F369140

General Info

Members Datasets Scaffolds Average Seq Length
259 151 518 202

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0789840|Ga0501079_0789840_21_734
Length 237
Sequence MGTDDMDRNELNTFCREPAGPDGYDGIRHTMKVAELLLASQNPGKLAEMRQLVEGLPFRVLGPGDLGIADAPDETGSTFAENAVLKARHYSLEAGGRLTVADDSGISVEALGGEPGLYSSRFGGPGASDEDRNRLLLERLSGVPEQRRGARFTSAVAAARAGEVVFQAVETVEGRIATEPRGSNGFGYDPVFFYPPYGKTFGEVPRTDKDRVSHRGKAFARLRAYLAGPCLIGGPTS

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 0
Rhizoplane 0
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0789840 3300049741 Bacteria 747
2 Ga0070676_10054578 3300005328 Bacteria 2356
3 Ga0070690_100008004 3300005330 Bacteria 6068
4 Ga0070690_100092119 3300005330 Bacteria 1998
5 Ga0070690_100130354 3300005330 Bacteria 1698
6 Ga0070677_10245992 3300005333 Bacteria 885
7 Ga0068869_100032482 3300005334 Bacteria 3678
8 Ga0070666_10557496 3300005335 Bacteria 834
9 Ga0070680_100320896 3300005336 Bacteria 1315
10 Ga0068868_100058352 3300005338 Bacteria 3050
11 Ga0070689_100034031 3300005340 Bacteria 3886
12 Ga0070689_100134230 3300005340 Bacteria 1986
13 Ga0070687_100036493 3300005343 Bacteria 2450
14 Ga0070675_100505997 3300005354 Bacteria 1089
15 Ga0070674_100032888 3300005356 Bacteria 3447
16 Ga0070674_100553995 3300005356 Bacteria 965
17 Ga0070673_100761968 3300005364 Bacteria 892
18 Ga0070688_100026898 3300005365 Bacteria 3422
19 Ga0070703_10000084 3300005406 Bacteria 47544
20 Ga0070701_10003421 3300005438 Bacteria 6276
21 Ga0070705_100003576 3300005440 Bacteria 7611
22 Ga0070700_100066078 3300005441 Bacteria 2294
23 Ga0070700_100078495 3300005441 Bacteria 2125
24 Ga0070694_100012364 3300005444 Bacteria 5305
25 Ga0070694_100434766 3300005444 Bacteria 1033
26 Ga0070678_100025085 3300005456 Bacteria 4004
27 Ga0068867_100030013 3300005459 Bacteria 3921
28 Ga0070685_10252614 3300005466 Bacteria 1168
29 Ga0070706_100000666 3300005467 Bacteria 39121
30 Ga0070706_100022682 3300005467 Bacteria 5781
31 Ga0070706_100253184 3300005467 Bacteria 1644
32 Ga0070707_100134368 3300005468 Bacteria 2406
33 Ga0070698_100028700 3300005471 Bacteria 5776
34 Ga0070698_100033598 3300005471 Bacteria 5314
35 Ga0070699_100000029 3300005518 Bacteria 151185
36 Ga0070699_100013803 3300005518 Bacteria 6949
37 Ga0070699_100113017 3300005518 Bacteria 2385
38 Ga0070699_100672214 3300005518 Unclassified 946
39 Ga0070697_100010502 3300005536 Bacteria 7228
40 Ga0070697_100792667 3300005536 Unclassified 838
41 Ga0070672_100115769 3300005543 Bacteria 2189
42 Ga0070686_100105818 3300005544 Bacteria 1908
43 Ga0070686_100238974 3300005544 Bacteria 1321
44 Ga0070695_100030841 3300005545 Unclassified 3339
45 Ga0070695_100079480 3300005545 Bacteria 2165
46 Ga0070695_100137050 3300005545 Bacteria 1693
47 Ga0070696_100000559 3300005546 Bacteria 23651
48 Ga0070696_100001046 3300005546 Bacteria 17886
49 Ga0070696_100352101 3300005546 Bacteria 1141
50 Ga0070696_100668375 3300005546 Bacteria 844
51 Ga0070704_100006629 3300005549 Bacteria 6835
52 Ga0070704_100123598 3300005549 Bacteria 1993
53 Ga0070704_100277675 3300005549 Bacteria 1386
54 Ga0070664_100195536 3300005564 Bacteria 1803
55 Ga0068857_100145280 3300005577 Bacteria 2146
56 Ga0068857_100416587 3300005577 Bacteria 1252
57 Ga0068857_100707117 3300005577 Bacteria 958
58 Ga0068854_100517966 3300005578 Bacteria 1007
59 Ga0068852_100575420 3300005616 Bacteria 1129
60 Ga0068859_100608431 3300005617 Bacteria 1186
61 Ga0068864_100129036 3300005618 Bacteria 2269
62 Ga0068866_10113560 3300005718 Bacteria 1515
63 Ga0068861_100013164 3300005719 Bacteria 5786
64 Ga0068861_100049502 3300005719 Bacteria 3182
65 Ga0068861_100314599 3300005719 Bacteria 1362
66 Ga0068870_10199431 3300005840 Bacteria 1213
67 Ga0068863_100229454 3300005841 Bacteria 1790
68 Ga0068863_100275391 3300005841 Bacteria 1629
69 Ga0068858_100033789 3300005842 Bacteria 4743
70 Ga0068858_101047624 3300005842 Bacteria 800
71 Ga0068860_100152283 3300005843 Bacteria 2227
72 Ga0068860_100817163 3300005843 Bacteria 946
73 Ga0068862_100066742 3300005844 Bacteria 3100
74 Ga0068862_100083277 3300005844 Bacteria 2777
75 Ga0068862_100606961 3300005844 Bacteria 1051
76 Ga0081455_10386174 3300005937 Bacteria 976
77 Ga0075365_10176277 3300006038 Bacteria 1493
78 Ga0075368_10019377 3300006042 Bacteria 2568
79 Ga0075363_100082300 3300006048 Bacteria 1762
80 Ga0075363_100089077 3300006048 Bacteria 1697
81 Ga0075363_100200522 3300006048 Bacteria 1140
82 Ga0075364_10223432 3300006051 Bacteria 1278
83 Ga0075362_10012726 3300006177 Bacteria 3349
84 Ga0075367_10030865 3300006178 Bacteria 3075
85 Ga0075367_10068656 3300006178 Bacteria 2127
86 Ga0075366_10000547 3300006195 Bacteria 17508
87 Ga0075428_100086438 3300006844 Bacteria 3420
88 Ga0075428_100153295 3300006844 Bacteria 2503
89 Ga0075428_100368917 3300006844 Bacteria 1540
90 Ga0075428_100639930 3300006844 Bacteria 1134
91 Ga0075430_100262411 3300006846 Bacteria 1430
92 Ga0075430_100301908 3300006846 Bacteria 1324
93 Ga0075430_100451403 3300006846 Bacteria 1061
94 Ga0075431_100052228 3300006847 Bacteria 4215
95 Ga0075431_100478279 3300006847 Bacteria 1239
96 Ga0075431_100936635 3300006847 Bacteria 835
97 Ga0075433_10194963 3300006852 Bacteria 1802
98 Ga0075434_100061763 3300006871 Bacteria 3729
99 Ga0075434_100109872 3300006871 Bacteria 2767
100 Ga0075429_100292248 3300006880 Bacteria 1427
101 Ga0075429_100319680 3300006880 Bacteria 1358
102 Ga0075429_100556008 3300006880 Bacteria 1006
103 Ga0068865_100018294 3300006881 Bacteria 4520
104 Ga0097620_100608438 3300006931 Bacteria 1186
105 Ga0075435_100137079 3300007076 Bacteria 2051
106 Ga0075435_100138595 3300007076 Bacteria 2039
107 Ga0111539_10000379 3300009094 Bacteria 54892
108 Ga0111539_10049111 3300009094 Bacteria 5035
109 Ga0111539_10287691 3300009094 Bacteria 1913
110 Ga0114129_10017543 3300009147 Bacteria 10192
111 Ga0114129_10028926 3300009147 Bacteria 7851
112 Ga0114129_10050906 3300009147 Bacteria 5816
113 Ga0114129_10058036 3300009147 Bacteria 5415
114 Ga0114129_10263770 3300009147 Bacteria 2307
115 Ga0114129_10808752 3300009147 Bacteria 1195
116 Ga0114129_10874441 3300009147 Bacteria 1141
117 Ga0114129_11323584 3300009147 Bacteria 892
118 Ga0114129_11572148 3300009147 Bacteria 806
119 Ga0105243_10109613 3300009148 Bacteria 2307
120 Ga0105242_10152173 3300009176 Bacteria 2018
121 Ga0105248_10063666 3300009177 Bacteria 4139
122 Ga0105249_10090482 3300009553 Bacteria 2861
123 Ga0105246_10521691 3300011119 Bacteria 1013
124 Ga0157375_11042343 3300013308 Bacteria 956
125 Ga0157380_10001674 3300014326 Bacteria 14634
126 Ga0157380_10099048 3300014326 Bacteria 2423
127 Ga0157377_10216558 3300014745 Bacteria 1224
128 Ga0157379_10032011 3300014968 Bacteria 4687
129 Ga0207653_10000146 3300025885 Bacteria 50026
130 Ga0207682_10166933 3300025893 Bacteria 1000
131 Ga0207642_10086817 3300025899 Bacteria 1535
132 Ga0207645_10202087 3300025907 Bacteria 1308
133 Ga0207643_10026420 3300025908 Bacteria 3214
134 Ga0207684_10000075 3300025910 Bacteria 183366
135 Ga0207684_10032091 3300025910 Bacteria 4467
136 Ga0207684_10329536 3300025910 Bacteria 1315
137 Ga0207684_10353617 3300025910 Bacteria 1264
138 Ga0207662_10001737 3300025918 Bacteria 10686
139 Ga0207646_10010400 3300025922 Bacteria 9099
140 Ga0207646_10080677 3300025922 Bacteria 2909
141 Ga0207646_10638514 3300025922 Bacteria 954
142 Ga0207659_10032917 3300025926 Bacteria 3562
143 Ga0207644_10371742 3300025931 Bacteria 1165
144 Ga0207706_10020090 3300025933 Bacteria 6002
145 Ga0207706_11037449 3300025933 Bacteria 688
146 Ga0207709_10798296 3300025935 Bacteria 762
147 Ga0207670_10116478 3300025936 Bacteria 1934
148 Ga0207670_10309529 3300025936 Bacteria 1239
149 Ga0207704_10047546 3300025938 Bacteria 2565
150 Ga0207665_10435049 3300025939 Bacteria 1004
151 Ga0207691_10045705 3300025940 Bacteria 4024
152 Ga0207711_10111965 3300025941 Bacteria 2428
153 Ga0207689_10012710 3300025942 Bacteria 7192
154 Ga0207651_10041045 3300025960 Bacteria 3068
155 Ga0207651_10192638 3300025960 Bacteria 1627
156 Ga0207712_10870512 3300025961 Bacteria 795
157 Ga0207640_10980866 3300025981 Bacteria 742
158 Ga0207677_10048122 3300026023 Bacteria 2869
159 Ga0207639_10518032 3300026041 Bacteria 1092
160 Ga0207678_10016399 3300026067 Bacteria 6504
161 Ga0207708_10018430 3300026075 Bacteria 5257
162 Ga0207708_10160650 3300026075 Bacteria 1774
163 Ga0207641_10379097 3300026088 Bacteria 1354
164 Ga0207648_10006673 3300026089 Bacteria 11449
165 Ga0207676_10662457 3300026095 Bacteria 1008
166 Ga0207676_10800787 3300026095 Bacteria 919
167 Ga0207674_10340970 3300026116 Bacteria 1449
168 Ga0207674_11235353 3300026116 Bacteria 717
169 Ga0207675_100026447 3300026118 Bacteria 5402
170 Ga0207675_100083221 3300026118 Bacteria 3001
171 Ga0207675_100454014 3300026118 Bacteria 1270
172 Ga0207683_10082226 3300026121 Bacteria 2861
173 Ga0209813_10024710 3300027866 Bacteria 1721
174 Ga0207428_10000043 3300027907 Bacteria 198931
175 Ga0207428_10107658 3300027907 Bacteria 2147
176 Ga0268264_10153122 3300028381 Bacteria 2069
177 Ga0268264_11204726 3300028381 Bacteria 767
178 Ga0316576_10022946 3300031727 Bacteria 4341
179 Ga0316576_10198070 3300031727 Bacteria 1513
180 Ga0316578_10034866 3300031728 Bacteria 2891
181 Ga0316578_10060777 3300031728 Bacteria 2225
182 Ga0307416_100776051 3300032002 Bacteria 1053
183 Ga0316580_10094524 3300032139 Bacteria 915
184 Ga0316574_0073675 3300035398 Bacteria 2160
185 Ga0316582_0653120 3300036647 Bacteria 723
186 Ga0316584_0029399 3300036712 Bacteria 4055
187 Ga0453683_0029145 3300044673 Bacteria 3492
188 Ga0453683_0098349 3300044673 Bacteria 1837
189 Ga0495656_0196922 3300046615 Bacteria 998
190 Ga0495669_0003639 3300046684 Bacteria 6349
191 Ga0495672_0001496 3300047320 Bacteria 22913
192 Ga0501031_0110866 3300049568 Bacteria 1792
193 Ga0501032_0165770 3300049569 Bacteria 1450
194 Ga0501036_0010826 3300049572 Bacteria 7536
195 Ga0501036_0615349 3300049572 Unclassified 900
196 Ga0501038_0458546 3300049574 Bacteria 979
197 Ga0501038_0605138 3300049574 Unclassified 829
198 Ga0501041_0077987 3300049577 Bacteria 2038
199 Ga0501041_0169195 3300049577 Bacteria 1367
200 Ga0501042_0007745 3300049578 Bacteria 7056
201 Ga0501071_0128527 3300049587 Bacteria 1881
202 Ga0501072_0229696 3300049588 Bacteria 1478
203 Ga0501072_0585045 3300049588 Bacteria 880
204 Ga0501072_0608566 3300049588 Bacteria 861
205 Ga0501076_0007074 3300049592 Bacteria 8152
206 Ga0501076_0009849 3300049592 Bacteria 7065
207 Ga0501076_0263757 3300049592 Bacteria 1411
208 Ga0501076_0587200 3300049592 Bacteria 919
209 Ga0501077_0440082 3300049593 Bacteria 835
210 Ga0501079_0174274 3300049741 Bacteria 1677
211 Ga0501079_0211831 3300049741 Bacteria 1514
212 Ga0501079_0503380 3300049741 Bacteria 952
213 Ga0501079_0515410 3300049741 Bacteria 940
214 Ga0501080_0154346 3300049742 Bacteria 2121
215 Ga0501081_0091173 3300049743 Bacteria 2143
216 Ga0501081_0598350 3300049743 Bacteria 825
217 Ga0501035_0240464 3300049822 Bacteria 1540
218 Ga0501035_0891764 3300049822 Unclassified 705
219 Ga0501045_0026770 3300049824 Bacteria 4151
220 Ga0501045_0590628 3300049824 Bacteria 823
221 nmdc:mga03683_8060_c1 3300050489 Bacteria 3688
222 nmdc:mga03n38_97149_c1 3300050490 Bacteria 1414
223 nmdc:mga00v17_150055_c1 3300050491 Bacteria 1497
224 nmdc:mga00v17_75742_c1 3300050491 Bacteria 2093
225 nmdc:mga0k408_1703_c1 3300050493 Bacteria 11841
226 nmdc:mga06z11_2190_c1 3300050494 Bacteria 7415
227 nmdc:mga06z11_53706_c1 3300050494 Bacteria 2073
228 nmdc:mga04h51_18784_c1 3300050495 Bacteria 2041
229 nmdc:mga07m45_351701_c1 3300050496 Bacteria 856
230 nmdc:mga05p37_145124_c1 3300050507 Bacteria 2907
231 nmdc:mga05p37_151445_c1 3300050507 Bacteria 2836
232 nmdc:mga05p37_194580_c1 3300050507 Bacteria 2459
233 nmdc:mga05p37_256129_c1 3300050507 Bacteria 2097
234 nmdc:mga05p37_59154_c1 3300050507 Bacteria 4720
235 nmdc:mga09592_27570_c1 3300050508 Bacteria 4714
236 nmdc:mga09592_371694_c1 3300050508 Bacteria 1237
237 nmdc:mga0qj67_420215_c1 3300050509 Bacteria 1078
238 nmdc:mga0qj67_820141_c1 3300050509 Bacteria 736
239 nmdc:mga06r32_2387_c1 3300050510 Bacteria 16812
240 nmdc:mga06r32_271443_c1 3300050510 Bacteria 1683
241 nmdc:mga06r32_313703_c1 3300050510 Bacteria 1554
242 nmdc:mga06r32_716359_c1 3300050510 Bacteria 965
243 nmdc:mga06r32_935373_c1 3300050510 Bacteria 822
244 nmdc:mga08y16_1029263_c1 3300050511 Bacteria 802
245 nmdc:mga08y16_22823_c1 3300050511 Bacteria 6604
246 nmdc:mga08y16_850949_c1 3300050511 Bacteria 901
247 nmdc:mga0n895_18744_c1 3300050512 Bacteria 6413
248 nmdc:mga0n895_505166_c1 3300050512 Bacteria 1218
249 nmdc:mga0rr50_74016_c1 3300050513 Bacteria 2606
250 nmdc:mga08x19_343006_c1 3300050514 Bacteria 1042
251 nmdc:mga0a205_12850_c1 3300050515 Bacteria 1890
252 nmdc:mga0a205_37591_c1 3300050515 Bacteria 1292
253 nmdc:mga0a205_52191_c1 3300050515 Bacteria 3947
254 Ga0501084_0540811 3300054114 Bacteria 984
255 Ga0501082_0059690 3300060353 Bacteria 3287
256 Ga0501082_0098940 3300060353 Bacteria 2522
257 Ga0501082_0431734 3300060353 Bacteria 1151
258 Ga0530510_0050953 3300061734 Bacteria 2991
259 Ga0530510_0125677 3300061734 Bacteria 1885
260 Ga0501079_0789840
261 Ga0070676_10054578
262 Ga0070690_100008004
263 Ga0070690_100092119
264 Ga0070690_100130354
265 Ga0070677_10245992
266 Ga0068869_100032482
267 Ga0070666_10557496
268 Ga0070680_100320896
269 Ga0068868_100058352
270 Ga0070689_100034031
271 Ga0070689_100134230
272 Ga0070687_100036493
273 Ga0070675_100505997
274 Ga0070674_100032888
275 Ga0070674_100553995
276 Ga0070673_100761968
277 Ga0070688_100026898
278 Ga0070703_10000084
279 Ga0070701_10003421
280 Ga0070705_100003576
281 Ga0070700_100066078
282 Ga0070700_100078495
283 Ga0070694_100012364
284 Ga0070694_100434766
285 Ga0070678_100025085
286 Ga0068867_100030013
287 Ga0070685_10252614
288 Ga0070706_100000666
289 Ga0070706_100022682
290 Ga0070706_100253184
291 Ga0070707_100134368
292 Ga0070698_100028700
293 Ga0070698_100033598
294 Ga0070699_100000029
295 Ga0070699_100013803
296 Ga0070699_100113017
297 Ga0070699_100672214
298 Ga0070697_100010502
299 Ga0070697_100792667
300 Ga0070672_100115769
301 Ga0070686_100105818
302 Ga0070686_100238974
303 Ga0070695_100030841
304 Ga0070695_100079480
305 Ga0070695_100137050
306 Ga0070696_100000559
307 Ga0070696_100001046
308 Ga0070696_100352101
309 Ga0070696_100668375
310 Ga0070704_100006629
311 Ga0070704_100123598
312 Ga0070704_100277675
313 Ga0070664_100195536
314 Ga0068857_100145280
315 Ga0068857_100416587
316 Ga0068857_100707117
317 Ga0068854_100517966
318 Ga0068852_100575420
319 Ga0068859_100608431
320 Ga0068864_100129036
321 Ga0068866_10113560
322 Ga0068861_100013164
323 Ga0068861_100049502
324 Ga0068861_100314599
325 Ga0068870_10199431
326 Ga0068863_100229454
327 Ga0068863_100275391
328 Ga0068858_100033789
329 Ga0068858_101047624
330 Ga0068860_100152283
331 Ga0068860_100817163
332 Ga0068862_100066742
333 Ga0068862_100083277
334 Ga0068862_100606961
335 Ga0081455_10386174
336 Ga0075365_10176277
337 Ga0075368_10019377
338 Ga0075363_100082300
339 Ga0075363_100089077
340 Ga0075363_100200522
341 Ga0075364_10223432
342 Ga0075362_10012726
343 Ga0075367_10030865
344 Ga0075367_10068656
345 Ga0075366_10000547
346 Ga0075428_100086438
347 Ga0075428_100153295
348 Ga0075428_100368917
349 Ga0075428_100639930
350 Ga0075430_100262411
351 Ga0075430_100301908
352 Ga0075430_100451403
353 Ga0075431_100052228
354 Ga0075431_100478279
355 Ga0075431_100936635
356 Ga0075433_10194963
357 Ga0075434_100061763
358 Ga0075434_100109872
359 Ga0075429_100292248
360 Ga0075429_100319680
361 Ga0075429_100556008
362 Ga0068865_100018294
363 Ga0097620_100608438
364 Ga0075435_100137079
365 Ga0075435_100138595
366 Ga0111539_10000379
367 Ga0111539_10049111
368 Ga0111539_10287691
369 Ga0114129_10017543
370 Ga0114129_10028926
371 Ga0114129_10050906
372 Ga0114129_10058036
373 Ga0114129_10263770
374 Ga0114129_10808752
375 Ga0114129_10874441
376 Ga0114129_11323584
377 Ga0114129_11572148
378 Ga0105243_10109613
379 Ga0105242_10152173
380 Ga0105248_10063666
381 Ga0105249_10090482
382 Ga0105246_10521691
383 Ga0157375_11042343
384 Ga0157380_10001674
385 Ga0157380_10099048
386 Ga0157377_10216558
387 Ga0157379_10032011
388 Ga0207653_10000146
389 Ga0207682_10166933
390 Ga0207642_10086817
391 Ga0207645_10202087
392 Ga0207643_10026420
393 Ga0207684_10000075
394 Ga0207684_10032091
395 Ga0207684_10329536
396 Ga0207684_10353617
397 Ga0207662_10001737
398 Ga0207646_10010400
399 Ga0207646_10080677
400 Ga0207646_10638514
401 Ga0207659_10032917
402 Ga0207644_10371742
403 Ga0207706_10020090
404 Ga0207706_11037449
405 Ga0207709_10798296
406 Ga0207670_10116478
407 Ga0207670_10309529
408 Ga0207704_10047546
409 Ga0207665_10435049
410 Ga0207691_10045705
411 Ga0207711_10111965
412 Ga0207689_10012710
413 Ga0207651_10041045
414 Ga0207651_10192638
415 Ga0207712_10870512
416 Ga0207640_10980866
417 Ga0207677_10048122
418 Ga0207639_10518032
419 Ga0207678_10016399
420 Ga0207708_10018430
421 Ga0207708_10160650
422 Ga0207641_10379097
423 Ga0207648_10006673
424 Ga0207676_10662457
425 Ga0207676_10800787
426 Ga0207674_10340970
427 Ga0207674_11235353
428 Ga0207675_100026447
429 Ga0207675_100083221
430 Ga0207675_100454014
431 Ga0207683_10082226
432 Ga0209813_10024710
433 Ga0207428_10000043
434 Ga0207428_10107658
435 Ga0268264_10153122
436 Ga0268264_11204726
437 Ga0316576_10022946
438 Ga0316576_10198070
439 Ga0316578_10034866
440 Ga0316578_10060777
441 Ga0307416_100776051
442 Ga0316580_10094524
443 Ga0316574_0073675
444 Ga0316582_0653120
445 Ga0316584_0029399
446 Ga0453683_0029145
447 Ga0453683_0098349
448 Ga0495656_0196922
449 Ga0495669_0003639
450 Ga0495672_0001496
451 Ga0501031_0110866
452 Ga0501032_0165770
453 Ga0501036_0010826
454 Ga0501036_0615349
455 Ga0501038_0458546
456 Ga0501038_0605138
457 Ga0501041_0077987
458 Ga0501041_0169195
459 Ga0501042_0007745
460 Ga0501071_0128527
461 Ga0501072_0229696
462 Ga0501072_0585045
463 Ga0501072_0608566
464 Ga0501076_0007074
465 Ga0501076_0009849
466 Ga0501076_0263757
467 Ga0501076_0587200
468 Ga0501077_0440082
469 Ga0501079_0174274
470 Ga0501079_0211831
471 Ga0501079_0503380
472 Ga0501079_0515410
473 Ga0501080_0154346
474 Ga0501081_0091173
475 Ga0501081_0598350
476 Ga0501035_0240464
477 Ga0501035_0891764
478 Ga0501045_0026770
479 Ga0501045_0590628
480 nmdc:mga03683_8060_c1
481 nmdc:mga03n38_97149_c1
482 nmdc:mga00v17_150055_c1
483 nmdc:mga00v17_75742_c1
484 nmdc:mga0k408_1703_c1
485 nmdc:mga06z11_2190_c1
486 nmdc:mga06z11_53706_c1
487 nmdc:mga04h51_18784_c1
488 nmdc:mga07m45_351701_c1
489 nmdc:mga05p37_145124_c1
490 nmdc:mga05p37_151445_c1
491 nmdc:mga05p37_194580_c1
492 nmdc:mga05p37_256129_c1
493 nmdc:mga05p37_59154_c1
494 nmdc:mga09592_27570_c1
495 nmdc:mga09592_371694_c1
496 nmdc:mga0qj67_420215_c1
497 nmdc:mga0qj67_820141_c1
498 nmdc:mga06r32_2387_c1
499 nmdc:mga06r32_271443_c1
500 nmdc:mga06r32_313703_c1
501 nmdc:mga06r32_716359_c1
502 nmdc:mga06r32_935373_c1
503 nmdc:mga08y16_1029263_c1
504 nmdc:mga08y16_22823_c1
505 nmdc:mga08y16_850949_c1
506 nmdc:mga0n895_18744_c1
507 nmdc:mga0n895_505166_c1
508 nmdc:mga0rr50_74016_c1
509 nmdc:mga08x19_343006_c1
510 nmdc:mga0a205_12850_c1
511 nmdc:mga0a205_37591_c1
512 nmdc:mga0a205_52191_c1
513 Ga0501084_0540811
514 Ga0501082_0059690
515 Ga0501082_0098940
516 Ga0501082_0431734
517 Ga0530510_0050953
518 Ga0530510_0125677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

36

225

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9284 3 197
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9238 3 197
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.9148 3 194
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.8915 1 194
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.887 3 194
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9506 1 194 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9319 1 194 3.90.950.10
2ztiA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9108 3 197 3.90.950.10
2ztiA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9016 3 197 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8933 1 198 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A7C2WH61-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.981 1 193 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7C3MIC0-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9779 2 193 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7X9FX27-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9749 2 197 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A641AGF9-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.973 3 194 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A2W1B7Z9-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9727 1 194 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Map