F369442

General Info

Members Datasets Scaffolds Average Seq Length
260 187 246 176

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10180745|Ga0081455_101807452
Length 193
Sequence MTARGGSDAIGLGMSESELEIVVDDPTAPEEDSPAVTSNRAVDVVVSLLLLALACVLGYDNWRTGAGWDSTGPEPGYFPFYLCVILAGASLYGLIAAFLSRTEAAETFVTRAQLRRVMAVFVPTFLFCLMTQFLGLYVASFLLIAGFMRFVGKIALWKSLLTAFVFTALMFVTFDIAFDVIMPKGPLEAAFGY

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
6 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
7 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
8 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
9 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
10 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
11 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
12 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
13 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
14 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
187 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.62
Metatranscriptomes 0
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 4.23
Rhizoplane 2.69
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1003864 3300003354 Bacteria 6576
2 Ga0055526_1017797 3300003771 Bacteria 2693
3 Ga0065165_1033372 3300005262 Bacteria 1602
4 Ga0070683_100003163 3300005329 Bacteria 13275
5 Ga0070666_10026969 3300005335 Bacteria 3758
6 Ga0070680_100001667 3300005336 Bacteria 16258
7 Ga0070660_100007554 3300005339 Bacteria 7576
8 Ga0070691_10010014 3300005341 Bacteria 4320
9 Ga0070691_10242901 3300005341 Bacteria 963
10 Ga0070668_100074547 3300005347 Bacteria 2648
11 Ga0070668_100251919 3300005347 Bacteria 1466
12 Ga0070674_100117355 3300005356 Bacteria 1965
13 Ga0070673_100188986 3300005364 Bacteria 1768
14 Ga0070659_100052830 3300005366 Bacteria 3197
15 Ga0070667_100034703 3300005367 Bacteria 4222
16 Ga0070709_10002981 3300005434 Bacteria 9109
17 Ga0070709_10319613 3300005434 Bacteria 1139
18 Ga0070709_10604238 3300005434 Bacteria 845
19 Ga0070714_100004849 3300005435 Bacteria 10213
20 Ga0070714_100461526 3300005435 Bacteria 1207
21 Ga0070714_100777134 3300005435 Bacteria 926
22 Ga0070713_100000039 3300005436 Bacteria 83384
23 Ga0070713_101123804 3300005436 Bacteria 760
24 Ga0070710_10006567 3300005437 Bacteria 5594
25 Ga0070711_100003697 3300005439 Bacteria 8958
26 Ga0070678_100000991 3300005456 Bacteria 14681
27 Ga0070698_100211951 3300005471 Bacteria 1872
28 Ga0070679_100053322 3300005530 Bacteria 4026
29 Ga0070679_100121459 3300005530 Bacteria 2597
30 Ga0070684_100005067 3300005535 Bacteria 10061
31 Ga0070684_100006761 3300005535 Bacteria 8888
32 Ga0068853_100019098 3300005539 Bacteria 5679
33 Ga0068853_100343783 3300005539 Bacteria 1387
34 Ga0068853_100513062 3300005539 Bacteria 1133
35 Ga0070672_100007989 3300005543 Bacteria 7225
36 Ga0070696_100145247 3300005546 Bacteria 1737
37 Ga0070665_100013407 3300005548 Bacteria 8248
38 Ga0070665_100142317 3300005548 Bacteria 2401
39 Ga0068855_100026934 3300005563 Bacteria 6879
40 Ga0068855_100296071 3300005563 Bacteria 1793
41 Ga0068857_100010355 3300005577 Bacteria 8102
42 Ga0068856_100102399 3300005614 Bacteria 2857
43 Ga0068856_100315497 3300005614 Bacteria 1581
44 Ga0068852_100022415 3300005616 Bacteria 5065
45 Ga0068859_100082059 3300005617 Bacteria 3267
46 Ga0068859_100508591 3300005617 Bacteria 1300
47 Ga0068851_10004202 3300005834 Bacteria 6487
48 Ga0068863_100417621 3300005841 Bacteria 1314
49 Ga0068860_100161654 3300005843 Bacteria 2159
50 Ga0068860_100969301 3300005843 Bacteria 868
51 Ga0081455_10180745 3300005937 Bacteria 1597
52 Ga0081540_1067081 3300005983 Bacteria 1678
53 Ga0070715_10065572 3300006163 Bacteria 1608
54 Ga0097621_100107239 3300006237 Bacteria 2357
55 Ga0097621_100422477 3300006237 Bacteria 1197
