F368825

General Info

Members Datasets Scaffolds Average Seq Length
259 156 518 377

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10029936|Ga0163163_100299362
Length 405
Sequence LAVEDRRAASATPPIERVSPRLTHNGHGPSGNRGRSSLLLTLLFVATIALPLAANLAGADGADPAAENRELAPFPRTDGSPASLAALPAAFAAWFDDHFGFRSRLVRWYGESRLFILHASPSGAVVKGEHGWFFYGDDKSVEDYANVEPMTDQALANWRAAVLRARDWLRTRGIAYVFTIAPDKHVIYAEEMPSAIERIGRLSRTDQLFTALQDAGLAVDLRGVEFEAKAHERVYQQTDTHWNDRGALVAYQQIISAVRAGVPWTPPAWARGDFTAMDRNIEGLDLAGMMGLTRVLREIDMTLVPRRPRRARVIEPAGGKPTDEEGRLVTEIDDASLPRAVIFRDSFSSRLVPFLSEHFSRAVYLWQNDFDANIVAQEHPDVVIQQIVGRHLYNFVPSPELVPDP

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.25
Rhizosphere 95.75
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10029936 3300014325 Bacteria 5240
2 JGI24751J29686_10003914 3300002459 Bacteria 3007
3 JGI25406J46586_10000754 3300003203 Bacteria 15113
4 Ga0065712_10009831 3300005290 Bacteria 3146
5 Ga0065712_10068533 3300005290 Bacteria 10024
6 Ga0070676_10056447 3300005328 Bacteria 2320
7 Ga0070690_100041796 3300005330 Bacteria 2903
8 Ga0070670_100025320 3300005331 Bacteria 5106
9 Ga0070670_100210591 3300005331 Bacteria 1690
10 Ga0070666_10095474 3300005335 Bacteria 2046
11 Ga0070666_10168652 3300005335 Bacteria 1532
12 Ga0070680_100185702 3300005336 Unclassified 1751
13 Ga0070682_100210254 3300005337 Bacteria 1378
14 Ga0068868_100043817 3300005338 Bacteria 3496
15 Ga0068868_100100828 3300005338 Bacteria 2336
16 Ga0068868_100231521 3300005338 Bacteria 1550
17 Ga0070660_100025801 3300005339 Bacteria 4370
18 Ga0070691_10006776 3300005341 Bacteria 5241
19 Ga0070661_100098806 3300005344 Bacteria 2168
20 Ga0070668_100070592 3300005347 Bacteria 2719
21 Ga0070668_100147849 3300005347 Unclassified 1898
22 Ga0070669_100009676 3300005353 Bacteria 6865
23 Ga0070669_100086434 3300005353 Bacteria 2343
24 Ga0070675_100000172 3300005354 Bacteria 40213
25 Ga0070675_100007568 3300005354 Bacteria 8401
26 Ga0070671_100242834 3300005355 Unclassified 1529
27 Ga0070674_100035232 3300005356 Unclassified 3351
28 Ga0070667_100182431 3300005367 Bacteria 1857
29 Ga0070700_100083367 3300005441 Bacteria 2069
30 Ga0070678_100023045 3300005456 Bacteria 4141
31 Ga0070662_100298289 3300005457 Unclassified 1309
32 Ga0070681_10008443 3300005458 Bacteria 10082
33 Ga0068867_100004942 3300005459 Bacteria 9394
34 Ga0068867_100011483 3300005459 Bacteria 6252
35 Ga0068867_100016984 3300005459 Bacteria 5171
36 Ga0070707_100208107 3300005468 Bacteria 1907
37 Ga0070707_100282810 3300005468 Bacteria 1612
38 Ga0070698_100089444 3300005471 Bacteria 3063
39 Ga0070698_100177438 3300005471 Bacteria 2069
40 Ga0070699_100079731 3300005518 Bacteria 2853
41 Ga0070699_100106000 3300005518 Bacteria 2466
42 Ga0070699_100278450 3300005518 Bacteria 1498
43 Ga0070679_100044641 3300005530 Bacteria 4415
44 Ga0070679_100102395 3300005530 Bacteria 2849
45 Ga0070697_100219298 3300005536 Unclassified 1621
46 Ga0070686_100006595 3300005544 Bacteria 6462
47 Ga0070686_100191434 3300005544 Bacteria 1460
48 Ga0070693_100018549 3300005547 Bacteria 3637
