F369409

General Info

Members Datasets Scaffolds Average Seq Length
260 197 255 239

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100076960|Ga0068853_1000769602
Length 267
Sequence LIENKTPQETDCPSISPAIVLTLFKITKMEPEHTLKDHIKNLDWDQINNTLHDKGFVIIKKVLDEKNCDILINDYEADAYRKTVNMERYRFGYGEYKYYKYPLPAIISDLREGVYPQIVPVANKWMAELGIDKRFPQTHEEMKQLSHKAGQTKPTALILKYAKGGFNTLHQDLYGEVYFPIQMVFMLDQHNSDYTGGEFVIAEQIPRAQSKANVLTPGMGDMVLFTTNFRPVKGSKGYYRVNMKHGVSPVHSGKRHSLGIIFHDALS

Samples

Sample ID Description Type Environment
1 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
2 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
197 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.38
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 3.46
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003689 3300000041 Bacteria 1351
2 JGI24737J22298_10000034 3300001990 Bacteria 39811
3 JGI24735J21928_10000008 3300002067 Bacteria 319819
4 rootH1_10054746 3300003316 Bacteria 7422
5 rootH2_10110560 3300003320 Bacteria 1956
6 rootL2_10253019 3300003322 Bacteria 3356
7 rootH1_10053007 3300003323 Bacteria 1577
8 rootH1_10336976 3300003323 Bacteria 1360
9 Ga0070670_100116545 3300005331 Bacteria 2303
10 Ga0068869_100127155 3300005334 Unclassified 1956
11 Ga0068869_100338066 3300005334 Bacteria 1225
12 Ga0068869_100365021 3300005334 Bacteria 1180
13 Ga0070682_100047912 3300005337 Bacteria 2659
14 Ga0068868_100188921 3300005338 Bacteria 1713
15 Ga0070675_100039251 3300005354 Bacteria 3863
16 Ga0070673_100038182 3300005364 Unclassified 3665
17 Ga0070667_100022152 3300005367 Bacteria 5271
18 Ga0070667_100151486 3300005367 Bacteria 2037
19 Ga0070709_10002340 3300005434 Archaea 10272
20 Ga0070714_100157307 3300005435 Bacteria 2053
21 Ga0070710_10015625 3300005437 Bacteria 3846
22 Ga0070710_10034634 3300005437 Archaea 2748
23 Ga0070711_100013858 3300005439 Archaea 5072
24 Ga0070711_100105197 3300005439 Bacteria 2061
25 Ga0070678_100399952 3300005456 Bacteria 1193
26 Ga0070662_100351311 3300005457 Unclassified 1208
27 Ga0070685_10203552 3300005466 Bacteria 1288
28 Ga0068853_100076960 3300005539 Bacteria 2914
29 Ga0068853_100093015 3300005539 Unclassified 2654
30 Ga0070672_100105361 3300005543 Unclassified 2293
31 Ga0070672_100619184 3300005543 Unclassified 944
32 Ga0070686_100109328 3300005544 Bacteria 1881
33 Ga0068855_100030157 3300005563 Bacteria 6487
34 Ga0068857_100418914 3300005577 Bacteria 1248
35 Ga0068856_100551767 3300005614 Bacteria 1173
36 Ga0068852_100162087 3300005616 Bacteria 2089
37 Ga0068859_100093605 3300005617 Bacteria 3056
38 Ga0068859_100136844 3300005617 Bacteria 2522
39 Ga0068864_100291251 3300005618 Bacteria 1526
40 Ga0068864_100693596 3300005618 Bacteria 994
41 Ga0068851_10055404 3300005834 Bacteria 2020
42 Ga0068870_10185789 3300005840 Unclassified 1251
43 Ga0068858_100040360 3300005842 Bacteria 4328
44 Ga0068860_100009140 3300005843 Bacteria 9857
45 Ga0068860_100010720 3300005843 Bacteria 9050
46 Ga0068860_100019320 3300005843 Bacteria 6612
47 Ga0068860_100402382 3300005843 Bacteria 1354
48 Ga0068862_100082833 3300005844 Bacteria 2785
49 Ga0070717_10127951 3300006028 Bacteria 2182
50 Ga0070715_10021152 3300006163 Bacteria 2519
51 Ga0070716_100007721 3300006173 Archaea 5307
52 Ga0070712_100010011 3300006175 Archaea 5975
53 Ga0075366_10017259 3300006195 Bacteria 4153
54 Ga0097621_100137520 3300006237 Bacteria 2085
55 Ga0097621_100281894 3300006237 Unclassified 1463
56 Ga0097621_100745314 3300006237 Bacteria 904
57 Ga0068871_100013144 3300006358 Bacteria 6138
58 Ga0068871_100448878 3300006358 Unclassified 1155
59 Ga0075431_100401285 3300006847 Bacteria 1372
60 Ga0075433_10569427 3300006852 Bacteria 995
61 Ga0075434_100302344 3300006871 Bacteria 1620
62 Ga0068865_100064295 3300006881 Unclassified 2581