56 Ga0068871_100234125 3300006358 Bacteria 1595
57 Ga0068871_101236863 3300006358 Bacteria 701
58 Ga0075434_100500495 3300006871 Bacteria 1236
59 Ga0097620_100082058 3300006931 Bacteria 3267
60 Ga0097620_100508588 3300006931 Bacteria 1300
61 Ga0105240_10354414 3300009093 Bacteria 1664
62 Ga0105240_10798837 3300009093 Bacteria 1022
63 Ga0105247_10028150 3300009101 Bacteria 3400
64 Ga0105241_10860473 3300009174 Bacteria 839
65 Ga0105242_10376925 3300009176 Bacteria 1318
66 Ga0105242_11527823 3300009176 Bacteria 699
67 Ga0105237_10020532 3300009545 Bacteria 6807
68 Ga0105237_10520603 3300009545 Bacteria 1196
69 Ga0105237_10848956 3300009545 Bacteria 920
70 Ga0105237_11111090 3300009545 Bacteria 797
71 Ga0105238_10355254 3300009551 Bacteria 1455
72 Ga0105239_10050052 3300010375 Bacteria 4583
73 Ga0157370_10103622 3300013104 Bacteria 2663
74 Ga0157370_10394063 3300013104 Bacteria 1275
75 Ga0157369_10033390 3300013105 Bacteria 5656
76 Ga0157369_10059326 3300013105 Bacteria 4126
77 Ga0157369_11175396 3300013105 Bacteria 783
78 Ga0157369_11281489 3300013105 Bacteria 747
79 Ga0157374_10306214 3300013296 Bacteria 1573
80 Ga0157372_10115748 3300013307 Bacteria 3074
81 Ga0157372_11152943 3300013307 Bacteria 896
82 Ga0157375_10032914 3300013308 Bacteria 4921
83 Ga0157375_10350251 3300013308 Bacteria 1643
84 Ga0157379_11209788 3300014968 Bacteria 727
85 Ga0209564_1003348 3300025295 Bacteria 11109
86 Ga0209758_1006245 3300025297 Bacteria 8679
87 Ga0209256_1001337 3300025299 Bacteria 26265
88 Ga0207426_1001389 3300025302 Bacteria 20453
89 Ga0207656_10004689 3300025321 Bacteria 4793
90 Ga0207710_10022294 3300025900 Bacteria 2718
91 Ga0207680_10249261 3300025903 Bacteria 1226
92 Ga0207685_10052035 3300025905 Bacteria 1585
93 Ga0207699_10009654 3300025906 Bacteria 4815
94 Ga0207699_10044493 3300025906 Bacteria 2585
95 Ga0207707_10001745 3300025912 Bacteria 19977
96 Ga0207707_10071840 3300025912 Bacteria 3016
97 Ga0207707_10245231 3300025912 Bacteria 1557
98 Ga0207695_10051679 3300025913 Bacteria 4312
99 Ga0207695_10675783 3300025913 Bacteria 913
100 Ga0207671_10021059 3300025914 Bacteria 4953
101 Ga0207671_10312959 3300025914 Bacteria 1241
102 Ga0207671_10434920 3300025914 Bacteria 1044
103 Ga0207671_10503435 3300025914 Bacteria 966
104 Ga0207671_10504933 3300025914 Bacteria 964
105 Ga0207671_10582401 3300025914 Bacteria 892
106 Ga0207693_10146008 3300025915 Bacteria 1860
107 Ga0207663_10024077 3300025916 Bacteria 3503
108 Ga0207663_10651029 3300025916 Bacteria 831
109 Ga0207660_10001256 3300025917 Bacteria 16995
110 Ga0207657_10009190 3300025919 Bacteria 9966
111 Ga0207649_10470806 3300025920 Bacteria 951
112 Ga0207652_10003897 3300025921 Bacteria 12206
113 Ga0207652_10095144 3300025921 Bacteria 2623
114 Ga0207646_11209966 3300025922 Bacteria 662
115 Ga0207694_10015295 3300025924 Bacteria 5790
116 Ga0207694_10247754 3300025924 Bacteria 1457
117 Ga0207664_10053468 3300025929 Bacteria 3197
118 Ga0207664_10178473 3300025929 Bacteria 1822
119 Ga0207664_10307852 3300025929 Bacteria 1395
120 Ga0207664_10531234 3300025929 Bacteria 1055
121 Ga0207706_10558608 3300025933 Bacteria 985
122 Ga0207686_10031491 3300025934 Bacteria 3150
123 Ga0207661_10031739 3300025944 Bacteria 4085
124 Ga0207661_10589359 3300025944 Bacteria 1020
125 Ga0207667_10014314 3300025949 Bacteria 9047
126 Ga0207667_10107188 3300025949 Bacteria 2882
127 Ga0207667_10253008 3300025949 Bacteria 1802
128 Ga0207667_10316069 3300025949 Bacteria 1595
129 Ga0207651_10174637 3300025960 Bacteria 1698
130 Ga0207668_10055699 3300025972 Bacteria 2750
131 Ga0207640_10228774 3300025981 Bacteria 1429
132 Ga0207658_10007272 3300025986 Bacteria 7550
133 Ga0207658_10216023 3300025986 Bacteria 1610
134 Ga0207703_10047023 3300026035 Bacteria 3478
