 112 | 3300005937 | Ga0081455_10180745 | Ga0081455_101807452 | 180 |
| 113 | 3300005983 | Ga0081540_1067081 | Ga0081540_10670813 | 180 |
| 114 | 3300006163 | Ga0070715_10065572 | Ga0070715_100655723 | 180 |
| 115 | 3300006237 | Ga0097621_100422477 | Ga0097621_1004224771 | 180 |
| 116 | 3300006358 | Ga0068871_101236863 | Ga0068871_1012368632 | 180 |
| 117 | 3300006871 | Ga0075434_100500495 | Ga0075434_1005004951 | 180 |
| 118 | 3300006931 | Ga0097620_100508588 | Ga0097620_1005085883 | 180 |
| 119 | 3300009093 | Ga0105240_10354414 | Ga0105240_103544142 | 180 |
| 120 | 3300009093 | Ga0105240_10798837 | Ga0105240_107988372 | 180 |
| 121 | 3300009101 | Ga0105247_10028150 | Ga0105247_100281504 | 180 |
| 122 | 3300009174 | Ga0105241_10860473 | Ga0105241_108604732 | 180 |
| 123 | 3300009176 | Ga0105242_11527823 | Ga0105242_115278231 | 180 |
| 124 | 3300009545 | Ga0105237_10020532 | Ga0105237_100205322 | 180 |
| 125 | 3300009545 | Ga0105237_10520603 | Ga0105237_105206032 | 180 |
| 126 | 3300009545 | Ga0105237_10848956 | Ga0105237_108489561 | 180 |
| 127 | 3300009545 | Ga0105237_11111090 | Ga0105237_111110901 | 180 |
| 128 | 3300009551 | Ga0105238_10355254 | Ga0105238_103552542 | 180 |
| 129 | 3300010375 | Ga0105239_10050052 | Ga0105239_100500522 | 180 |
| 130 | 3300013104 | Ga0157370_10103622 | Ga0157370_101036222 | 180 |
| 131 | 3300013104 | Ga0157370_10394063 | Ga0157370_103940632 | 180 |
| 132 | 3300013105 | Ga0157369_10033390 | Ga0157369_100333903 | 180 |
| 133 | 3300013105 | Ga0157369_10059326 | Ga0157369_100593262 | 180 |
| 134 | 3300013105 | Ga0157369_11175396 | Ga0157369_111753961 | 180 |
| 135 | 3300013105 | Ga0157369_11281489 | Ga0157369_112814892 | 180 |
| 136 | 3300013296 | Ga0157374_10306214 | Ga0157374_103062142 | 180 |
| 137 | 3300013307 | Ga0157372_10115748 | Ga0157372_101157482 | 180 |
| 138 | 3300013307 | Ga0157372_11152943 | Ga0157372_111529432 | 180 |
| 139 | 3300013308 | Ga0157375_10350251 | Ga0157375_103502512 | 180 |
| 140 | 3300014968 | Ga0157379_11209788 | Ga0157379_112097881 | 180 |
| 141 | 3300025295 | Ga0209564_1003348 | Ga0209564_10033487 | 180 |
| 142 | 3300025297 | Ga0209758_1006245 | Ga0209758_10062451 | 180 |
| 143 | 3300025299 | Ga0209256_1001337 | Ga0209256_100133711 | 180 |
| 144 | 3300025302 | Ga0207426_1001389 | Ga0207426_10013895 | 180 |
| 145 | 3300025900 | Ga0207710_10022294 | Ga0207710_100222942 | 180 |
| 146 | 3300025905 | Ga0207685_10052035 | Ga0207685_100520352 | 180 |
| 147 | 3300025906 | Ga0207699_10009654 | Ga0207699_100096544 | 180 |
| 148 | 3300025906 | Ga0207699_10044493 | Ga0207699_100444932 | 180 |
| 149 | 3300025912 | Ga0207707_10071840 | Ga0207707_100718402 | 180 |
| 150 | 3300025912 | Ga0207707_10245231 | Ga0207707_102452312 | 180 |
| 151 | 3300025913 | Ga0207695_10675783 | Ga0207695_106757831 | 180 |
| 152 | 3300025914 | Ga0207671_10312959 | Ga0207671_103129591 | 180 |
| 153 | 3300025914 | Ga0207671_10434920 | Ga0207671_104349202 | 180 |
| 154 | 3300025914 | Ga0207671_10503435 | Ga0207671_105034352 | 180 |
| 155 | 3300025914 | Ga0207671_10504933 | Ga0207671_105049332 | 180 |
| 156 | 3300025914 | Ga0207671_10582401 | Ga0207671_105824012 | 180 |