49 Ga0070665_100019140 3300005548 Bacteria 6870
50 Ga0070704_100130625 3300005549 Unclassified 1946
51 Ga0070704_100166586 3300005549 Bacteria 1748
52 Ga0068855_100008194 3300005563 Bacteria 12631
53 Ga0068855_100301630 3300005563 Bacteria 1774
54 Ga0068855_100388500 3300005563 Bacteria 1531
55 Ga0068856_100010295 3300005614 Bacteria 9090
56 Ga0068856_100133384 3300005614 Bacteria 2489
57 Ga0068859_100174228 3300005617 Bacteria 2233
58 Ga0068859_100191252 3300005617 Bacteria 2131
59 Ga0068864_100002159 3300005618 Bacteria 16261
60 Ga0068866_10027909 3300005718 Unclassified 2685
61 Ga0068861_100003326 3300005719 Bacteria 10638
62 Ga0068861_100134786 3300005719 Bacteria 2008
63 Ga0068861_100147796 3300005719 Bacteria 1925
64 Ga0068858_100018936 3300005842 Bacteria 6442
65 Ga0068862_100022476 3300005844 Bacteria 5275
66 Ga0081539_10000184 3300005985 Bacteria 147966
67 Ga0081539_10000268 3300005985 Bacteria 119235
68 Ga0081539_10002829 3300005985 Bacteria 23195
69 Ga0081539_10007146 3300005985 Bacteria 10302
70 Ga0070717_10166290 3300006028 Bacteria 1916
71 Ga0070716_100244711 3300006173 Bacteria 1218
72 Ga0070712_100005447 3300006175 Bacteria 7882
73 Ga0097621_100008766 3300006237 Bacteria 7306
74 Ga0097621_100012381 3300006237 Bacteria 6321
75 Ga0097621_100178048 3300006237 Bacteria 1836
76 Ga0068871_100002177 3300006358 Bacteria 13307
77 Ga0068871_100014001 3300006358 Bacteria 5967
78 Ga0075428_100086012 3300006844 Bacteria 3429
79 Ga0075430_100079054 3300006846 Bacteria 2757
80 Ga0075431_100114949 3300006847 Bacteria 2778
81 Ga0075433_10019286 3300006852 Bacteria 5681
82 Ga0075434_100000589 3300006871 Bacteria 28031
83 Ga0075434_100039505 3300006871 Bacteria 4676
84 Ga0075429_100023786 3300006880 Bacteria 5316
85 Ga0075429_100055405 3300006880 Bacteria 3450
86 Ga0068865_100016072 3300006881 Bacteria 4780
87 Ga0075436_100002635 3300006914 Bacteria 12338
88 Ga0075436_100005279 3300006914 Bacteria 8886
89 Ga0075436_100037764 3300006914 Bacteria 3334
90 Ga0075436_100051815 3300006914 Bacteria 2832
91 Ga0097620_100174226 3300006931 Bacteria 2233
92 Ga0097620_100191266 3300006931 Bacteria 2131
93 Ga0075435_100000014 3300007076 Bacteria 100771
94 Ga0075435_100000780 3300007076 Bacteria 19791
95 Ga0075435_100005241 3300007076 Bacteria 9025
96 Ga0075435_100008179 3300007076 Bacteria 7489
97 Ga0075435_100014734 3300007076 Bacteria 5859
98 Ga0075435_100127004 3300007076 Bacteria 2132
99 Ga0105240_10006183 3300009093 Bacteria 17642
100 Ga0105240_10173372 3300009093 Bacteria 2552
101 Ga0105240_10236308 3300009093 Bacteria 2121
102 Ga0111539_10017901 3300009094 Bacteria 8777
103 Ga0111539_10032151 3300009094 Bacteria 6374
104 Ga0105245_10159473 3300009098 Bacteria 2139
105 Ga0105245_10254555 3300009098 Bacteria 1707
106 Ga0105247_10056036 3300009101 Bacteria 2434
107 Ga0114129_10001288 3300009147 Bacteria 33389
108 Ga0114129_10008350 3300009147 Bacteria 14762
109 Ga0114129_10011111 3300009147 Bacteria 12831
110 Ga0114129_10039673 3300009147 Bacteria 6639
111 Ga0114129_10048615 3300009147 Bacteria 5960
112 Ga0114129_10081893 3300009147 Bacteria 4486
113 Ga0114129_10187791 3300009147 Bacteria 2808
114 Ga0105243_10127400 3300009148 Bacteria 2156
115 Ga0105241_10101809 3300009174 Bacteria 2285
116 Ga0105242_10015287 3300009176 Bacteria 5961
117 Ga0105242_10018054 3300009176 Bacteria 5509
118 Ga0105242_10018065 3300009176 Bacteria 5507
119 Ga0105248_10002669 3300009177 Bacteria 19819
120 Ga0105248_10036712 3300009177 Bacteria 5481
121 Ga0105248_10044867 3300009177 Bacteria 4958
122 Ga0105248_10066038 3300009177 Bacteria 4062
123 Ga0105248_10192755 3300009177 Bacteria 2296
124 Ga0105248_10228974 3300009177 Bacteria 2092
125 Ga0105248_10331713 3300009177 Bacteria 1713
126 Ga0105248_10526383 3300009177 Unclassified 1333
127 Ga0105238_10017586 3300009551 Bacteria 7269
128 Ga0105238_10116604 3300009551 Bacteria 2650
129 Ga0105249_10168039 3300009553 Bacteria 2125
130 Ga0105246_10091821 3300011119 Bacteria 2190
131 Ga0157374_10020939 3300013296 Bacteria 5810
132 Ga0163162_10057445 3300013306 Unclassified 3919
133 Ga0157372_10185908 3300013307 Bacteria 2406
134 Ga0163163_10001392 3300014325 Bacteria 20434
135 Ga0163163_10014053 3300014325 Bacteria 7348
136 Ga0163163_10016513 3300014325 Bacteria 6864
137 Ga0157377_10172448 3300014745 Bacteria 1354
138 Ga0157379_10013338 3300014968 Bacteria 7195
139 Ga0157379_10067681 3300014968 Bacteria 3192
140 Ga0157376_10123034 3300014969 Bacteria 2303
141 Ga0207710_10027815 3300025900 Bacteria 2452
142 Ga0207645_10003421 3300025907 Bacteria 12065
143 Ga0207654_10057765 3300025911 Bacteria 2256
144 Ga0207707_10011991 3300025912 Bacteria 7534
145 Ga0207707_10028191 3300025912 Bacteria 4908
146 Ga0207695_10023644 3300025913 Bacteria 6934
147 Ga0207695_10239333 3300025913 Bacteria 1717
148 Ga0207660_10227708 3300025917 Unclassified 1465
149 Ga0207662_10071465 3300025918 Bacteria 2101
150 Ga0207657_10005357 3300025919 Bacteria 13439
151 Ga0207657_10072226 3300025919 Bacteria 2920
152 Ga0207646_10108594 3300025922 Bacteria 2490
153 Ga0207681_10094723 3300025923 Bacteria 2140
154 Ga0207681_10204959 3300025923 Unclassified 1516
155 Ga0207694_10021541 3300025924 Bacteria 4885
156 Ga0207659_10004490 3300025926 Bacteria 8439
157 Ga0207659_10122346 3300025926 Bacteria 1996
158 Ga0207687_10172908 3300025927 Bacteria 1667
159 Ga0207644_10248179 3300025931 Unclassified 1419
160 Ga0207690_10098389 3300025932 Bacteria 2084
161 Ga0207686_10015890 3300025934 Bacteria 4217
162 Ga0207686_10035472 3300025934 Bacteria 2994
163 Ga0207686_10038521 3300025934 Bacteria 2893
164 Ga0207709_10091432 3300025935 Unclassified 1990
165 Ga0207704_10039076 3300025938 Bacteria 2759
166 Ga0207711_10040326 3300025941 Bacteria 3972
167 Ga0207711_10041471 3300025941 Bacteria 3920
168 Ga0207711_10046923 3300025941 Bacteria 3691
169 Ga0207711_10055051 3300025941 Bacteria 3415
170 Ga0207711_10321954 3300025941 Unclassified 1429
171 Ga0207661_10255315 3300025944 Bacteria 1560
172 Ga0207679_10149712 3300025945 Unclassified 1898
173 Ga0207667_10036289 3300025949 Bacteria 5284
174 Ga0207667_10245067 3300025949 Unclassified 1834
175 Ga0207712_10042923 3300025961 Unclassified 3117
176 Ga0207668_10017131 3300025972 Bacteria 4534
177 Ga0207668_10047406 3300025972 Bacteria 2942
178 Ga0207640_10012920 3300025981 Bacteria 4771
179 Ga0207640_10039038 3300025981 Bacteria 3002
180 Ga0207677_10023565 3300026023 Bacteria 3806
181 Ga0207677_10056136 3300026023 Bacteria 2696
182 Ga0207677_10137819 3300026023 Bacteria 1863
183 Ga0207703_10008831 3300026035 Bacteria 7945
184 Ga0207703_10286374 3300026035 Bacteria 1498
185 Ga0207708_10139252 3300026075 Bacteria 1902
186 Ga0207702_10015197 3300026078 Bacteria 6383
187 Ga0207648_10013259 3300026089 Bacteria 7679
188 Ga0207648_10018716 3300026089 Bacteria 6263
189 Ga0207676_10009767 3300026095 Bacteria 6824
190 Ga0207676_10336039 3300026095 Bacteria 1392
191 Ga0207675_100001872 3300026118 Bacteria 21031
192 Ga0207675_100062357 3300026118 Bacteria 3481
193 Ga0268266_10015565 3300028379 Bacteria 6521
194 Ga0268266_10015940 3300028379 Bacteria 6430
195 Ga0268265_10010699 3300028380 Bacteria 6193
196 Ga0307405_10155166 3300031731 Bacteria 1615
197 Ga0373950_0001638 3300034818 Bacteria 2956
198 Ga0373958_0000727 3300034819 Bacteria 4188
199 Ga0373938_0001046 3300034957 Bacteria 4455
200 Ga0373929_0003133 3300035085 Bacteria 3004
201 Ga0373951_0004740 3300035091 Bacteria 3212
202 Ga0373939_0000307 3300035114 Bacteria 12740
203 Ga0373941_0000487 3300035115 Bacteria 7933
204 Ga0373957_0059750 3300035120 Bacteria 1475
205 Ga0373955_0010044 3300035172 Bacteria 4456
206 Ga0373942_0000410 3300035207 Bacteria 11950
207 Ga0373961_0006019 3300035241 Bacteria 2912
208 Ga0373924_0059472 3300035410 Bacteria 1596
209 Ga0373931_0027393 3300035691 Bacteria 2909
210 Ga0373933_0138171 3300035724 Unclassified 1537
211 Ga0373925_0272462 3300037068 Unclassified 1362
212 Ga0451576_0007188 3300045051 Bacteria 13413
213 Ga0451576_0266193 3300045051 Bacteria 1792
214 Ga0495651_0236886 3300046462 Bacteria 1254
215 Ga0495653_0146363 3300046463 Bacteria 1655
216 Ga0495628_0060914 3300046516 Bacteria 2961
217 Ga0495630_0104897 3300046517 Bacteria 2140
218 Ga0495645_0004297 3300046543 Bacteria 9735
219 Ga0495634_0053081 3300046642 Bacteria 2716
220 Ga0495658_0118059 3300046683 Bacteria 1601
221 Ga0495669_0074702 3300046684 Bacteria 1550
222 Ga0495674_0045386 3300047319 Bacteria 3902
223 Ga0495684_0027318 3300047471 Bacteria 4382
224 Ga0496102_0164752 3300048905 Bacteria 2086
225 Ga0496102_0462067 3300048905 Unclassified 1190
226 Ga0496104_0065185 3300048907 Bacteria 3456
227 Ga0496108_0045208 3300048911 Bacteria 3677
228 Ga0496108_0119752 3300048911 Unclassified 2257
229 Ga0496109_0081372 3300048912 Bacteria 2984
230 Ga0496111_0122276 3300048914 Unclassified 1923
231 Ga0496112_0022221 3300048915 Bacteria 6045
232 Ga0496112_0199170 3300048915 Bacteria 1962
233 Ga0496113_0063429 3300048916 Bacteria 2792
234 Ga0496113_0255363 3300048916 Unclassified 1400
235 Ga0501067_0025536 3300049583 Bacteria 3275
236 Ga0501079_0206827 3300049741 Bacteria 1533
237 nmdc:mga05p37_18783_c1 3300050507 Bacteria 8354
238 nmdc:mga05p37_236946_c1 3300050507 Bacteria 2196
239 nmdc:mga05p37_2395_c1 3300050507 Bacteria 21805
240 nmdc:mga05p37_438708_c1 3300050507 Bacteria 1515
241 nmdc:mga05p37_9449_c1 3300050507 Bacteria 11545
242 nmdc:mga09592_112021_c1 3300050508 Bacteria 2341
243 nmdc:mga09592_8503_c1 3300050508 Bacteria 8346
244 nmdc:mga0qj67_14467_c1 3300050509 Bacteria 5966
245 nmdc:mga06r32_257964_c1 3300050510 Unclassified 1731
246 nmdc:mga0n895_275416_c1 3300050512 Bacteria 1707
247 nmdc:mga0n895_443_c1 3300050512 Bacteria 27747
248 nmdc:mga0n895_59328_c1 3300050512 Bacteria 3775
249 nmdc:mga0n895_87818_c1 3300050512 Bacteria 3108
250 nmdc:mga0rr50_134290_c1 3300050513 Bacteria 1985
251 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
252 nmdc:mga0rr50_418_c1 3300050513 Bacteria 22918
253 nmdc:mga0rr50_86760_c1 3300050513 Bacteria 2428
254 nmdc:mga08x19_119_c1 3300050514 Bacteria 70188
255 nmdc:mga08x19_60512_c1 3300050514 Bacteria 2453
256 nmdc:mga0a205_25735_c1 3300050515 Bacteria 5607
257 Ga0495601_0193830 3300053077 Bacteria 1328
258 Ga0495619_0035159 3300053085 Bacteria 3259
259 Ga0495619_0175506 3300053085 Unclassified 1482
260 Ga0163163_10029936
261 JGI24751J29686_10003914
262 JGI25406J46586_10000754
263 Ga0065712_10009831
264 Ga0065712_10068533
265 Ga0070676_10056447
266 Ga0070690_100041796
267 Ga0070670_100025320
268 Ga0070670_100210591
269 Ga0070666_10095474
270 Ga0070666_10168652
271 Ga0070680_100185702
272 Ga0070682_100210254
273 Ga0068868_100043817
274 Ga0068868_100100828
275 Ga0068868_100231521
276 Ga0070660_100025801
277 Ga0070691_10006776
278 Ga0070661_100098806
279 Ga0070668_100070592
280 Ga0070668_100147849
281 Ga0070669_100009676
282 Ga0070669_100086434
283 Ga0070675_100000172
284 Ga0070675_100007568
285 Ga0070671_100242834
286 Ga0070674_100035232
287 Ga0070667_100182431
288 Ga0070700_100083367
289 Ga0070678_100023045
290 Ga0070662_100298289
291 Ga0070681_10008443
292 Ga0068867_100004942
293 Ga0068867_100011483
294 Ga0068867_100016984
295 Ga0070707_100208107
296 Ga0070707_100282810
297 Ga0070698_100089444
298 Ga0070698_100177438
299 Ga0070699_100079731
300 Ga0070699_100106000
301 Ga0070699_100278450
302 Ga0070679_100044641
303 Ga0070679_100102395
304 Ga0070697_100219298
305 Ga0070686_100006595
306 Ga0070686_100191434
307 Ga0070693_100018549
308 Ga0070665_100019140
309 Ga0070704_100130625
310 Ga0070704_100166586
311 Ga0068855_100008194
312 Ga0068855_100301630
313 Ga0068855_100388500
314 Ga0068856_100010295
315 Ga0068856_100133384
316 Ga0068859_100174228
317 Ga0068859_100191252
318 Ga0068864_100002159
319 Ga0068866_10027909
320 Ga0068861_100003326
321 Ga0068861_100134786
322 Ga0068861_100147796
323 Ga0068858_100018936
324 Ga0068862_100022476
325 Ga0081539_10000184
326 Ga0081539_10000268
327 Ga0081539_10002829
328 Ga0081539_10007146
329 Ga0070717_10166290
330 Ga0070716_100244711
331 Ga0070712_100005447
332 Ga0097621_100008766
333 Ga0097621_100012381
334 Ga0097621_100178048