135 Ga0207703_10450992 3300026035 Bacteria 1201
136 Ga0207639_10007834 3300026041 Bacteria 7295
137 Ga0207639_10332038 3300026041 Bacteria 1353
138 Ga0207678_10838458 3300026067 Bacteria 812
139 Ga0207641_11629250 3300026088 Unclassified 647
140 Ga0207674_10054532 3300026116 Bacteria 4069
141 Ga0207674_10095323 3300026116 Bacteria 2962
142 Ga0207674_10668457 3300026116 Bacteria 1003
143 Ga0207683_10001221 3300026121 Bacteria 23317
144 Ga0207698_10260627 3300026142 Bacteria 1592
145 Ga0207698_11091302 3300026142 Bacteria 811
146 Ga0268266_10149707 3300028379 Bacteria 2102
147 Ga0268266_10265886 3300028379 Bacteria 1591
148 Ga0268264_10021721 3300028381 Bacteria 5239
149 Ga0265337_1005145 3300028556 Bacteria 5262
150 Ga0265326_10002419 3300028558 Bacteria 6287
151 Ga0265319_1008268 3300028563 Bacteria 4578
152 Ga0265334_10008736 3300028573 Bacteria 4303
153 Ga0265334_10199052 3300028573 Bacteria 696
154 Ga0265323_10000837 3300028653 Bacteria 16432
155 Ga0265336_10000593 3300028666 Bacteria 20297
156 Ga0265338_10000013 3300028800 Bacteria 379065
157 Ga0265330_10060662 3300031235 Bacteria 1646
158 Ga0265340_10052571 3300031247 Bacteria 1969
159 Ga0265331_10313057 3300031250 Bacteria 703
160 Ga0265314_10199381 3300031711 Bacteria 1185
161 Ga0373934_0117820 3300035086 Bacteria 1080
162 Ga0373944_0223456 3300035089 Bacteria 688
163 Ga0373936_0055010 3300035113 Bacteria 1615
164 Ga0373945_0030918 3300035116 Bacteria 1889
165 Ga0373943_0070321 3300035170 Bacteria 1771
166 Ga0373942_0085103 3300035207 Bacteria 944
167 Ga0373961_0198170 3300035241 Bacteria 707
168 Ga0373935_0162698 3300035692 Bacteria 1522
169 Ga0373927_0094914 3300035695 Bacteria 1938
170 Ga0373927_0275199 3300035695 Bacteria 1107
171 Ga0373947_0013012 3300035725 Bacteria 4771
172 Ga0373947_0281092 3300035725 Bacteria 1106
173 Ga0373925_0123770 3300037068 Bacteria 2010
174 Ga0395900_0328820 3300037418 Bacteria 1507
175 Ga0395898_0019680 3300037466 Bacteria 6866
176 Ga0395898_0521617 3300037466 Bacteria 1129
177 Ga0436364_1379571 3300037853 Bacteria 817
178 Ga0436365_1535963 3300039437 Bacteria 1902
179 Ga0436365_1605560 3300039437 Bacteria 999
180 Ga0436365_1612979 3300039437 Bacteria 1312
181 Ga0436363_0608756 3300039450 Bacteria 1122
182 Ga0451807_2488207 3300041486 Bacteria 957
183 Ga0466963_0507637 3300044694 Bacteria 851
184 Ga0466957_0043912 3300044842 Bacteria 2708
185 Ga0466967_0589927 3300045976 Bacteria 1096
186 Ga0495592_0095856 3300046454 Bacteria 2121
187 Ga0495603_0066997 3300046455 Bacteria 2114
188 Ga0495629_0016024 3300046459 Bacteria 5386
189 Ga0495629_0341605 3300046459 Bacteria 1022
190 Ga0495641_0032993 3300046461 Bacteria 2461
191 Ga0495641_0115886 3300046461 Bacteria 1195
192 Ga0495651_0199019 3300046462 Bacteria 1404
193 Ga0495580_0050434 3300046472 Bacteria 2943
194 Ga0495639_0010555 3300046475 Bacteria 3978
195 Ga0495618_0181824 3300046514 Bacteria 1336
196 Ga0495620_0092306 3300046515 Bacteria 1214
197 Ga0495628_0269814 3300046516 Bacteria 1266
198 Ga0495630_0355953 3300046517 Bacteria 1120
199 Ga0495630_0623922 3300046517 Bacteria 826
200 Ga0495666_0087556 3300046526 Bacteria 1471
201 Ga0495665_0001580 3300046531 Bacteria 12182
202 Ga0495640_0020780 3300046533 Bacteria 4827
203 Ga0495586_0154365 3300046535 Bacteria 1293
204 Ga0495622_0016052 3300046557 Bacteria 3484
205 Ga0495634_0080873 3300046642 Bacteria 2126
206 Ga0495635_0416030 3300046663 Bacteria 891
207 Ga0495588_0191867 3300046674 Bacteria 1079
208 Ga0495657_0293547 3300046675 Bacteria 970
209 Ga0495599_0334810 3300046678 Bacteria 909
210 Ga0495623_0174708 3300046679 Bacteria 1252
211 Ga0495647_0032501 3300046681 Bacteria 1945
212 Ga0495600_0122214 3300046809 Bacteria 1693
213 Ga0495581_0031557 3300047315 Bacteria 3069