| 157 | 3300025915 | Ga0207693_10146008 | Ga0207693_101460082 | 180 |
| 158 | 3300025916 | Ga0207663_10024077 | Ga0207663_100240772 | 180 |
| 159 | 3300025916 | Ga0207663_10651029 | Ga0207663_106510292 | 180 |
| 160 | 3300025921 | Ga0207652_10095144 | Ga0207652_100951442 | 180 |
| 161 | 3300025922 | Ga0207646_11209966 | Ga0207646_112099661 | 180 |
| 162 | 3300025924 | Ga0207694_10247754 | Ga0207694_102477542 | 180 |
| 163 | 3300025929 | Ga0207664_10053468 | Ga0207664_100534683 | 180 |
| 164 | 3300025929 | Ga0207664_10178473 | Ga0207664_101784733 | 180 |
| 165 | 3300025929 | Ga0207664_10307852 | Ga0207664_103078522 | 180 |
| 166 | 3300025944 | Ga0207661_10589359 | Ga0207661_105893592 | 180 |
| 167 | 3300025949 | Ga0207667_10107188 | Ga0207667_101071882 | 180 |
| 168 | 3300025949 | Ga0207667_10253008 | Ga0207667_102530082 | 180 |
| 169 | 3300025949 | Ga0207667_10316069 | Ga0207667_103160691 | 180 |
| 170 | 3300025972 | Ga0207668_10055699 | Ga0207668_100556992 | 180 |
| 171 | 3300025981 | Ga0207640_10228774 | Ga0207640_102287742 | 180 |
| 172 | 3300026035 | Ga0207703_10047023 | Ga0207703_100470232 | 180 |
| 173 | 3300026041 | Ga0207639_10332038 | Ga0207639_103320382 | 180 |
| 174 | 3300026067 | Ga0207678_10838458 | Ga0207678_108384581 | 180 |
| 175 | 3300026116 | Ga0207674_10095323 | Ga0207674_100953232 | 180 |
| 176 | 3300026116 | Ga0207674_10668457 | Ga0207674_106684572 | 180 |
| 177 | 3300026142 | Ga0207698_11091302 | Ga0207698_110913022 | 180 |
| 178 | 3300028379 | Ga0268266_10265886 | Ga0268266_102658862 | 180 |
| 179 | 3300028556 | Ga0265337_1005145 | Ga0265337_10051454 | 180 |
| 180 | 3300028558 | Ga0265326_10002419 | Ga0265326_100024194 | 180 |
| 181 | 3300028563 | Ga0265319_1008268 | Ga0265319_10082682 | 180 |
| 182 | 3300028573 | Ga0265334_10008736 | Ga0265334_100087362 | 180 |
| 183 | 3300028573 | Ga0265334_10199052 | Ga0265334_101990521 | 180 |
| 184 | 3300028653 | Ga0265323_10000837 | Ga0265323_1000083712 | 180 |
| 185 | 3300028666 | Ga0265336_10000593 | Ga0265336_100005934 | 180 |
| 186 | 3300028800 | Ga0265338_10000013 | Ga0265338_1000001335 | 180 |
| 187 | 3300031235 | Ga0265330_10060662 | Ga0265330_100606622 | 180 |
| 188 | 3300031247 | Ga0265340_10052571 | Ga0265340_100525712 | 180 |
| 189 | 3300031250 | Ga0265331_10313057 | Ga0265331_103130571 | 180 |
| 190 | 3300031711 | Ga0265314_10199381 | Ga0265314_101993812 | 180 |
| 191 | 3300035086 | Ga0373934_0117820 | Ga0373934_0117820_280_822 | 180 |
| 192 | 3300035089 | Ga0373944_0223456 | Ga0373944_0223456_55_597 | 180 |
| 193 | 3300035113 | Ga0373936_0055010 | Ga0373936_0055010_76_618 | 180 |
| 194 | 3300035116 | Ga0373945_0030918 | Ga0373945_0030918_1227_1769 | 180 |
| 195 | 3300035170 | Ga0373943_0070321 | Ga0373943_0070321_520_1062 | 180 |
| 196 | 3300035207 | Ga0373942_0085103 | Ga0373942_0085103_151_693 | 180 |
| 197 | 3300035692 | Ga0373935_0162698 | Ga0373935_0162698_924_1466 | 180 |
| 198 | 3300035695 | Ga0373927_0094914 | Ga0373927_0094914_840_1382 | 180 |
| 199 | 3300035695 | Ga0373927_0275199 | Ga0373927_0275199_151_693 | 180 |
| 200 | 3300035725 | Ga0373947_0013012 | Ga0373947_0013012_3918_4460 | 180 |