63 Ga0075436_100080170 3300006914 Bacteria 2261
64 Ga0097620_100093601 3300006931 Bacteria 3056
65 Ga0097620_100136848 3300006931 Bacteria 2522
66 Ga0105251_10001549 3300009011 Bacteria 19732
67 Ga0105244_10028300 3300009036 Bacteria 3008
68 Ga0105240_10060932 3300009093 Bacteria 4703
69 Ga0105240_10084523 3300009093 Bacteria 3891
70 Ga0105241_10007874 3300009174 Bacteria 7834
71 Ga0105241_10218549 3300009174 Bacteria 1600
72 Ga0105237_10000109 3300009545 Bacteria 115699
73 Ga0105237_10684609 3300009545 Bacteria 1032
74 Ga0105238_10306708 3300009551 Bacteria 1572
75 Ga0105249_10000425 3300009553 Bacteria 40270
76 Ga0105249_10032894 3300009553 Bacteria 4693
77 Ga0105249_10090165 3300009553 Bacteria 2866
78 Ga0105239_10005833 3300010375 Bacteria 14354
79 Ga0105239_10063271 3300010375 Bacteria 4062
80 Ga0105239_10705854 3300010375 Bacteria 1153
81 Ga0105246_10004808 3300011119 Bacteria 8227
82 Ga0105246_10248138 3300011119 Bacteria 1411
83 Ga0157374_10431901 3300013296 Bacteria 1317
84 Ga0157372_10000438 3300013307 Bacteria 45862
85 Ga0157372_10687784 3300013307 Bacteria 1191
86 Ga0157375_10035640 3300013308 Bacteria 4751
87 Ga0157375_10842920 3300013308 Bacteria 1064
88 Ga0163163_10057535 3300014325 Bacteria 3845
89 Ga0163163_10267018 3300014325 Unclassified 1762
90 Ga0182008_10000001 3300014497 Bacteria 540790
91 Ga0157376_10017298 3300014969 Bacteria 5494
92 Ga0157376_10216446 3300014969 Bacteria 1771
93 Ga0163161_10194149 3300017792 Bacteria 1562
94 Ga0207655_1006651 3300025728 Bacteria 7620
95 Ga0207655_1023865 3300025728 Bacteria 3016
96 Ga0207713_1001800 3300025735 Bacteria 16387
97 Ga0207688_10298054 3300025901 Bacteria 985
98 Ga0207685_10055967 3300025905 Bacteria 1542
99 Ga0207699_10000950 3300025906 Archaea 13817
100 Ga0207645_10000175 3300025907 Bacteria 51325
101 Ga0207654_10114655 3300025911 Bacteria 1682
102 Ga0207695_10000142 3300025913 Bacteria 214715
103 Ga0207695_10017949 3300025913 Bacteria 8195
104 Ga0207695_10244935 3300025913 Bacteria 1693
105 Ga0207671_10000407 3300025914 Bacteria 60207
106 Ga0207693_10010445 3300025915 Archaea 7533
107 Ga0207663_10009252 3300025916 Archaea 5197
108 Ga0207663_10295652 3300025916 Bacteria 1208
109 Ga0207681_10015273 3300025923 Unclassified 4788
110 Ga0207694_10119447 3300025924 Bacteria 2104
111 Ga0207650_10146733 3300025925 Bacteria 1859
112 Ga0207686_10113420 3300025934 Unclassified 1832
113 Ga0207665_10024697 3300025939 Bacteria 3963
114 Ga0207691_10107721 3300025940 Bacteria 2480
115 Ga0207691_10209020 3300025940 Bacteria 1696
116 Ga0207689_10008055 3300025942 Bacteria 9196
117 Ga0207679_10544726 3300025945 Bacteria 1040
118 Ga0207667_10039020 3300025949 Bacteria 5064
119 Ga0207651_10393252 3300025960 Unclassified 1178
120 Ga0207712_10010631 3300025961 Bacteria 5843
121 Ga0207640_10217168 3300025981 Bacteria 1461
122 Ga0207658_10034076 3300025986 Unclassified 3636
123 Ga0207703_10028368 3300026035 Bacteria 4412
124 Ga0207703_10383930 3300026035 Bacteria 1300
125 Ga0207639_10012708 3300026041 Bacteria 5872
126 Ga0207702_10099608 3300026078 Bacteria 2562
127 Ga0207648_10011237 3300026089 Bacteria 8442
128 Ga0207676_10078209 3300026095 Bacteria 2678
129 Ga0207676_10084595 3300026095 Bacteria 2586
130 Ga0207674_10232391 3300026116 Bacteria 1792
131 Ga0207674_10444409 3300026116 Bacteria 1253
132 Ga0207675_100364044 3300026118 Unclassified 1419
133 Ga0207683_10000494 3300026121 Bacteria 36475
134 Ga0207683_10256785 3300026121 Bacteria 1595
135 Ga0207698_10082084 3300026142 Bacteria 2605
136 Ga0268266_11027079 3300028379 Bacteria 798
137 Ga0268265_10016670 3300028380 Bacteria 5054
138 Ga0268264_10001724 3300028381 Bacteria 20126
139 Ga0268264_10023275 3300028381 Bacteria 5054
140 Ga0268264_10100067 3300028381 Unclassified 2517
141 Ga0268264_10599931 3300028381 Bacteria 1085
142 Ga0307515_10000226 3300028794 Bacteria 139533
143 Ga0307515_10001274 3300028794 Bacteria 57313
144 Ga0307515_10001736 3300028794 Bacteria 48546
145 Ga0265327_10000101 3300031251 Bacteria 188671
146 Ga0265327_10019883 3300031251 Bacteria 4112
147 Ga0265327_10027771 3300031251 Unclassified 3251
148 Ga0307414_10000076 3300032004 Bacteria 93668
149 Ga0307414_10140945 3300032004 Bacteria 1887
150 Ga0307414_10506281 3300032004 Bacteria 1069
151 Ga0307507_10000023 3300033179 Bacteria 212423
152 Ga0373934_0009437 3300035086 Archaea 3656
153 Ga0373923_0004723 3300035111 Archaea 4549
154 Ga0373936_0015078 3300035113 Archaea 2960
155 Ga0373945_0017930 3300035116 Bacteria 2403
156 Ga0373953_0000716 3300035117 Archaea 9164
157 Ga0373954_0001773 3300035118 Archaea 8870
158 Ga0373956_0001862 3300035119 Archaea 8693
159 Ga0373957_0000560 3300035120 Archaea 9432
160 Ga0373946_0198784 3300035171 Archaea 959
161 Ga0373955_0001842 3300035172 Archaea 9130
162 Ga0373924_0007549 3300035410 Archaea 3930
163 Ga0373935_0064584 3300035692 Archaea 2347
164 Ga0373933_0002737 3300035724 Archaea 9847
165 Ga0373937_0008517 3300036401 Archaea 8910
166 Ga0373925_0063257 3300037068 Archaea 2784
167 Ga0373925_0414141 3300037068 Bacteria 1100
168 Ga0439439_0027054 3300041406 Bacteria 1448
169 Ga0439433_0018592 3300041999 Bacteria 1548
170 Ga0439442_040967 3300042002 Unclassified 973
171 Ga0439445_0034566 3300042004 Unclassified 1325
172 Ga0439452_062116 3300042010 Unclassified 835
173 Ga0450894_009421 3300042131 Bacteria 1267
174 Ga0450898_006362 3300042134 Bacteria 1811
175 Ga0495592_0005770 3300046454 Archaea 9167
176 Ga0495592_0232778 3300046454 Bacteria 1226
177 Ga0495651_0001886 3300046462 Archaea 16212
178 Ga0495653_0013843 3300046463 Archaea 6574
179 Ga0495650_0000025 3300046471 Bacteria 486001
180 Ga0495650_0037690 3300046471 Bacteria 2102
181 Ga0495664_0310051 3300046477 Unclassified 952
182 Ga0495585_0000017 3300046492 Bacteria 164054
183 Ga0495585_0000456 3300046492 Bacteria 39053
184 Ga0495606_0000026 3300046507 Bacteria 259118
185 Ga0495608_0034789 3300046511 Archaea 3401
186 Ga0495610_0002228 3300046512 Bacteria 16396
187 Ga0495610_0080928 3300046512 Bacteria 1492
188 Ga0495616_0002102 3300046513 Bacteria 13386
189 Ga0495616_0109561 3300046513 Bacteria 1284
190 Ga0495618_0313249 3300046514 Unclassified 973
191 Ga0495628_0048453 3300046516 Archaea 3368
192 Ga0495628_0221510 3300046516 Bacteria 1421
193 Ga0495632_0117049 3300046519 Bacteria 1248
194 Ga0495652_0008843 3300046529 Archaea 9164
195 Ga0495654_0056815 3300046530 Bacteria 1891
196 Ga0495587_0004788 3300046536 Archaea 8890
197 Ga0495609_0005278 3300046538 Bacteria 6855
198 Ga0495645_0041845 3300046543 Archaea 3340
199 Ga0495633_0000273 3300046558 Bacteria 60402
200 Ga0495633_0021842 3300046558 Bacteria 3195
201 Ga0495667_0006315 3300046559 Archaea 8042
202 Ga0495668_0000134 3300046616 Bacteria 112135
203 Ga0495668_0000312 3300046616 Bacteria 66963
204 Ga0495668_0119588 3300046616 Bacteria 1441
205 Ga0495625_0000008 3300046660 Bacteria 536165
206 Ga0495625_0002361 3300046660 Bacteria 20556
207 Ga0495625_0004708 3300046660 Bacteria 12776
208 Ga0495625_0025351 3300046660 Bacteria 4499
209 Ga0495635_0033330 3300046663 Archaea 3573
210 Ga0495661_0021046 3300046665 Bacteria 4255
211 Ga0495657_0008732 3300046675 Archaea 7736
212 Ga0495599_0003368 3300046678 Archaea 9342
213 Ga0495623_0126754 3300046679 Archaea 1532
214 Ga0495646_0015034 3300046680 Archaea 4916
215 Ga0495658_0004397 3300046683 Bacteria 6940
216 Ga0495658_0373033 3300046683 Archaea 908
217 Ga0495649_0000006 3300046694 Bacteria 542188
218 Ga0495589_0103032 3300046794 Bacteria 1380
219 Ga0495600_0058087 3300046809 Archaea 2527
220 Ga0495600_0274561 3300046809 Bacteria 1068
221 Ga0495604_0012865 3300047317 Archaea 6664
222 Ga0495674_0068509 3300047319 Archaea 3071
223 Ga0495680_0027024 3300047322 Archaea 4722
224 Ga0495687_004896 3300047443 Bacteria 8780
225 Ga0495675_0007877 3300047444 Archaea 6583
226 Ga0495673_0044415 3300047469 Bacteria 1982
227 Ga0495684_0083901 3300047471 Archaea 2417
228 Ga0495686_0001501 3300047472 Bacteria 25233
229 Ga0495686_0047297 3300047472 Bacteria 2717
230 Ga0495602_0012057 3300048088 Archaea 8910
231 Ga0495614_0015019 3300048089 Bacteria 3380
232 Ga0496101_0316939 3300048904 Bacteria 1223
233 Ga0496102_0155215 3300048905 Bacteria 2152
234 Ga0496106_0023837 3300048909 Bacteria 4549
235 Ga0496107_0065446 3300048910 Bacteria 2635
236 Ga0496111_0150143 3300048914 Bacteria 1728
237 Ga0496112_0092933 3300048915 Bacteria 2986
238 Ga0496113_0318419 3300048916 Bacteria 1246
239 Ga0496114_0081473 3300048917 Bacteria 2734
240 Ga0496115_0582911 3300048918 Bacteria 891
241 Ga0496125_0109080 3300048928 Unclassified 2011
242 Ga0501217_028990 3300049661 Bacteria 1351
243 Ga0501257_087925 3300049686 Bacteria 806
244 Ga0501269_000497 3300049766 Bacteria 8141
245 nmdc:mga0k408_9147_c1 3300050493 Bacteria 5337
246 nmdc:mga0n895_42432_c1 3300050512 Bacteria 4425
247 nmdc:mga08x19_267498_c1 3300050514 Bacteria 1183
248 Ga0495619_0004198 3300053085 Archaea 9193
249 Ga0500556_0010290 3300053104 Bacteria 2742
250 Ga0500608_018911 3300053122 Bacteria 3151
251 Ga0500618_000266 3300053125 Bacteria 40517
252 Ga0500561_0004934 3300053137 Bacteria 2442
253 Ga0500616_0002312 3300053153 Bacteria 16122
254 Ga0500611_000023 3300053727 Bacteria 102347
255 Ga0587114_014236 3300059655 Bacteria 1035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10084523 Ga0105240_100845233 209
2 3300006028 Ga0070717_10127951 Ga0070717_101279514 210
3 3300003320 rootH2_10110560 rootH2_101105602 217
4 3300046492 Ga0495585_0000017 Ga0495585_0000017_9847_10617 224
5 3300046794 Ga0495589_0103032 Ga0495589_0103032_455_1225 224
6 3300003316 rootH1_10054746 rootH1_1005474610 225
7 3300005563 Ga0068855_100030157 Ga0068855_1000301573 230
8 3300006195 Ga0075366_10017259 Ga0075366_100172592 230
9 3300025949 Ga0207667_10039020 Ga0207667_100390203 230
10 3300005843 Ga0068860_100010720 Ga0068860_1000107206 231
11 3300005331 Ga0070670_100116545 Ga0070670_1001165453 234
12 3300025925 Ga0207650_10146733 Ga0207650_101467333 234
13 3300032004 Ga0307414_10000076 Ga0307414_100000764 234
14 3300032004 Ga0307414_10506281 Ga0307414_105062811 234
15 3300009174 Ga0105241_10007874 Ga0105241_100078748 235
16 3300009545 Ga0105237_10000109 Ga0105237_1000010944 235
17 3300010375 Ga0105239_10005833 Ga0105239_100058333 235
18 3300025911 Ga0207654_10114655 Ga0207654_101146552 235
19 3300025913 Ga0207695_10000142 Ga0207695_10000142170 235
20 3300025913 Ga0207695_10244935 Ga0207695_102449352 235
21 3300025914 Ga0207671_10000407 Ga0207671_1000040724 235
22 3300028794 Ga0307515_10000226 Ga0307515_1000022698 235
23 3300028794 Ga0307515_10001736 Ga0307515_1000173650 235
24 3300033179 Ga0307507_10000023 Ga0307507_1000002328 235
25 3300046454 Ga0495592_0232778 Ga0495592_0232778_509_1216 235
26 3300046492 Ga0495585_0000456 Ga0495585_0000456_25226_25933 235
27 3300046513 Ga0495616_0109561 Ga0495616_0109561_515_1222 235
28 3300046516 Ga0495628_0221510 Ga0495628_0221510_404_1111 235
29 3300046530 Ga0495654_0056815 Ga0495654_0056815_402_1109 235
30 3300046538 Ga0495609_0005278 Ga0495609_0005278_1405_2112 235
31 3300046558 Ga0495633_0000273 Ga0495633_0000273_17949_18656 235
32 3300046616 Ga0495668_0000134 Ga0495668_0000134_15976_16683 235
33 3300046660 Ga0495625_0004708 Ga0495625_0004708_5474_6181 235
34 3300046683 Ga0495658_0004397 Ga0495658_0004397_75_782 235
35 3300046809 Ga0495600_0274561 Ga0495600_0274561_140_847 235
36 3300048089 Ga0495614_0015019 Ga0495614_0015019_2266_2973 235
37 3300053122 Ga0500608_018911 Ga0500608_018911_355_1062 235
38 3300053125 Ga0500618_000266 Ga0500618_000266_32915_33622 235
39 3300053137 Ga0500561_0004934 Ga0500561_0004934_1453_2160 235
40 iso_pu_bacteria 2928078545 2928083568 235
41 iso_pu_bacteria 2928147474 2928151171 235
42 iso_pu_bacteria 2932082852 2932084470 235
43 3300001990 JGI24737J22298_10000034 JGI24737J22298_1000003414 236
44 3300002067 JGI24735J21928_10000008 JGI24735J21928_1000000839 236
45 3300003322 rootL2_10253019 rootL2_102530193 236
46 3300003323 rootH1_10053007 rootH1_100530072 236
47 3300005334 Ga0068869_100127155 Ga0068869_1001271552 236
48 3300005354 Ga0070675_100039251 Ga0070675_1000392513 236
49 3300005364 Ga0070673_100038182 Ga0070673_1000381824 236
50 3300005367 Ga0070667_100151486 Ga0070667_1001514862 236
51 3300005435 Ga0070714_100157307 Ga0070714_1001573071 236
52 3300005457 Ga0070662_100351311 Ga0070662_1003513112 236
53 3300005466 Ga0070685_10203552 Ga0070685_102035522 236
54 3300005539 Ga0068853_100076960 Ga0068853_1000769602 236
55 3300005539 Ga0068853_100093015 Ga0068853_1000930153 236
56 3300005543 Ga0070672_100105361 Ga0070672_1001053613 236
57 3300005577 Ga0068857_100418914 Ga0068857_1004189142 236
58 3300005617 Ga0068859_100136844 Ga0068859_1001368444 236
59 3300005618 Ga0068864_100693596 Ga0068864_1006935962 236
60 3300005840 Ga0068870_10185789 Ga0068870_101857893 236
61 3300005843 Ga0068860_100019320 Ga0068860_1000193206 236
62 3300005843 Ga0068860_100402382 Ga0068860_1004023822 236
63 3300006237 Ga0097621_100137520 Ga0097621_1001375201 236
64 3300006237 Ga0097621_100745314 Ga0097621_1007453142 236
65 3300006358 Ga0068871_100448878 Ga0068871_1004488781 236
66 3300006847 Ga0075431_100401285 Ga0075431_1004012852 236
67 3300006881 Ga0068865_100064295 Ga0068865_1000642951 236
68 3300006931 Ga0097620_100136848 Ga0097620_1001368484 236
69 3300009551 Ga0105238_10306708 Ga0105238_103067082 236
70 3300009553 Ga0105249_10032894 Ga0105249_100328942 236
71 3300009553 Ga0105249_10090165 Ga0105249_100901654 236
72 3300011119 Ga0105246_10004808 Ga0105246_100048086 236
73 3300013307 Ga0157372_10000438 Ga0157372_100004386 236
74 3300013308 Ga0157375_10035640 Ga0157375_100356404 236
75 3300014325 Ga0163163_10057535 Ga0163163_100575352 236
76 3300014325 Ga0163163_10267018 Ga0163163_102670182 236
77 3300014969 Ga0157376_10216446 Ga0157376_102164462 236
78 3300025907 Ga0207645_10000175 Ga0207645_1000017536 236
79 3300025923 Ga0207681_10015273 Ga0207681_100152735 236
80 3300025934 Ga0207686_10113420 Ga0207686_101134201 236
81 3300025940 Ga0207691_10107721 Ga0207691_101077213 236
82 3300025942 Ga0207689_10008055 Ga0207689_100080556 236
83 3300025960 Ga0207651_10393252 Ga0207651_103932522 236
84 3300025981 Ga0207640_10217168 Ga0207640_102171682 236
85 3300026035 Ga0207703_10383930 Ga0207703_103839302 236
86 3300026089 Ga0207648_10011237 Ga0207648_100112376 236
87 3300026095 Ga0207676_10078209 Ga0207676_100782094 236
88 3300026116 Ga0207674_10232391 Ga0207674_102323912 236
89 3300026118 Ga0207675_100364044 Ga0207675_1003640442 236
90 3300026121 Ga0207683_10000494 Ga0207683_1000049424 236
91 3300028379 Ga0268266_11027079 Ga0268266_110270791 236
92 3300028381 Ga0268264_10100067 Ga0268264_101000672 236
93 3300031251 Ga0265327_10000101 Ga0265327_10000101155 236
94 3300046471 Ga0495650_0000025 Ga0495650_0000025_71570_72340 236
95 3300046471 Ga0495650_0037690 Ga0495650_0037690_279_1001 236
96 3300046507 Ga0495606_0000026 Ga0495606_0000026_82636_83355 236
97 3300046512 Ga0495610_0002228 Ga0495610_0002228_5958_6728 236
98 3300046512 Ga0495610_0080928 Ga0495610_0080928_388_1158 236
99 3300046513 Ga0495616_0002102 Ga0495616_0002102_747_1466 236
100 3300046519 Ga0495632_0117049 Ga0495632_0117049_415_1185 236
101 3300046558 Ga0495633_0021842 Ga0495633_0021842_1817_2587 236