214 Ga0495674_0147783 3300047319 Bacteria 1972
215 Ga0495674_0178819 3300047319 Bacteria 1768
216 Ga0495676_0422689 3300047321 Bacteria 882
217 Ga0495680_0090420 3300047322 Bacteria 2296
218 Ga0495680_0126033 3300047322 Bacteria 1886
219 Ga0495673_0247923 3300047469 Bacteria 651
220 Ga0495684_0298691 3300047471 Bacteria 1157
221 Ga0495686_0334164 3300047472 Bacteria 827
222 Ga0495593_0024285 3300047673 Bacteria 3360
223 Ga0495602_0269049 3300048088 Bacteria 1260
224 Ga0496104_0668512 3300048907 Bacteria 947
225 Ga0496110_0142668 3300048913 Bacteria 2166
226 Ga0496112_0000008 3300048915 Bacteria 310323
227 Ga0496115_0066702 3300048918 Bacteria 2909
228 Ga0496115_0110407 3300048918 Bacteria 2259
229 Ga0496115_0795973 3300048918 Bacteria 736
230 Ga0496120_0143626 3300048923 Bacteria 1208
231 Ga0496121_0093368 3300048924 Bacteria 2343
232 Ga0496121_0154542 3300048924 Bacteria 1685
233 Ga0496124_0130988 3300048927 Bacteria 1992
234 Ga0496125_0023632 3300048928 Bacteria 5668
235 Ga0496126_0196644 3300048929 Bacteria 1705
236 Ga0496126_0260650 3300048929 Bacteria 1442
237 Ga0496126_0807226 3300048929 Bacteria 719
238 nmdc:mga0n895_163259_c1 3300050512 Bacteria 2259
239 nmdc:mga0a205_495129_c1 3300050515 Bacteria 1079
240 nmdc:mga0a205_600351_c1 3300050515 Bacteria 954
241 Ga0495619_0269801 3300053085 Bacteria 1179
242 Ga0500572_000492 3300053111 Bacteria 13605
243 Ga0500559_0003494 3300053136 Bacteria 7710
244 Ga0500564_082115 3300053138 Bacteria 1443
245 Ga0500639_025515 3300053163 Bacteria 3125
246 Ga0500596_008565 3300053735 Bacteria 1627

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100082059 Ga0068859_1000820592 147
2 3300005841 Ga0068863_100417621 Ga0068863_1004176211 147
3 3300005843 Ga0068860_100161654 Ga0068860_1001616542 147
4 3300006931 Ga0097620_100082058 Ga0097620_1000820582 147
5 3300025986 Ga0207658_10216023 Ga0207658_102160232 147
6 3300026035 Ga0207703_10450992 Ga0207703_104509921 147
7 3300026088 Ga0207641_11629250 Ga0207641_116292501 147
8 3300028381 Ga0268264_10021721 Ga0268264_100217213 147
9 3300009176 Ga0105242_10376925 Ga0105242_103769252 155
10 3300025934 Ga0207686_10031491 Ga0207686_100314912 155
11 3300046515 Ga0495620_0092306 Ga0495620_0092306_31_501 156
12 3300039437 Ga0436365_1612979 Ga0436365_1612979_405_947 159
13 3300005335 Ga0070666_10026969 Ga0070666_100269692 160
14 3300005347 Ga0070668_100251919 Ga0070668_1002519192 160
15 3300005356 Ga0070674_100117355 Ga0070674_1001173552 160
16 3300005364 Ga0070673_100188986 Ga0070673_1001889862 160
17 3300005367 Ga0070667_100034703 Ga0070667_1000347034 160
18 3300005456 Ga0070678_100000991 Ga0070678_1000009915 160
19 3300005548 Ga0070665_100013407 Ga0070665_1000134071 160
20 3300006237 Ga0097621_100107239 Ga0097621_1001072392 160
21 3300025903 Ga0207680_10249261 Ga0207680_102492612 160
22 3300025933 Ga0207706_10558608 Ga0207706_105586082 160
23 3300025960 Ga0207651_10174637 Ga0207651_101746372 160
24 3300025986 Ga0207658_10007272 Ga0207658_100072724 160
25 3300026121 Ga0207683_10001221 Ga0207683_1000122110 160
26 3300028379 Ga0268266_10149707 Ga0268266_101497072 160
27 3300013308 Ga0157375_10032914 Ga0157375_100329142 161
28 3300005435 Ga0070714_100777134 Ga0070714_1007771342 162
29 3300005543 Ga0070672_100007989 Ga0070672_1000079893 162
30 3300006358 Ga0068871_100234125 Ga0068871_1002341252 162
31 3300025929 Ga0207664_10531234 Ga0207664_105312342 162
32 3300005329 Ga0070683_100003163 Ga0070683_1000031633 166
33 3300005336 Ga0070680_100001667 Ga0070680_1000016673 166
34 3300005339 Ga0070660_100007554 Ga0070660_1000075546 166
35 3300005341 Ga0070691_10010014 Ga0070691_100100142 166
36 3300005366 Ga0070659_100052830 Ga0070659_1000528303 166
37 3300005530 Ga0070679_100053322 Ga0070679_1000533222 166