| 201 | 3300037068 | Ga0373925_0123770 | Ga0373925_0123770_1391_1933 | 180 |
| 202 | 3300037418 | Ga0395900_0328820 | Ga0395900_0328820_686_1228 | 180 |
| 203 | 3300037466 | Ga0395898_0019680 | Ga0395898_0019680_4137_4679 | 180 |
| 204 | 3300037466 | Ga0395898_0521617 | Ga0395898_0521617_277_819 | 180 |
| 205 | 3300037853 | Ga0436364_1379571 | Ga0436364_1379571_41_583 | 180 |
| 206 | 3300039437 | Ga0436365_1535963 | Ga0436365_1535963_1096_1638 | 180 |
| 207 | 3300039437 | Ga0436365_1605560 | Ga0436365_1605560_282_824 | 180 |
| 208 | 3300041486 | Ga0451807_2488207 | Ga0451807_2488207_193_735 | 180 |
| 209 | 3300044842 | Ga0466957_0043912 | Ga0466957_0043912_1860_2402 | 180 |
| 210 | 3300046454 | Ga0495592_0095856 | Ga0495592_0095856_959_1501 | 180 |
| 211 | 3300046455 | Ga0495603_0066997 | Ga0495603_0066997_1342_1884 | 180 |
| 212 | 3300046459 | Ga0495629_0016024 | Ga0495629_0016024_2203_2745 | 180 |
| 213 | 3300046459 | Ga0495629_0341605 | Ga0495629_0341605_224_766 | 180 |
| 214 | 3300046461 | Ga0495641_0032993 | Ga0495641_0032993_1211_1753 | 180 |
| 215 | 3300046462 | Ga0495651_0199019 | Ga0495651_0199019_131_673 | 180 |
| 216 | 3300046472 | Ga0495580_0050434 | Ga0495580_0050434_1772_2314 | 180 |
| 217 | 3300046475 | Ga0495639_0010555 | Ga0495639_0010555_1095_1637 | 180 |
| 218 | 3300046514 | Ga0495618_0181824 | Ga0495618_0181824_504_1046 | 180 |
| 219 | 3300046516 | Ga0495628_0269814 | Ga0495628_0269814_366_908 | 180 |
| 220 | 3300046517 | Ga0495630_0355953 | Ga0495630_0355953_342_884 | 180 |
| 221 | 3300046526 | Ga0495666_0087556 | Ga0495666_0087556_467_1009 | 180 |
| 222 | 3300046531 | Ga0495665_0001580 | Ga0495665_0001580_1518_2060 | 180 |
| 223 | 3300046533 | Ga0495640_0020780 | Ga0495640_0020780_3813_4355 | 180 |
| 224 | 3300046535 | Ga0495586_0154365 | Ga0495586_0154365_584_1126 | 180 |
| 225 | 3300046557 | Ga0495622_0016052 | Ga0495622_0016052_2578_3120 | 180 |
| 226 | 3300046642 | Ga0495634_0080873 | Ga0495634_0080873_1193_1735 | 180 |
| 227 | 3300046663 | Ga0495635_0416030 | Ga0495635_0416030_108_650 | 180 |
| 228 | 3300046674 | Ga0495588_0191867 | Ga0495588_0191867_158_700 | 180 |
| 229 | 3300046675 | Ga0495657_0293547 | Ga0495657_0293547_117_659 | 180 |
| 230 | 3300046678 | Ga0495599_0334810 | Ga0495599_0334810_350_892 | 180 |
| 231 | 3300046679 | Ga0495623_0174708 | Ga0495623_0174708_22_564 | 180 |
| 232 | 3300046681 | Ga0495647_0032501 | Ga0495647_0032501_244_786 | 180 |
| 233 | 3300046809 | Ga0495600_0122214 | Ga0495600_0122214_47_589 | 180 |
| 234 | 3300047315 | Ga0495581_0031557 | Ga0495581_0031557_529_1071 | 180 |
| 235 | 3300047319 | Ga0495674_0147783 | Ga0495674_0147783_816_1358 | 180 |
| 236 | 3300047319 | Ga0495674_0178819 | Ga0495674_0178819_1017_1559 | 180 |
| 237 | 3300047321 | Ga0495676_0422689 | Ga0495676_0422689_86_628 | 180 |
| 238 | 3300047322 | Ga0495680_0090420 | Ga0495680_0090420_650_1192 | 180 |
| 239 | 3300047322 | Ga0495680_0126033 | Ga0495680_0126033_582_1124 | 180 |
| 240 | 3300047469 | Ga0495673_0247923 | Ga0495673_0247923_97_639 | 180 |
| 241 | 3300047471 | Ga0495684_0298691 | Ga0495684_0298691_391_933 | 180 |
| 242 | 3300047472 | Ga0495686_0334164 | Ga0495686_0334164_180_722 | 180 |