102 3300046616 Ga0495668_0119588 Ga0495668_0119588_510_1280 236
103 3300046660 Ga0495625_0000008 Ga0495625_0000008_230909_231628 236
104 3300046660 Ga0495625_0002361 Ga0495625_0002361_16212_16922 236
105 3300046665 Ga0495661_0021046 Ga0495661_0021046_926_1696 236
106 3300046694 Ga0495649_0000006 Ga0495649_0000006_456416_457135 236
107 3300047443 Ga0495687_004896 Ga0495687_004896_6200_6970 236
108 3300047469 Ga0495673_0044415 Ga0495673_0044415_911_1681 236
109 3300047472 Ga0495686_0047297 Ga0495686_0047297_440_1210 236
110 3300050493 nmdc:mga0k408_9147_c1 nmdc:mga0k408_9147_c1_1777_2487 236
111 iso_pu_bacteria 2597489875 2597813007 236
112 3300003323 rootH1_10336976 rootH1_103369763 237
113 3300005334 Ga0068869_100338066 Ga0068869_1003380663 237
114 3300005334 Ga0068869_100365021 Ga0068869_1003650211 237
115 3300005338 Ga0068868_100188921 Ga0068868_1001889214 237
116 3300005367 Ga0070667_100022152 Ga0070667_1000221524 237
117 3300005434 Ga0070709_10002340 Ga0070709_100023404 237
118 3300005437 Ga0070710_10015625 Ga0070710_100156252 237
119 3300005437 Ga0070710_10034634 Ga0070710_100346343 237
120 3300005439 Ga0070711_100013858 Ga0070711_1000138581 237
121 3300005439 Ga0070711_100105197 Ga0070711_1001051973 237
122 3300005456 Ga0070678_100399952 Ga0070678_1003999521 237
123 3300005543 Ga0070672_100619184 Ga0070672_1006191841 237
124 3300005544 Ga0070686_100109328 Ga0070686_1001093282 237
125 3300005614 Ga0068856_100551767 Ga0068856_1005517672 237
126 3300005616 Ga0068852_100162087 Ga0068852_1001620872 237
127 3300005617 Ga0068859_100093605 Ga0068859_1000936055 237
128 3300005618 Ga0068864_100291251 Ga0068864_1002912512 237
129 3300005834 Ga0068851_10055404 Ga0068851_100554042 237
130 3300005842 Ga0068858_100040360 Ga0068858_1000403602 237
131 3300005843 Ga0068860_100009140 Ga0068860_1000091406 237
132 3300005844 Ga0068862_100082833 Ga0068862_1000828334 237
133 3300006163 Ga0070715_10021152 Ga0070715_100211524 237
134 3300006173 Ga0070716_100007721 Ga0070716_1000077211 237
135 3300006175 Ga0070712_100010011 Ga0070712_10001001113 237
136 3300006237 Ga0097621_100281894 Ga0097621_1002818943 237
137 3300006358 Ga0068871_100013144 Ga0068871_1000131446 237
138 3300006852 Ga0075433_10569427 Ga0075433_105694271 237
139 3300006871 Ga0075434_100302344 Ga0075434_1003023443 237
140 3300006914 Ga0075436_100080170 Ga0075436_1000801703 237
141 3300006931 Ga0097620_100093601 Ga0097620_1000936011 237
142 3300009011 Ga0105251_10001549 Ga0105251_1000154912 237
143 3300009036 Ga0105244_10028300 Ga0105244_100283005 237
144 3300009093 Ga0105240_10060932 Ga0105240_100609323 237
145 3300009174 Ga0105241_10218549 Ga0105241_102185493 237
146 3300009545 Ga0105237_10684609 Ga0105237_106846091 237
147 3300009553 Ga0105249_10000425 Ga0105249_100004254 237
148 3300010375 Ga0105239_10063271 Ga0105239_100632712 237
149 3300010375 Ga0105239_10705854 Ga0105239_107058541 237
150 3300013296 Ga0157374_10431901 Ga0157374_104319011 237
151 3300013307 Ga0157372_10687784 Ga0157372_106877842 237
152 3300013308 Ga0157375_10842920 Ga0157375_108429202 237
153 3300014497 Ga0182008_10000001 Ga0182008_10000001290 237
154 3300014969 Ga0157376_10017298 Ga0157376_100172986 237
155 3300017792 Ga0163161_10194149 Ga0163161_101941493 237
156 3300025728 Ga0207655_1006651 Ga0207655_10066515 237
157 3300025728 Ga0207655_1023865 Ga0207655_10238652 237
158 3300025735 Ga0207713_1001800 Ga0207713_100180013 237
159 3300025901 Ga0207688_10298054 Ga0207688_102980541 237
160 3300025905 Ga0207685_10055967 Ga0207685_100559671 237
161 3300025906 Ga0207699_10000950 Ga0207699_1000095010 237
162 3300025913 Ga0207695_10017949 Ga0207695_100179493 237
163 3300025915 Ga0207693_10010445 Ga0207693_100104457 237
164 3300025916 Ga0207663_10009252 Ga0207663_100092521 237
165 3300025916 Ga0207663_10295652 Ga0207663_102956522 237
166 3300025924 Ga0207694_10119447 Ga0207694_101194472 237
167 3300025939 Ga0207665_10024697 Ga0207665_100246975 237
168 3300025940 Ga0207691_10209020 Ga0207691_102090203 237
169 3300025945 Ga0207679_10544726 Ga0207679_105447261 237
170 3300025961 Ga0207712_10010631 Ga0207712_100106314 237
171 3300025986 Ga0207658_10034076 Ga0207658_100340763 237
172 3300026035 Ga0207703_10028368 Ga0207703_100283682 237
173 3300026041 Ga0207639_10012708 Ga0207639_100127083 237
174 3300026078 Ga0207702_10099608 Ga0207702_100996082 237
175 3300026095 Ga0207676_10084595 Ga0207676_100845954 237
176 3300026116 Ga0207674_10444409 Ga0207674_104444092 237
177 3300026121 Ga0207683_10256785 Ga0207683_102567852 237
178 3300026142 Ga0207698_10082084 Ga0207698_100820842 237
179 3300028380 Ga0268265_10016670 Ga0268265_100166708 237
180 3300028381 Ga0268264_10001724 Ga0268264_100017244 237
181 3300028381 Ga0268264_10023275 Ga0268264_100232755 237
182 3300028381 Ga0268264_10599931 Ga0268264_105999312 237
183 3300028794 Ga0307515_10001274 Ga0307515_1000127417 237
184 3300031251 Ga0265327_10019883 Ga0265327_100198834 237
185 3300031251 Ga0265327_10027771 Ga0265327_100277714 237
186 3300032004 Ga0307414_10140945 Ga0307414_101409452 237
187 3300035086 Ga0373934_0009437 Ga0373934_0009437_1514_2236 237
188 3300035111 Ga0373923_0004723 Ga0373923_0004723_2438_3160 237
189 3300035113 Ga0373936_0015078 Ga0373936_0015078_578_1300 237
190 3300035116 Ga0373945_0017930 Ga0373945_0017930_1630_2352 237
191 3300035117 Ga0373953_0000716 Ga0373953_0000716_7031_7753 237
192 3300035118 Ga0373954_0001773 Ga0373954_0001773_1419_2141 237
193 3300035119 Ga0373956_0001862 Ga0373956_0001862_6582_7304 237
194 3300035120 Ga0373957_0000560 Ga0373957_0000560_1386_2108 237
195 3300035171 Ga0373946_0198784 Ga0373946_0198784_158_880 237
196 3300035172 Ga0373955_0001842 Ga0373955_0001842_6994_7716 237
197 3300035410 Ga0373924_0007549 Ga0373924_0007549_1789_2511 237
198 3300035692 Ga0373935_0064584 Ga0373935_0064584_352_1074 237
199 3300035724 Ga0373933_0002737 Ga0373933_0002737_7707_8429 237
200 3300036401 Ga0373937_0008517 Ga0373937_0008517_1418_2140 237
201 3300037068 Ga0373925_0063257 Ga0373925_0063257_1682_2404 237
202 3300037068 Ga0373925_0414141 Ga0373925_0414141_318_1040 237
203 3300041406 Ga0439439_0027054 Ga0439439_0027054_530_1243 237
204 3300041999 Ga0439433_0018592 Ga0439433_0018592_291_1004 237
205 3300042002 Ga0439442_040967 Ga0439442_040967_75_788 237
206 3300042004 Ga0439445_0034566 Ga0439445_0034566_587_1300 237
207 3300042010 Ga0439452_062116 Ga0439452_062116_103_816 237
208 3300042131 Ga0450894_009421 Ga0450894_009421_80_793 237
209 3300042134 Ga0450898_006362 Ga0450898_006362_945_1658 237
210 3300046454 Ga0495592_0005770 Ga0495592_0005770_1419_2141 237
211 3300046462 Ga0495651_0001886 Ga0495651_0001886_1419_2141 237
212 3300046463 Ga0495653_0013843 Ga0495653_0013843_1391_2113 237
213 3300046477 Ga0495664_0310051 Ga0495664_0310051_98_820 237
214 3300046511 Ga0495608_0034789 Ga0495608_0034789_1262_1984 237
215 3300046514 Ga0495618_0313249 Ga0495618_0313249_11_733 237
216 3300046516 Ga0495628_0048453 Ga0495628_0048453_1413_2135 237
217 3300046529 Ga0495652_0008843 Ga0495652_0008843_1390_2112 237
218 3300046536 Ga0495587_0004788 Ga0495587_0004788_6750_7472 237
219 3300046543 Ga0495645_0041845 Ga0495645_0041845_1229_1951 237
220 3300046559 Ga0495667_0006315 Ga0495667_0006315_1419_2141 237
221 3300046616 Ga0495668_0000312 Ga0495668_0000312_19220_19945 237
222 3300046660 Ga0495625_0025351 Ga0495625_0025351_107_844 237
223 3300046663 Ga0495635_0033330 Ga0495635_0033330_1925_2647 237
224 3300046675 Ga0495657_0008732 Ga0495657_0008732_5622_6344 237
225 3300046678 Ga0495599_0003368 Ga0495599_0003368_7053_7775 237