38 3300005535 Ga0070684_100006761 Ga0070684_1000067613 166
39 3300005539 Ga0068853_100019098 Ga0068853_1000190982 166
40 3300005563 Ga0068855_100026934 Ga0068855_1000269342 166
41 3300005577 Ga0068857_100010355 Ga0068857_1000103556 166
42 3300005616 Ga0068852_100022415 Ga0068852_1000224156 166
43 3300005834 Ga0068851_10004202 Ga0068851_100042022 166
44 3300025321 Ga0207656_10004689 Ga0207656_100046892 166
45 3300025912 Ga0207707_10001745 Ga0207707_1000174518 166
46 3300025913 Ga0207695_10051679 Ga0207695_100516792 166
47 3300025914 Ga0207671_10021059 Ga0207671_100210593 166
48 3300025917 Ga0207660_10001256 Ga0207660_100012563 166
49 3300025919 Ga0207657_10009190 Ga0207657_100091906 166
50 3300025920 Ga0207649_10470806 Ga0207649_104708062 166
51 3300025921 Ga0207652_10003897 Ga0207652_100038973 166
52 3300025924 Ga0207694_10015295 Ga0207694_100152953 166
53 3300025944 Ga0207661_10031739 Ga0207661_100317392 166
54 3300025949 Ga0207667_10014314 Ga0207667_100143146 166
55 3300026041 Ga0207639_10007834 Ga0207639_100078343 166
56 3300026116 Ga0207674_10054532 Ga0207674_100545322 166
57 3300026142 Ga0207698_10260627 Ga0207698_102606272 166
58 3300053138 Ga0500564_082115 Ga0500564_082115_272_814 166
59 3300050515 nmdc:mga0a205_495129_c1 nmdc:mga0a205_495129_c1_21_527 168
60 3300044694 Ga0466963_0507637 Ga0466963_0507637_36_578 171
61 3300045976 Ga0466967_0589927 Ga0466967_0589927_95_637 171
62 3300053111 Ga0500572_000492 Ga0500572_000492_6506_7048 171
63 3300053136 Ga0500559_0003494 Ga0500559_0003494_583_1125 171
64 3300053163 Ga0500639_025515 Ga0500639_025515_2029_2571 171
65 3300053735 Ga0500596_008565 Ga0500596_008565_986_1528 171
66 3300035241 Ga0373961_0198170 Ga0373961_0198170_175_693 172
67 3300039450 Ga0436363_0608756 Ga0436363_0608756_535_1077 172
68 iso_pu_bacteria 2508501128 2509153163 175
69 iso_pu_bacteria 2513237094 2513640250 176
70 iso_pu_bacteria 2513237095 2513648655 176
71 iso_pu_bacteria 2513237161 2514017633 176
72 iso_pu_bacteria 2617270735 2617349938 176
73 iso_pu_bacteria 2791355197 2793071493 176
74 iso_pu_bacteria 2816332527 2818241931 176
75 iso_pu_bacteria 2841983080 2841989033 176
76 iso_pu_bacteria 2847939898 2847944733 176
77 iso_pu_bacteria 2879127579 2879129819 176
78 iso_pu_bacteria 2879142872 2879146144 176
79 iso_pu_bacteria 2888378607 2888382064 176
80 iso_pu_bacteria 2935959822 2935963609 176
81 iso_pu_bacteria 3005506211 3005512188 176
82 3300035725 Ga0373947_0281092 Ga0373947_0281092_301_840 179
83 3300046461 Ga0495641_0115886 Ga0495641_0115886_245_784 179
84 3300046517 Ga0495630_0623922 Ga0495630_0623922_203_742 179
85 3300048918 Ga0496115_0110407 Ga0496115_0110407_1306_1845 179
86 3300003354 JGI25160J50197_1003864 JGI25160J50197_10038644 180
87 3300003771 Ga0055526_1017797 Ga0055526_10177972 180
88 3300005262 Ga0065165_1033372 Ga0065165_10333722 180
89 3300005341 Ga0070691_10242901 Ga0070691_102429011 180
90 3300005347 Ga0070668_100074547 Ga0070668_1000745473 180
91 3300005434 Ga0070709_10002981 Ga0070709_100029815 180
92 3300005434 Ga0070709_10319613 Ga0070709_103196131 180
93 3300005434 Ga0070709_10604238 Ga0070709_106042381 180
94 3300005435 Ga0070714_100004849 Ga0070714_1000048493 180
95 3300005435 Ga0070714_100461526 Ga0070714_1004615263 180
96 3300005436 Ga0070713_100000039 Ga0070713_10000003969 180
97 3300005436 Ga0070713_101123804 Ga0070713_1011238041 180
98 3300005437 Ga0070710_10006567 Ga0070710_100065675 180
99 3300005439 Ga0070711_100003697 Ga0070711_1000036974 180
100 3300005471 Ga0070698_100211951 Ga0070698_1002119512 180
101 3300005530 Ga0070679_100121459 Ga0070679_1001214592 180
102 3300005535 Ga0070684_100005067 Ga0070684_1000050675 180
103 3300005539 Ga0068853_100343783 Ga0068853_1003437832 180