| 243 | 3300047673 | Ga0495593_0024285 | Ga0495593_0024285_519_1061 | 180 |
| 244 | 3300048088 | Ga0495602_0269049 | Ga0495602_0269049_157_699 | 180 |
| 245 | 3300048907 | Ga0496104_0668512 | Ga0496104_0668512_29_571 | 180 |
| 246 | 3300048913 | Ga0496110_0142668 | Ga0496110_0142668_249_791 | 180 |
| 247 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_139806_140348 | 180 |
| 248 | 3300048918 | Ga0496115_0066702 | Ga0496115_0066702_1255_1797 | 180 |
| 249 | 3300048918 | Ga0496115_0795973 | Ga0496115_0795973_33_575 | 180 |
| 250 | 3300048923 | Ga0496120_0143626 | Ga0496120_0143626_134_676 | 180 |
| 251 | 3300048924 | Ga0496121_0093368 | Ga0496121_0093368_1128_1670 | 180 |
| 252 | 3300048924 | Ga0496121_0154542 | Ga0496121_0154542_650_1192 | 180 |
| 253 | 3300048927 | Ga0496124_0130988 | Ga0496124_0130988_514_1056 | 180 |
| 254 | 3300048928 | Ga0496125_0023632 | Ga0496125_0023632_1114_1656 | 180 |
| 255 | 3300048929 | Ga0496126_0196644 | Ga0496126_0196644_118_660 | 180 |
| 256 | 3300048929 | Ga0496126_0260650 | Ga0496126_0260650_68_610 | 180 |
| 257 | 3300048929 | Ga0496126_0807226 | Ga0496126_0807226_90_632 | 180 |
| 258 | 3300050512 | nmdc:mga0n895_163259_c1 | nmdc:mga0n895_163259_c1_1541_2083 | 180 |
| 259 | 3300050515 | nmdc:mga0a205_600351_c1 | nmdc:mga0a205_600351_c1_62_604 | 180 |
| 260 | 3300053085 | Ga0495619_0269801 | Ga0495619_0269801_134_676 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ew5-assembly3.cif.gz_C | crystal structure of colicin e9 in complex with its immunity protein im9 | 0.8453 | 26 | 87 |
| 7nsu-assembly1.cif.gz_D | colicine9 intact translocation complex | 0.8443 | 26 | 87 |
| 1ujw-assembly1.cif.gz_B | structure of the complex between btub and colicin e3 receptor binding domain | 0.8426 | 26 | 87 |
| 2b5u-assembly2.cif.gz_C | crystal structure of colicin e3 v206c mutant in complex with its immunity protein | 0.8289 | 26 | 87 |
| 2ysu-assembly1.cif.gz_B | structure of the complex between btub and colicin e2 receptor binding domain | 0.8039 | 26 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ujwB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins | 0.8426 | 26 | 87 | 1.10.287.620 |
| 4i9qB04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain | 0.8298 | 27 | 86 | 1.10.287.690 |
| 2b5uC02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins | 0.8289 | 26 | 87 | 1.10.287.620 |
| 2b5uA02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins | 0.8275 | 26 | 87 | 1.10.287.620 |
| 1g4yB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.827 | 27 | 89 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3P1UI25-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.8669 | 23 | 89 |
GO:0016020
|
| AF-A0A7C9RED7-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.8433 | 1 | 104 |
GO:0016020
|
| AF-A0A7C9RED7-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.8292 | 1 | 104 |
GO:0016020
|
| AF-A0A7W1L4U8-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.7982 | 12 | 125 |
GO:0016020
|
| AF-A0A7W1L4U8-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.7739 | 12 | 125 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar