F369349

General Info

Members Datasets Scaffolds Average Seq Length
260 174 520 282

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100003714|Ga0070667_1000037145
Length 298
Sequence MTTASTWRAVELREEKMKVTFVGVGAIGLPMALQIQRAGHHVTGVDVSDDVIANAKASGIETVSNYRDAPPADVVVVMVATPEQLAALIGGITDLVRGELWVVMSTVGPQSVREQGEVLQRAGARVVDAPVTGGVARARMGELVIFAAGAPHDVASATPVLEAMGTVRVTGRNLGDGQSIKVVNQHLCAVHIAAAAEALNLARLLGLDPATVLRLVEKGAAGSWMLSDRGPRMVADADVEVTSAINIFVKDSGLVASAGEACGAELPLLAIAHERFRRAADVGLGLHDDSRVIETWDH

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
79 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
156 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
161 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
162 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
163 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
164 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
165 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
166 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
167 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
168 2862574272 Streptomyces sp. AcE210 Isolate Nodule
169 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
170 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
171 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
172 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
173 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
174 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 0
Isolates 5.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 0.38
Rhizoplane 1.92
Rhizosphere 86.92
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100003714 3300005367 Bacteria 12966
2 Ga0055540_1003783 3300003792 Bacteria 7133
3 Ga0070676_10006795 3300005328 Bacteria 6129
4 Ga0070670_100026402 3300005331 Bacteria 4999
5 Ga0070670_100103145 3300005331 Bacteria 2457
6 Ga0070670_100144465 3300005331 Bacteria 2058
7 Ga0068869_100016000 3300005334 Bacteria 5049
8 Ga0070666_10052975 3300005335 Bacteria 2736
9 Ga0070666_10066573 3300005335 Bacteria 2445
10 Ga0068868_100071848 3300005338 Unclassified 2760
11 Ga0070675_100013913 3300005354 Bacteria 6332
12 Ga0070675_100143877 3300005354 Bacteria 2040
13 Ga0070671_100012359 3300005355 Bacteria 6876
14 Ga0070671_100019568 3300005355 Bacteria 5512
15 Ga0070671_100103564 3300005355 Bacteria 2388
16 Ga0070671_100149878 3300005355 Bacteria 1969
17 Ga0070673_100040100 3300005364 Bacteria 3590
18 Ga0070673_100071887 3300005364 Bacteria 2781
19 Ga0070673_100199234 3300005364 Bacteria 1724
20 Ga0070673_100222045 3300005364 Bacteria 1636
21 Ga0070659_100182304 3300005366 Bacteria 1724
22 Ga0070667_100033680 3300005367 Bacteria 4285
23 Ga0070667_100097844 3300005367 Bacteria 2532
24 Ga0070708_100470308 3300005445 Bacteria 1186
25 Ga0070662_100013706 3300005457 Bacteria 5400
26 Ga0068867_100075737 3300005459 Bacteria 2525
27 Ga0070706_100000751 3300005467 Bacteria 36305
28 Ga0070707_100541502 3300005468 Bacteria 1126
29 Ga0070698_100166983 3300005471 Bacteria 2143
30 Ga0068853_100295377 3300005539 Bacteria 1496
31 Ga0070672_100005314 3300005543 Bacteria 8526
32 Ga0070672_100005708 3300005543 Bacteria 8290
33 Ga0070672_100459460 3300005543 Bacteria 1097
34 Ga0070665_100081547 3300005548 Bacteria 3240
35 Ga0070665_100151852 3300005548 Bacteria 2319
36 Ga0068857_100004905 3300005577 Bacteria 11353
37 Ga0068864_100049920 3300005618 Bacteria 3600
38 Ga0068870_10050757 3300005840 Bacteria 2193
39 Ga0068863_100087758 3300005841 Bacteria 2948
40 Ga0068860_100228048 3300005843 Bacteria 1810
41 Ga0075365_10019805 3300006038 Bacteria 4161
42 Ga0075367_10008675 3300006178 Bacteria 5276
43 Ga0075366_10002602 3300006195 Bacteria 9276
44 Ga0097621_100349309 3300006237 Bacteria 1315
45 Ga0097621_100492021 3300006237 Bacteria 1110
46 Ga0075370_10022382 3300006353 Bacteria 3470
47 Ga0075370_10047588 3300006353 Bacteria 2429
48 Ga0075370_10081520 3300006353 Bacteria 1860
49 Ga0075430_100008182 3300006846 Bacteria 8838
50 Ga0075429_100000702 3300006880 Bacteria 26160
51 Ga0068865_100044388 3300006881 Bacteria 3042
52 Ga0068865_100130676 3300006881 Bacteria 1881
53 Ga0105251_10000028 3300009011 Bacteria 126517
54 Ga0105251_10013296 3300009011 Bacteria 4610
55 Ga0105244_10013818 3300009036 Bacteria 4697
56 Ga0105240_10010973 3300009093 Bacteria 12688
57 Ga0105245_10179353 3300009098 Bacteria 2023
58 Ga0105245_10249177 3300009098 Bacteria 1725
59 Ga0105241_10043444 3300009174 Bacteria 3404
60 Ga0105248_10019509 3300009177 Bacteria 7503
61 Ga0105248_10262233 3300009177 Bacteria 1945
62 Ga0105248_10816216 3300009177 Bacteria 1053
63 Ga0105237_10406733 3300009545 Bacteria 1366
64 Ga0105249_11007009 3300009553 Bacteria 902
65 Ga0105239_10007162 3300010375 Bacteria 12836
66 Ga0105239_10238998 3300010375 Bacteria 2039
67 Ga0105246_10072193 3300011119 Bacteria 2433
68 Ga0157373_10309679 3300013100 Bacteria 1122
69 Ga0157371_10002180 3300013102 Bacteria 19014
70 Ga0157371_10021514 3300013102 Bacteria 4734
71 Ga0157369_10018812 3300013105 Bacteria 7742
72 Ga0157369_10046972 3300013105 Bacteria 4689
73 Ga0157378_10000586 3300013297 Bacteria 34157
74 Ga0157378_10269807 3300013297 Bacteria 1636
75 Ga0163162_10149365 3300013306 Bacteria 2454
76 Ga0163162_10256591 3300013306 Bacteria 1880
77 Ga0163162_10411531 3300013306 Bacteria 1485
78 Ga0163162_10573196 3300013306 Unclassified 1256
79 Ga0157372_10635808 3300013307 Bacteria 1243
80 Ga0157375_10018293 3300013308 Bacteria 6352
81 Ga0157375_10045767 3300013308 Bacteria 4260
82 Ga0157379_10084658 3300014968 Bacteria 2841
83 Ga0157379_10217882 3300014968 Bacteria 1729
84 Ga0157379_10266451 3300014968 Bacteria 1557
85 Ga0163161_10620876 3300017792 Unclassified 893
86 Ga0209051_1011016 3300025303 Bacteria 4508
87 Ga0209051_1057497 3300025303 Bacteria 1246
88 Ga0207655_1004007 3300025728 Bacteria 10646
89 Ga0207713_1001010 3300025735 Bacteria 24522
90 Ga0207645_10010744 3300025907 Bacteria 6275
91 Ga0207645_10033520 3300025907 Bacteria 3301
92 Ga0207643_10051626 3300025908 Bacteria 2334
93 Ga0207684_10003223 3300025910 Bacteria 16019
94 Ga0207654_10111597 3300025911 Bacteria 1702
95 Ga0207671_10148027 3300025914 Bacteria 1813
96 Ga0207681_10377124 3300025923 Bacteria 1141
97 Ga0207650_10145760 3300025925 Bacteria 1865
98 Ga0207687_10307830 3300025927 Bacteria 1278
99 Ga0207644_10007837 3300025931 Bacteria 6976
100 Ga0207644_10040798 3300025931 Bacteria 3281
101 Ga0207644_10139321 3300025931 Bacteria 1866
102 Ga0207669_10119136 3300025937 Unclassified 1788
103 Ga0207704_10108516 3300025938 Bacteria 1870
104 Ga0207691_10005516 3300025940 Bacteria 12222
105 Ga0207691_10005554 3300025940 Bacteria 12181
106 Ga0207689_10024577 3300025942 Bacteria 5054
107 Ga0207689_10284181 3300025942 Bacteria 1370
108 Ga0207651_10085435 3300025960 Bacteria 2289
109 Ga0207651_10173174 3300025960 Bacteria 1704
110 Ga0207658_10003893 3300025986 Bacteria 10503
111 Ga0207648_10649300 3300026089 Bacteria 975
112 Ga0207676_10055921 3300026095 Bacteria 3100
113 Ga0207674_10004595 3300026116 Bacteria 16574
114 Ga0207683_10092752 3300026121 Bacteria 2691
115 Ga0207683_10408856 3300026121 Unclassified 1249
116 Ga0268266_10006970 3300028379 Bacteria 10273
117 Ga0268266_10315014 3300028379 Bacteria 1463
118 Ga0395905_0123082 3300037471 Bacteria 2439
119 Ga0495617_005718 3300046452 Bacteria 4391
120 Ga0495627_005944 3300046453 Bacteria 4850
121 Ga0495591_001308 3300046458 Bacteria 15715
122 Ga0495591_002219 3300046458 Bacteria 11080
123 Ga0495638_0012145 3300046460 Bacteria 5912
124 Ga0495653_0000142 3300046463 Bacteria 59557
125 Ga0495653_0005903 3300046463 Bacteria 10023
126 Ga0495650_0010374 3300046471 Bacteria 5202
127 Ga0495605_0002297 3300046474 Bacteria 11924
128 Ga0495605_0011817 3300046474 Bacteria 4859
129 Ga0495585_0001225 3300046492 Bacteria 20783
130 Ga0495585_0169923 3300046492 Bacteria 1127
131 Ga0495607_0011731 3300046501 Bacteria 5814
132 Ga0495607_0019507 3300046501 Bacteria 4305
133 Ga0495607_0030722 3300046501 Bacteria 3295
134 Ga0495607_0047598 3300046501 Bacteria 2511
135 Ga0495607_0129389 3300046501 Bacteria 1316
136 Ga0495583_0000818 3300046506 Bacteria 38087
137 Ga0495583_0004054 3300046506 Bacteria 10772
138 Ga0495606_0000468 3300046507 Bacteria 66350
139 Ga0495606_0000956 3300046507 Bacteria 42400
140 Ga0495606_0041963 3300046507 Bacteria 3064
141 Ga0495606_0076618 3300046507 Bacteria 2090
142 Ga0495606_0134696 3300046507 Bacteria 1464
143 Ga0495610_0006517 3300046512 Bacteria 8009
144 Ga0495610_0094960 3300046512 Bacteria 1345
145 Ga0495616_0003109 3300046513 Bacteria 10745
146 Ga0495620_0010274 3300046515 Bacteria 4941
147 Ga0495628_0034136 3300046516 Bacteria 4095
148 Ga0495630_0006909 3300046517 Bacteria 8088
149 Ga0495632_0000051 3300046519 Bacteria 133522
150 Ga0495632_0005044 3300046519 Bacteria 8838
151 Ga0495632_0008305 3300046519 Bacteria 6393
152 Ga0495632_0153012 3300046519 Bacteria 1066
153 Ga0495637_0000133 3300046520 Bacteria 55485
154 Ga0495637_0000209 3300046520 Bacteria 45853
155 Ga0495637_0002736 3300046520 Bacteria 9598
156 Ga0495643_0011808 3300046522 Bacteria 5299
157 Ga0495648_0000219 3300046524 Bacteria 65619
158 Ga0495648_0006202 3300046524 Bacteria 9792
159 Ga0495654_0000508 3300046530 Bacteria 31700
160 Ga0495654_0002940 3300046530 Bacteria 10667
161 Ga0495665_0000577 3300046531 Bacteria 18660
162 Ga0495597_0034213 3300046542 Bacteria 2297
163 Ga0495645_0160591 3300046543 Bacteria 1554
164 Ga0495668_0029289 3300046616 Bacteria 3111
165 Ga0495611_0003655 3300046648 Bacteria 6747
166 Ga0495625_0009848 3300046660 Bacteria 7952
167 Ga0495635_0004080 3300046663 Bacteria 10136
168 Ga0495661_0000011 3300046665 Bacteria 277997
169 Ga0495661_0000475 3300046665 Bacteria 42461
170 Ga0495661_0004179 3300046665 Bacteria 10497
171 Ga0495661_0004219 3300046665 Bacteria 10441
172 Ga0495623_0005814 3300046679 Bacteria 8044
173 Ga0495646_0066196 3300046680 Bacteria 2137
174 Ga0495624_0002106 3300046690 Bacteria 15176
175 Ga0495671_0032568 3300046692 Bacteria 2661
176 Ga0495649_0000267 3300046694 Bacteria 46493
177 Ga0495649_0004540 3300046694 Bacteria 9057
178 Ga0495600_0030194 3300046809 Bacteria 3510
179 Ga0495660_0009071 3300046810 Bacteria 5809
180 Ga0495660_0019967 3300046810 Bacteria 3843
181 Ga0495604_0004021 3300047317 Bacteria 11694
182 Ga0495674_0140609 3300047319 Bacteria 2029
183 Ga0495672_0003314 3300047320 Bacteria 13917
184 Ga0495672_0006653 3300047320 Bacteria 8879
185 Ga0495680_0006476 3300047322 Bacteria 10870
186 Ga0495683_0001123 3300047323 Bacteria 18431
187 Ga0495687_002983 3300047443 Bacteria 12802
188 Ga0495687_040950 3300047443 Bacteria 2037
189 Ga0495675_0007514 3300047444 Bacteria 6718
190 Ga0495673_0002256 3300047469 Bacteria 13842
191 Ga0495673_0049627 3300047469 Bacteria 1846
192 Ga0495686_0004569 3300047472 Bacteria 11327
193 Ga0495593_0003127 3300047673 Bacteria 9947
194 Ga0495593_0036949 3300047673 Bacteria 2645
195 Ga0495602_0027200 3300048088 Bacteria 5502
196 Ga0495626_0002014 3300048091 Bacteria 14983
197 Ga0496100_0254784 3300048903 Bacteria 1299
198 Ga0496101_0027291 3300048904 Bacteria 3976
199 Ga0496102_0105509 3300048905 Bacteria 2622
200 Ga0496109_0110406 3300048912 Bacteria 2557
201 Ga0496112_0003658 3300048915 Bacteria 12812
202 Ga0496116_0004112 3300048919 Bacteria 14028
203 Ga0496117_0102107 3300048920 Bacteria 1811
204 Ga0496121_0003966 3300048924 Bacteria 20418
205 Ga0496121_0314353 3300048924 Bacteria 1057
206 Ga0496122_0000043 3300048925 Bacteria 280333
207 Ga0496123_0000090 3300048926 Bacteria 179735
208 Ga0496125_0000935 3300048928 Bacteria 45862
209 Ga0495678_000043 3300049459 Bacteria 172593
210 Ga0495678_001159 3300049459 Bacteria 21786
211 Ga0495678_001228 3300049459 Bacteria 20891
212 Ga0495678_021638 3300049459 Bacteria 2828
213 Ga0501032_0171736 3300049569 Bacteria 1421
214 Ga0501033_0006256 3300049570 Bacteria 9330
215 Ga0501033_0025022 3300049570 Bacteria 4498
216 Ga0501034_0327257 3300049571 Bacteria 1464
217 Ga0501036_0040964 3300049572 Bacteria 3919
218 Ga0501036_0188544 3300049572 Bacteria 1735
219 Ga0501037_0101479 3300049573 Bacteria 2076
220 Ga0501038_0094609 3300049574 Bacteria 2497
221 Ga0501039_0011687 3300049575 Bacteria 6688
222 Ga0501043_0091364 3300049579 Bacteria 2393
223 Ga0501043_0170973 3300049579 Bacteria 1695
224 Ga0501046_0025418 3300049580 Bacteria 4846
225 Ga0501046_0182303 3300049580 Bacteria 1569
226 Ga0501047_0125794 3300049581 Bacteria 2443
227 Ga0501047_0173434 3300049581 Bacteria 2025
228 Ga0501074_0065533 3300049590 Bacteria 2614
229 Ga0501080_0049376 3300049742 Bacteria 3916
230 Ga0501035_0136340 3300049822 Bacteria 2136
231 Ga0501035_0181080 3300049822 Bacteria 1815
232 Ga0501035_0237956 3300049822 Bacteria 1549
233 Ga0501044_0252842 3300049823 Bacteria 1702
234 nmdc:mga0k408_7378_c1 3300050493 Bacteria 5870
235 nmdc:mga07m45_101216_c1 3300050496 Bacteria 1654
236 nmdc:mga07m45_18481_c1 3300050496 Bacteria 3763
237 nmdc:mga07m45_85045_c1 3300050496 Bacteria 1809
238 nmdc:mga09592_30410_c1 3300050508 Bacteria 4493
239 nmdc:mga0qj67_16548_c1 3300050509 Bacteria 5595
240 nmdc:mga0sz30_65076_c1 3300050516 Bacteria 1563
241 Ga0500650_0186410 3300053098 Bacteria 949
242 Ga0500618_001062 3300053125 Bacteria 13635
243 Ga0500618_009070 3300053125 Unclassified 2736
244 Ga0500621_000002 3300053126 Bacteria 849473
245 Ga0501084_0101756 3300054114 Bacteria 2413
246 2501077991 2501025502 Bacteria 9641094
247 2511092047 2510917013 Bacteria 9951648
248 2774130061 2773857672 Bacteria 4993178
249 2808983490 2808606386 Bacteria 4471946
250 2809128714 2808606415 Bacteria 4576710
251 2809148335 2808606419 Bacteria 4576925
252 2852620243 2852618963 Bacteria 4577824
253 2857733037 2857729791 Bacteria 4040535
254 2862582466 2862574272 Bacteria 10567477
255 2917835727 2917832318 Bacteria 5346010
256 2928121737 2928121344 Bacteria 3972376
257 2939662459 2939660829 Bacteria 3784848
258 2964328303 2964326757 Bacteria 3290868
259 8054853028 8054849141 Bacteria 5232694
260 8056211629 8056207758 Bacteria 8639239
261 Ga0070667_100003714
262 Ga0055540_1003783
263 Ga0070676_10006795
264 Ga0070670_100026402
265 Ga0070670_100103145
266 Ga0070670_100144465
267 Ga0068869_100016000
268 Ga0070666_10052975
269 Ga0070666_10066573
270 Ga0068868_100071848
271 Ga0070675_100013913
272 Ga0070675_100143877
273 Ga0070671_100012359
274 Ga0070671_100019568
275 Ga0070671_100103564
276 Ga0070671_100149878
277 Ga0070673_100040100
278 Ga0070673_100071887
279 Ga0070673_100199234
280 Ga0070673_100222045
281 Ga0070659_100182304
282 Ga0070667_100033680
283 Ga0070667_100097844
284 Ga0070708_100470308
285 Ga0070662_100013706
286 Ga0068867_100075737
287 Ga0070706_100000751
288 Ga0070707_100541502
289 Ga0070698_100166983
290 Ga0068853_100295377
291 Ga0070672_100005314
292 Ga0070672_100005708
293 Ga0070672_100459460
294 Ga0070665_100081547
295 Ga0070665_100151852
296 Ga0068857_100004905
297 Ga0068864_100049920
298 Ga0068870_10050757
299 Ga0068863_100087758
300 Ga0068860_100228048
301 Ga0075365_10019805
302 Ga0075367_10008675
303 Ga0075366_10002602
304 Ga0097621_100349309
305 Ga0097621_100492021
306 Ga0075370_10022382
307 Ga0075370_10047588
308 Ga0075370_10081520
309 Ga0075430_100008182
310 Ga0075429_100000702
311 Ga0068865_100044388
312 Ga0068865_100130676