226 3300046679 Ga0495623_0126754 Ga0495623_0126754_164_886 237
227 3300046680 Ga0495646_0015034 Ga0495646_0015034_2790_3512 237
228 3300046683 Ga0495658_0373033 Ga0495658_0373033_22_744 237
229 3300046809 Ga0495600_0058087 Ga0495600_0058087_1052_1774 237
230 3300047317 Ga0495604_0012865 Ga0495604_0012865_4525_5247 237
231 3300047319 Ga0495674_0068509 Ga0495674_0068509_949_1671 237
232 3300047322 Ga0495680_0027024 Ga0495680_0027024_2595_3317 237
233 3300047444 Ga0495675_0007877 Ga0495675_0007877_1359_2081 237
234 3300047471 Ga0495684_0083901 Ga0495684_0083901_1381_2103 237
235 3300047472 Ga0495686_0001501 Ga0495686_0001501_9962_10675 237
236 3300048088 Ga0495602_0012057 Ga0495602_0012057_1418_2140 237
237 3300048904 Ga0496101_0316939 Ga0496101_0316939_73_786 237
238 3300048905 Ga0496102_0155215 Ga0496102_0155215_1248_1961 237
239 3300048909 Ga0496106_0023837 Ga0496106_0023837_1193_1906 237
240 3300048910 Ga0496107_0065446 Ga0496107_0065446_1528_2241 237
241 3300048914 Ga0496111_0150143 Ga0496111_0150143_758_1471 237
242 3300048915 Ga0496112_0092933 Ga0496112_0092933_734_1447 237
243 3300048916 Ga0496113_0318419 Ga0496113_0318419_383_1096 237
244 3300048917 Ga0496114_0081473 Ga0496114_0081473_346_1059 237
245 3300048918 Ga0496115_0582911 Ga0496115_0582911_126_839 237
246 3300048928 Ga0496125_0109080 Ga0496125_0109080_338_1051 237
247 3300049661 Ga0501217_028990 Ga0501217_028990_386_1099 237
248 3300049686 Ga0501257_087925 Ga0501257_087925_51_764 237
249 3300049766 Ga0501269_000497 Ga0501269_000497_7346_8071 237
250 3300050512 nmdc:mga0n895_42432_c1 nmdc:mga0n895_42432_c1_438_1151 237
251 3300050514 nmdc:mga08x19_267498_c1 nmdc:mga08x19_267498_c1_257_970 237
252 3300053085 Ga0495619_0004198 Ga0495619_0004198_1419_2141 237
253 3300053104 Ga0500556_0010290 Ga0500556_0010290_780_1505 237
254 3300053153 Ga0500616_0002312 Ga0500616_0002312_8982_9707 237
255 3300053727 Ga0500611_000023 Ga0500611_000023_94064_94777 237
256 3300059655 Ga0587114_014236 Ga0587114_014236_306_1019 237
257 iso_pu_bacteria 2643221665 2644362013 237
258 3300000041 ARcpr5oldR_c003689 ARcpr5oldR_0036892 238
259 3300005337 Ga0070682_100047912 Ga0070682_1000479127 238
260 3300011119 Ga0105246_10248138 Ga0105246_102481381 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

94

265

1

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

156

263

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e1r-assembly1.cif.gz_A crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.7059 111 229
4j25-assembly7.cif.gz_G crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.7056 13 229
5e1r-assembly2.cif.gz_E crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.7008 111 229
6v7j-assembly1.cif.gz_A the c2221 crystal form of canavalin at 173 k 0.6974 126 229
6ey1-assembly1.cif.gz_A prolyl hydroxylase from trichoplax adhaerens 0.695 2 229
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9277 69 235 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8969 69 235 2.60.120.590
af_A4IB22_54_194_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.7054 125 229 2.60.120.590
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6999 125 229 2.60.120.10
af_Z4YHZ5_296_475_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6967 125 229 2.60.120.620
ID Description Score Start End GO Terms
AF-L8JN65-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9919 13 237 GO:0016491
GO:0046872
AF-A0A1X7H4U3-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9904 2 236 GO:0016491
GO:0046872
AF-A0A0Q8FME1-F1-model_v4 Proline hydroxylase 0.9903 6 235
AF-A0A534SS43-F1-model_v4 Proline hydroxylase 0.9902 10 197
AF-A0A2T4VDD6-F1-model_v4 Proline hydroxylase 0.9897 4 236

Feature Viewer

pLDDT pTM Quality
94.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map