335 Ga0068871_100002177
336 Ga0068871_100014001
337 Ga0075428_100086012
338 Ga0075430_100079054
339 Ga0075431_100114949
340 Ga0075433_10019286
341 Ga0075434_100000589
342 Ga0075434_100039505
343 Ga0075429_100023786
344 Ga0075429_100055405
345 Ga0068865_100016072
346 Ga0075436_100002635
347 Ga0075436_100005279
348 Ga0075436_100037764
349 Ga0075436_100051815
350 Ga0097620_100174226
351 Ga0097620_100191266
352 Ga0075435_100000014
353 Ga0075435_100000780
354 Ga0075435_100005241
355 Ga0075435_100008179
356 Ga0075435_100014734
357 Ga0075435_100127004
358 Ga0105240_10006183
359 Ga0105240_10173372
360 Ga0105240_10236308
361 Ga0111539_10017901
362 Ga0111539_10032151
363 Ga0105245_10159473
364 Ga0105245_10254555
365 Ga0105247_10056036
366 Ga0114129_10001288
367 Ga0114129_10008350
368 Ga0114129_10011111
369 Ga0114129_10039673
370 Ga0114129_10048615
371 Ga0114129_10081893
372 Ga0114129_10187791
373 Ga0105243_10127400
374 Ga0105241_10101809
375 Ga0105242_10015287
376 Ga0105242_10018054
377 Ga0105242_10018065
378 Ga0105248_10002669
379 Ga0105248_10036712
380 Ga0105248_10044867
381 Ga0105248_10066038
382 Ga0105248_10192755
383 Ga0105248_10228974
384 Ga0105248_10331713
385 Ga0105248_10526383
386 Ga0105238_10017586
387 Ga0105238_10116604
388 Ga0105249_10168039
389 Ga0105246_10091821
390 Ga0157374_10020939
391 Ga0163162_10057445
392 Ga0157372_10185908
393 Ga0163163_10001392
394 Ga0163163_10014053
395 Ga0163163_10016513
396 Ga0157377_10172448
397 Ga0157379_10013338
398 Ga0157379_10067681
399 Ga0157376_10123034
400 Ga0207710_10027815
401 Ga0207645_10003421
402 Ga0207654_10057765
403 Ga0207707_10011991
404 Ga0207707_10028191
405 Ga0207695_10023644
406 Ga0207695_10239333
407 Ga0207660_10227708
408 Ga0207662_10071465
409 Ga0207657_10005357
410 Ga0207657_10072226
411 Ga0207646_10108594
412 Ga0207681_10094723
413 Ga0207681_10204959
414 Ga0207694_10021541
415 Ga0207659_10004490
416 Ga0207659_10122346
417 Ga0207687_10172908
418 Ga0207644_10248179
419 Ga0207690_10098389
420 Ga0207686_10015890
421 Ga0207686_10035472
422 Ga0207686_10038521
423 Ga0207709_10091432
424 Ga0207704_10039076
425 Ga0207711_10040326
426 Ga0207711_10041471
427 Ga0207711_10046923
428 Ga0207711_10055051
429 Ga0207711_10321954
430 Ga0207661_10255315
431 Ga0207679_10149712
432 Ga0207667_10036289
433 Ga0207667_10245067
434 Ga0207712_10042923
435 Ga0207668_10017131
436 Ga0207668_10047406
437 Ga0207640_10012920
438 Ga0207640_10039038
439 Ga0207677_10023565
440 Ga0207677_10056136
441 Ga0207677_10137819
442 Ga0207703_10008831
443 Ga0207703_10286374
444 Ga0207708_10139252
445 Ga0207702_10015197
446 Ga0207648_10013259
447 Ga0207648_10018716
448 Ga0207676_10009767
449 Ga0207676_10336039
450 Ga0207675_100001872
451 Ga0207675_100062357
452 Ga0268266_10015565
453 Ga0268266_10015940
454 Ga0268265_10010699
455 Ga0307405_10155166
456 Ga0373950_0001638
457 Ga0373958_0000727
458 Ga0373938_0001046
459 Ga0373929_0003133
460 Ga0373951_0004740
461 Ga0373939_0000307
462 Ga0373941_0000487
463 Ga0373957_0059750
464 Ga0373955_0010044
465 Ga0373942_0000410