104 3300005539 Ga0068853_100513062 Ga0068853_1005130622 180
105 3300005546 Ga0070696_100145247 Ga0070696_1001452472 180
106 3300005548 Ga0070665_100142317 Ga0070665_1001423172 180
107 3300005563 Ga0068855_100296071 Ga0068855_1002960712 180
108 3300005614 Ga0068856_100102399 Ga0068856_1001023992 180
109 3300005614 Ga0068856_100315497 Ga0068856_1003154972 180
110 3300005617 Ga0068859_100508591 Ga0068859_1005085913 180
111 3300005843 Ga0068860_100969301 Ga0068860_1009693012 180
112 3300005937 Ga0081455_10180745 Ga0081455_101807452 180
113 3300005983 Ga0081540_1067081 Ga0081540_10670813 180
114 3300006163 Ga0070715_10065572 Ga0070715_100655723 180
115 3300006237 Ga0097621_100422477 Ga0097621_1004224771 180
116 3300006358 Ga0068871_101236863 Ga0068871_1012368632 180
117 3300006871 Ga0075434_100500495 Ga0075434_1005004951 180
118 3300006931 Ga0097620_100508588 Ga0097620_1005085883 180
119 3300009093 Ga0105240_10354414 Ga0105240_103544142 180
120 3300009093 Ga0105240_10798837 Ga0105240_107988372 180
121 3300009101 Ga0105247_10028150 Ga0105247_100281504 180
122 3300009174 Ga0105241_10860473 Ga0105241_108604732 180
123 3300009176 Ga0105242_11527823 Ga0105242_115278231 180
124 3300009545 Ga0105237_10020532 Ga0105237_100205322 180
125 3300009545 Ga0105237_10520603 Ga0105237_105206032 180
126 3300009545 Ga0105237_10848956 Ga0105237_108489561 180
127 3300009545 Ga0105237_11111090 Ga0105237_111110901 180
128 3300009551 Ga0105238_10355254 Ga0105238_103552542 180
129 3300010375 Ga0105239_10050052 Ga0105239_100500522 180
130 3300013104 Ga0157370_10103622 Ga0157370_101036222 180
131 3300013104 Ga0157370_10394063 Ga0157370_103940632 180
132 3300013105 Ga0157369_10033390 Ga0157369_100333903 180
133 3300013105 Ga0157369_10059326 Ga0157369_100593262 180
134 3300013105 Ga0157369_11175396 Ga0157369_111753961 180
135 3300013105 Ga0157369_11281489 Ga0157369_112814892 180
136 3300013296 Ga0157374_10306214 Ga0157374_103062142 180
137 3300013307 Ga0157372_10115748 Ga0157372_101157482 180
138 3300013307 Ga0157372_11152943 Ga0157372_111529432 180
139 3300013308 Ga0157375_10350251 Ga0157375_103502512 180
140 3300014968 Ga0157379_11209788 Ga0157379_112097881 180
141 3300025295 Ga0209564_1003348 Ga0209564_10033487 180
142 3300025297 Ga0209758_1006245 Ga0209758_10062451 180
143 3300025299 Ga0209256_1001337 Ga0209256_100133711 180
144 3300025302 Ga0207426_1001389 Ga0207426_10013895 180
145 3300025900 Ga0207710_10022294 Ga0207710_100222942 180
146 3300025905 Ga0207685_10052035 Ga0207685_100520352 180
147 3300025906 Ga0207699_10009654 Ga0207699_100096544 180
148 3300025906 Ga0207699_10044493 Ga0207699_100444932 180
149 3300025912 Ga0207707_10071840 Ga0207707_100718402 180
150 3300025912 Ga0207707_10245231 Ga0207707_102452312 180
151 3300025913 Ga0207695_10675783 Ga0207695_106757831 180
152 3300025914 Ga0207671_10312959 Ga0207671_103129591 180
153 3300025914 Ga0207671_10434920 Ga0207671_104349202 180
154 3300025914 Ga0207671_10503435 Ga0207671_105034352 180
155 3300025914 Ga0207671_10504933 Ga0207671_105049332 180
156 3300025914 Ga0207671_10582401 Ga0207671_105824012 180
157 3300025915 Ga0207693_10146008 Ga0207693_101460082 180
158 3300025916 Ga0207663_10024077 Ga0207663_100240772 180
159 3300025916 Ga0207663_10651029 Ga0207663_106510292 180
160 3300025921 Ga0207652_10095144 Ga0207652_100951442 180
161 3300025922 Ga0207646_11209966 Ga0207646_112099661 180
162 3300025924 Ga0207694_10247754 Ga0207694_102477542 180
163 3300025929 Ga0207664_10053468 Ga0207664_100534683 180
164 3300025929 Ga0207664_10178473 Ga0207664_101784733 180
165 3300025929 Ga0207664_10307852 Ga0207664_103078522 180
166 3300025944 Ga0207661_10589359 Ga0207661_105893592 180
167 3300025949 Ga0207667_10107188 Ga0207667_101071882 180
168 3300025949 Ga0207667_10253008 Ga0207667_102530082 180