313 Ga0105251_10000028
314 Ga0105251_10013296
315 Ga0105244_10013818
316 Ga0105240_10010973
317 Ga0105245_10179353
318 Ga0105245_10249177
319 Ga0105241_10043444
320 Ga0105248_10019509
321 Ga0105248_10262233
322 Ga0105248_10816216
323 Ga0105237_10406733
324 Ga0105249_11007009
325 Ga0105239_10007162
326 Ga0105239_10238998
327 Ga0105246_10072193
328 Ga0157373_10309679
329 Ga0157371_10002180
330 Ga0157371_10021514
331 Ga0157369_10018812
332 Ga0157369_10046972
333 Ga0157378_10000586
334 Ga0157378_10269807
335 Ga0163162_10149365
336 Ga0163162_10256591
337 Ga0163162_10411531
338 Ga0163162_10573196
339 Ga0157372_10635808
340 Ga0157375_10018293
341 Ga0157375_10045767
342 Ga0157379_10084658
343 Ga0157379_10217882
344 Ga0157379_10266451
345 Ga0163161_10620876
346 Ga0209051_1011016
347 Ga0209051_1057497
348 Ga0207655_1004007
349 Ga0207713_1001010
350 Ga0207645_10010744
351 Ga0207645_10033520
352 Ga0207643_10051626
353 Ga0207684_10003223
354 Ga0207654_10111597
355 Ga0207671_10148027
356 Ga0207681_10377124
357 Ga0207650_10145760
358 Ga0207687_10307830
359 Ga0207644_10007837
360 Ga0207644_10040798
361 Ga0207644_10139321
362 Ga0207669_10119136
363 Ga0207704_10108516
364 Ga0207691_10005516
365 Ga0207691_10005554
366 Ga0207689_10024577
367 Ga0207689_10284181
368 Ga0207651_10085435
369 Ga0207651_10173174
370 Ga0207658_10003893
371 Ga0207648_10649300
372 Ga0207676_10055921
373 Ga0207674_10004595
374 Ga0207683_10092752
375 Ga0207683_10408856
376 Ga0268266_10006970
377 Ga0268266_10315014
378 Ga0395905_0123082
379 Ga0495617_005718
380 Ga0495627_005944
381 Ga0495591_001308
382 Ga0495591_002219
383 Ga0495638_0012145
384 Ga0495653_0000142
385 Ga0495653_0005903
386 Ga0495650_0010374
387 Ga0495605_0002297
388 Ga0495605_0011817
389 Ga0495585_0001225
390 Ga0495585_0169923
391 Ga0495607_0011731
392 Ga0495607_0019507
393 Ga0495607_0030722
394 Ga0495607_0047598
395 Ga0495607_0129389
396 Ga0495583_0000818
397 Ga0495583_0004054
398 Ga0495606_0000468
399 Ga0495606_0000956
400 Ga0495606_0041963
401 Ga0495606_0076618
402 Ga0495606_0134696
403 Ga0495610_0006517
404 Ga0495610_0094960
405 Ga0495616_0003109
406 Ga0495620_0010274
407 Ga0495628_0034136
408 Ga0495630_0006909
409 Ga0495632_0000051
410 Ga0495632_0005044
411 Ga0495632_0008305
412 Ga0495632_0153012
413 Ga0495637_0000133
414 Ga0495637_0000209
415 Ga0495637_0002736
416 Ga0495643_0011808
417 Ga0495648_0000219
418 Ga0495648_0006202
419 Ga0495654_0000508
420 Ga0495654_0002940
421 Ga0495665_0000577
422 Ga0495597_0034213
423 Ga0495645_0160591
424 Ga0495668_0029289
425 Ga0495611_0003655
426 Ga0495625_0009848
427 Ga0495635_0004080
428 Ga0495661_0000011
429 Ga0495661_0000475
430 Ga0495661_0004179
431 Ga0495661_0004219
432 Ga0495623_0005814
433 Ga0495646_0066196
434 Ga0495624_0002106
435 Ga0495671_0032568
436 Ga0495649_0000267
437 Ga0495649_0004540
438 Ga0495600_0030194
439 Ga0495660_0009071
440 Ga0495660_0019967
441 Ga0495604_0004021
442 Ga0495674_0140609
443 Ga0495672_0003314
444 Ga0495672_0006653
445 Ga0495680_0006476
446 Ga0495683_0001123
447 Ga0495687_002983
448 Ga0495687_040950
449 Ga0495675_0007514
450 Ga0495673_0002256
451 Ga0495673_0049627
452 Ga0495686_0004569
453 Ga0495593_0003127
454 Ga0495593_0036949
455 Ga0495602_0027200
456 Ga0495626_0002014
457 Ga0496100_0254784
458 Ga0496101_0027291
459 Ga0496102_0105509
460 Ga0496109_0110406
461 Ga0496112_0003658
462 Ga0496116_0004112
463 Ga0496117_0102107
464 Ga0496121_0003966
465 Ga0496121_0314353
466 Ga0496122_0000043
467 Ga0496123_0000090
468 Ga0496125_0000935
469 Ga0495678_000043
470 Ga0495678_001159
471 Ga0495678_001228
472 Ga0495678_021638
473 Ga0501032_0171736
474 Ga0501033_0006256
475 Ga0501033_0025022
476 Ga0501034_0327257
477 Ga0501036_0040964
478 Ga0501036_0188544
479 Ga0501037_0101479
480 Ga0501038_0094609
481 Ga0501039_0011687
482 Ga0501043_0091364
483 Ga0501043_0170973
484 Ga0501046_0025418
485 Ga0501046_0182303
486 Ga0501047_0125794
487 Ga0501047_0173434
488 Ga0501074_0065533
489 Ga0501080_0049376
490 Ga0501035_0136340
491 Ga0501035_0181080
492 Ga0501035_0237956
493 Ga0501044_0252842
494 nmdc:mga0k408_7378_c1
495 nmdc:mga07m45_101216_c1
496 nmdc:mga07m45_18481_c1
497 nmdc:mga07m45_85045_c1
498 nmdc:mga09592_30410_c1
499 nmdc:mga0qj67_16548_c1
500 nmdc:mga0sz30_65076_c1
501 Ga0500650_0186410
502 Ga0500618_001062
503 Ga0500618_009070
504 Ga0500621_000002
505 Ga0501084_0101756
506 2501077991
507 2511092047
508 2774130061
509 2808983490
510 2809128714
511 2809148335
512 2852620243
513 2857733037
514 2862582466
515 2917835727
516 2928121737
517 2939662459
518 2964328303
519 8054853028
520 8056211629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

175

296

0.98

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

18

183

0.95

PF03721

UDPG_MGDP_dh_N

UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

17

69

0.92

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

18

107

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9531 5 288
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9527 6 285
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.946 7 35
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9434 5 288
3doj-assembly1.cif.gz_A structure of glyoxylate reductase 1 from arabidopsis (atglyr1) 0.9416 7 286
ID Description Score Start End Superfamily
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9636 167 287 1.10.1040.10
5je8D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 6 165 3.40.50.720
af_A0A1D6LWN3_490_603_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9522 171 274 1.10.1040.10
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 6 161 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 5 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A163B4B6-F1-model_v4 deleted 0.9783 4 288
AF-A0A7S1MXA0-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9676 61 149 GO:0009083
GO:0016616
GO:0050661
AF-B5YP39-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9663 61 287 GO:0050661
GO:0051287
AF-A0A7S2MZN1-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.964 171 287 GO:0051287
AF-A0A7X6ISJ6-F1-model_v4 deleted 0.9624 60 177

Map