466 Ga0373961_0006019
467 Ga0373924_0059472
468 Ga0373931_0027393
469 Ga0373933_0138171
470 Ga0373925_0272462
471 Ga0451576_0007188
472 Ga0451576_0266193
473 Ga0495651_0236886
474 Ga0495653_0146363
475 Ga0495628_0060914
476 Ga0495630_0104897
477 Ga0495645_0004297
478 Ga0495634_0053081
479 Ga0495658_0118059
480 Ga0495669_0074702
481 Ga0495674_0045386
482 Ga0495684_0027318
483 Ga0496102_0164752
484 Ga0496102_0462067
485 Ga0496104_0065185
486 Ga0496108_0045208
487 Ga0496108_0119752
488 Ga0496109_0081372
489 Ga0496111_0122276
490 Ga0496112_0022221
491 Ga0496112_0199170
492 Ga0496113_0063429
493 Ga0496113_0255363
494 Ga0501067_0025536
495 Ga0501079_0206827
496 nmdc:mga05p37_18783_c1
497 nmdc:mga05p37_236946_c1
498 nmdc:mga05p37_2395_c1
499 nmdc:mga05p37_438708_c1
500 nmdc:mga05p37_9449_c1
501 nmdc:mga09592_112021_c1
502 nmdc:mga09592_8503_c1
503 nmdc:mga0qj67_14467_c1
504 nmdc:mga06r32_257964_c1
505 nmdc:mga0n895_275416_c1
506 nmdc:mga0n895_443_c1
507 nmdc:mga0n895_59328_c1
508 nmdc:mga0n895_87818_c1
509 nmdc:mga0rr50_134290_c1
510 nmdc:mga0rr50_2_c1
511 nmdc:mga0rr50_418_c1
512 nmdc:mga0rr50_86760_c1
513 nmdc:mga08x19_119_c1
514 nmdc:mga08x19_60512_c1
515 nmdc:mga0a205_25735_c1
516 Ga0495601_0193830
517 Ga0495619_0035159
518 Ga0495619_0175506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16822

ALGX

SGNH hydrolase-like domain, acetyltransferase AlgX

125

371

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v8e-assembly2.cif.gz_B structure of bacillus cereus patb1 0.7413 94 365
5v8d-assembly3.cif.gz_C structure of bacillus cereus patb1 with sulfonyl adduct 0.7247 91 365
5v8d-assembly4.cif.gz_D structure of bacillus cereus patb1 with sulfonyl adduct 0.7242 94 365
5v8d-assembly2.cif.gz_B structure of bacillus cereus patb1 with sulfonyl adduct 0.7107 94 365
5v8d-assembly1.cif.gz_A structure of bacillus cereus patb1 with sulfonyl adduct 0.6965 94 365
ID Description Score Start End Superfamily
1jowB02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7851 114 147 1.10.510.10
af_A0A1D6G8F8_6_199_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7279 109 147 1.10.510.10
1a9xD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5699 307 354 3.40.50.880
4ao6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5696 296 363 3.40.50.1820
af_A0A0P0XIW7_1_112_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.5289 116 204 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A2V8DAR4-F1-model_v4 AlgX/AlgJ SGNH hydrolase-like domain-containing protein 0.9605 161 373 GO:0042121
GO:0042597
AF-A0A843STF5-F1-model_v4 AlgX/AlgJ SGNH hydrolase-like domain-containing protein 0.9602 1 374 GO:0042121
GO:0042597
AF-A0A2V8DAR4-F1-model_v4 AlgX/AlgJ SGNH hydrolase-like domain-containing protein 0.9476 161 373 GO:0042121
GO:0042597
AF-A0A7W0G0A1-F1-model_v4 AlgX/AlgJ SGNH hydrolase-like domain-containing protein 0.9126 149 361 GO:0042121
GO:0042597
AF-A0A517DZL2-F1-model_v4 SGNH hydrolase-like domain, acetyltransferase AlgX 0.9086 93 362 GO:0016740
GO:0016787
GO:0042121
GO:0042597

Map