169 3300025949 Ga0207667_10316069 Ga0207667_103160691 180
170 3300025972 Ga0207668_10055699 Ga0207668_100556992 180
171 3300025981 Ga0207640_10228774 Ga0207640_102287742 180
172 3300026035 Ga0207703_10047023 Ga0207703_100470232 180
173 3300026041 Ga0207639_10332038 Ga0207639_103320382 180
174 3300026067 Ga0207678_10838458 Ga0207678_108384581 180
175 3300026116 Ga0207674_10095323 Ga0207674_100953232 180
176 3300026116 Ga0207674_10668457 Ga0207674_106684572 180
177 3300026142 Ga0207698_11091302 Ga0207698_110913022 180
178 3300028379 Ga0268266_10265886 Ga0268266_102658862 180
179 3300028556 Ga0265337_1005145 Ga0265337_10051454 180
180 3300028558 Ga0265326_10002419 Ga0265326_100024194 180
181 3300028563 Ga0265319_1008268 Ga0265319_10082682 180
182 3300028573 Ga0265334_10008736 Ga0265334_100087362 180
183 3300028573 Ga0265334_10199052 Ga0265334_101990521 180
184 3300028653 Ga0265323_10000837 Ga0265323_1000083712 180
185 3300028666 Ga0265336_10000593 Ga0265336_100005934 180
186 3300028800 Ga0265338_10000013 Ga0265338_1000001335 180
187 3300031235 Ga0265330_10060662 Ga0265330_100606622 180
188 3300031247 Ga0265340_10052571 Ga0265340_100525712 180
189 3300031250 Ga0265331_10313057 Ga0265331_103130571 180
190 3300031711 Ga0265314_10199381 Ga0265314_101993812 180
191 3300035086 Ga0373934_0117820 Ga0373934_0117820_280_822 180
192 3300035089 Ga0373944_0223456 Ga0373944_0223456_55_597 180
193 3300035113 Ga0373936_0055010 Ga0373936_0055010_76_618 180
194 3300035116 Ga0373945_0030918 Ga0373945_0030918_1227_1769 180
195 3300035170 Ga0373943_0070321 Ga0373943_0070321_520_1062 180
196 3300035207 Ga0373942_0085103 Ga0373942_0085103_151_693 180
197 3300035692 Ga0373935_0162698 Ga0373935_0162698_924_1466 180
198 3300035695 Ga0373927_0094914 Ga0373927_0094914_840_1382 180
199 3300035695 Ga0373927_0275199 Ga0373927_0275199_151_693 180
200 3300035725 Ga0373947_0013012 Ga0373947_0013012_3918_4460 180
201 3300037068 Ga0373925_0123770 Ga0373925_0123770_1391_1933 180
202 3300037418 Ga0395900_0328820 Ga0395900_0328820_686_1228 180
203 3300037466 Ga0395898_0019680 Ga0395898_0019680_4137_4679 180
204 3300037466 Ga0395898_0521617 Ga0395898_0521617_277_819 180
205 3300037853 Ga0436364_1379571 Ga0436364_1379571_41_583 180
206 3300039437 Ga0436365_1535963 Ga0436365_1535963_1096_1638 180
207 3300039437 Ga0436365_1605560 Ga0436365_1605560_282_824 180
208 3300041486 Ga0451807_2488207 Ga0451807_2488207_193_735 180
209 3300044842 Ga0466957_0043912 Ga0466957_0043912_1860_2402 180
210 3300046454 Ga0495592_0095856 Ga0495592_0095856_959_1501 180
211 3300046455 Ga0495603_0066997 Ga0495603_0066997_1342_1884 180
212 3300046459 Ga0495629_0016024 Ga0495629_0016024_2203_2745 180
213 3300046459 Ga0495629_0341605 Ga0495629_0341605_224_766 180
214 3300046461 Ga0495641_0032993 Ga0495641_0032993_1211_1753 180
215 3300046462 Ga0495651_0199019 Ga0495651_0199019_131_673 180
216 3300046472 Ga0495580_0050434 Ga0495580_0050434_1772_2314 180
217 3300046475 Ga0495639_0010555 Ga0495639_0010555_1095_1637 180
218 3300046514 Ga0495618_0181824 Ga0495618_0181824_504_1046 180
219 3300046516 Ga0495628_0269814 Ga0495628_0269814_366_908 180
220 3300046517 Ga0495630_0355953 Ga0495630_0355953_342_884 180
221 3300046526 Ga0495666_0087556 Ga0495666_0087556_467_1009 180
222 3300046531 Ga0495665_0001580 Ga0495665_0001580_1518_2060 180
223 3300046533 Ga0495640_0020780 Ga0495640_0020780_3813_4355 180
224 3300046535 Ga0495586_0154365 Ga0495586_0154365_584_1126 180
225 3300046557 Ga0495622_0016052 Ga0495622_0016052_2578_3120 180
226 3300046642 Ga0495634_0080873 Ga0495634_0080873_1193_1735 180
227 3300046663 Ga0495635_0416030 Ga0495635_0416030_108_650 180
228 3300046674 Ga0495588_0191867 Ga0495588_0191867_158_700 180
229 3300046675 Ga0495657_0293547 Ga0495657_0293547_117_659 180
230 3300046678 Ga0495599_0334810 Ga0495599_0334810_350_892 180
231 3300046679 Ga0495623_0174708 Ga0495623_0174708_22_564 180
232 3300046681 Ga0495647_0032501 Ga0495647_0032501_244_786 180
233 3300046809 Ga0495600_0122214 Ga0495600_0122214_47_589 180
234 3300047315 Ga0495581_0031557 Ga0495581_0031557_529_1071 180
235 3300047319 Ga0495674_0147783 Ga0495674_0147783_816_1358 180
236 3300047319 Ga0495674_0178819 Ga0495674_0178819_1017_1559 180
237 3300047321 Ga0495676_0422689 Ga0495676_0422689_86_628 180
238 3300047322 Ga0495680_0090420 Ga0495680_0090420_650_1192 180
239 3300047322 Ga0495680_0126033 Ga0495680_0126033_582_1124 180
240 3300047469 Ga0495673_0247923 Ga0495673_0247923_97_639 180
241 3300047471 Ga0495684_0298691 Ga0495684_0298691_391_933 180
242 3300047472 Ga0495686_0334164 Ga0495686_0334164_180_722 180
243 3300047673 Ga0495593_0024285 Ga0495593_0024285_519_1061 180
244 3300048088 Ga0495602_0269049 Ga0495602_0269049_157_699 180
245 3300048907 Ga0496104_0668512 Ga0496104_0668512_29_571 180
246 3300048913 Ga0496110_0142668 Ga0496110_0142668_249_791 180
247 3300048915 Ga0496112_0000008 Ga0496112_0000008_139806_140348 180
248 3300048918 Ga0496115_0066702 Ga0496115_0066702_1255_1797 180
249 3300048918 Ga0496115_0795973 Ga0496115_0795973_33_575 180
250 3300048923 Ga0496120_0143626 Ga0496120_0143626_134_676 180
251 3300048924 Ga0496121_0093368 Ga0496121_0093368_1128_1670 180
252 3300048924 Ga0496121_0154542 Ga0496121_0154542_650_1192 180
253 3300048927 Ga0496124_0130988 Ga0496124_0130988_514_1056 180
254 3300048928 Ga0496125_0023632 Ga0496125_0023632_1114_1656 180
255 3300048929 Ga0496126_0196644 Ga0496126_0196644_118_660 180
256 3300048929 Ga0496126_0260650 Ga0496126_0260650_68_610 180
257 3300048929 Ga0496126_0807226 Ga0496126_0807226_90_632 180
258 3300050512 nmdc:mga0n895_163259_c1 nmdc:mga0n895_163259_c1_1541_2083 180
259 3300050515 nmdc:mga0a205_600351_c1 nmdc:mga0a205_600351_c1_62_604 180
260 3300053085 Ga0495619_0269801 Ga0495619_0269801_134_676 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

43

183

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ew5-assembly3.cif.gz_C crystal structure of colicin e9 in complex with its immunity protein im9 0.8453 26 87
7nsu-assembly1.cif.gz_D colicine9 intact translocation complex 0.8443 26 87
1ujw-assembly1.cif.gz_B structure of the complex between btub and colicin e3 receptor binding domain 0.8426 26 87
2b5u-assembly2.cif.gz_C crystal structure of colicin e3 v206c mutant in complex with its immunity protein 0.8289 26 87
2ysu-assembly1.cif.gz_B structure of the complex between btub and colicin e2 receptor binding domain 0.8039 26 87
ID Description Score Start End Superfamily
1ujwB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins 0.8426 26 87 1.10.287.620
4i9qB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.8298 27 86 1.10.287.690
2b5uC02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins 0.8289 26 87 1.10.287.620
2b5uA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins 0.8275 26 87 1.10.287.620
1g4yB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.827 27 89 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A3P1UI25-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8669 23 89 GO:0016020
AF-A0A7C9RED7-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8433 1 104 GO:0016020
AF-A0A7C9RED7-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8292 1 104 GO:0016020
AF-A0A7W1L4U8-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.7982 12 125 GO:0016020
AF-A0A7W1L4U8-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.7739 12 125 GO:0016020

Feature Viewer

pLDDT pTM Quality
78 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map