F368557

General Info

Members Datasets Scaffolds Average Seq Length
259 155 518 219

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100000004|Ga0070683_100000004100
Length 251
Sequence MRGLGRICRRGPSGIIFGVGMNVPNTLTILRIFFVPLLVAALVQEDVALRLGSVVFTKEWLALAIFLTAAGTDLLDGYLARRWKQVTTIGTLLDPIADKLLISAALISLVQVRALPGWMAILIIGREFAVSGLRSIAAVEGYTIKANDLGKTKMFFQVVAIACMLVSIRHSALLLPATVLMWIVVFFAILSAVSYFRKFWRKIDERIKLRRRRELLALERKRQKALRRQMGLSSGKEGLGAATMWKPPEVN

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 1.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 25.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000004 3300005329 Bacteria 373231
2 Ga0070676_10369047 3300005328 Unclassified 991
3 Ga0070670_100489295 3300005331 Unclassified 1093
4 Ga0070670_100869925 3300005331 Unclassified 816
5 Ga0070680_100035795 3300005336 Bacteria 4009
6 Ga0068868_100004313 3300005338 Bacteria 9964
7 Ga0070660_100002627 3300005339 Bacteria 12345
8 Ga0070689_100384204 3300005340 Bacteria 1184
9 Ga0070673_100128475 3300005364 Bacteria 2123
10 Ga0070688_100076769 3300005365 Unclassified 2151
11 Ga0070709_10141861 3300005434 Unclassified 1652
12 Ga0070709_10391825 3300005434 Bacteria 1035
13 Ga0070714_100238847 3300005435 Unclassified 1676
14 Ga0070713_100188221 3300005436 Bacteria 1858
15 Ga0070713_100277758 3300005436 Unclassified 1536
16 Ga0070711_100247488 3300005439 Unclassified 1397
17 Ga0070711_100248101 3300005439 Bacteria 1395
18 Ga0070681_10095117 3300005458 Bacteria 2928
19 Ga0070681_10101665 3300005458 Bacteria 2820
20 Ga0070706_100077980 3300005467 Bacteria 3067
21 Ga0070707_100000190 3300005468 Bacteria 61096
22 Ga0070707_100456019 3300005468 Unclassified 1239
23 Ga0070699_100014077 3300005518 Bacteria 6882
24 Ga0070679_100134108 3300005530 Bacteria 2457
25 Ga0070684_100000009 3300005535 Bacteria 209881
26 Ga0070684_100065014 3300005535 Unclassified 3201
27 Ga0070684_100263982 3300005535 Bacteria 1575
28 Ga0070684_100360903 3300005535 Bacteria 1337
29 Ga0070684_100956825 3300005535 Bacteria 803
30 Ga0070697_100638871 3300005536 Bacteria 937
31 Ga0068853_100109182 3300005539 Bacteria 2455
32 Ga0070696_100000202 3300005546 Bacteria 35448
33 Ga0070665_100073981 3300005548 Bacteria 3413
34 Ga0070665_100094780 3300005548 Bacteria 2989
35 Ga0070665_100639992 3300005548 Bacteria 1076
36 Ga0068855_100010327 3300005563 Bacteria 11261
37 Ga0068855_100206114 3300005563 Bacteria 2212
38 Ga0070664_100628605 3300005564 Bacteria 997
39 Ga0068857_100090341 3300005577 Bacteria 2741
40 Ga0068856_100032893 3300005614 Bacteria 5079
41 Ga0068856_100041130 3300005614 Bacteria 4541
42 Ga0068852_100085503 3300005616 Bacteria 2810
43 Ga0068852_100242799 3300005616 Bacteria 1722
44 Ga0068859_100492274 3300005617 Unclassified 1321
45 Ga0068864_100876012 3300005618 Bacteria 886
46 Ga0068863_100154169 3300005841 Bacteria 2199
47 Ga0068858_100009643 3300005842 Bacteria 9204
48 Ga0068860_100501234 3300005843 Bacteria 1212
49 Ga0068860_100644500 3300005843 Bacteria 1067
50 Ga0081539_10068249 3300005985 Unclassified 1919
51 Ga0070717_10342640 3300006028 Unclassified 1335
52 Ga0070717_10380347 3300006028 Bacteria 1266
53 Ga0070712_100565243 3300006175 Unclassified 959
54 Ga0097621_100049595 3300006237 Bacteria 3411
55 Ga0097621_100194565 3300006237 Bacteria 1758
56 Ga0097621_101027282 3300006237 Unclassified 772
57 Ga0068871_100036179 3300006358 Bacteria 3929
58 Ga0075431_100009338 3300006847 Bacteria 9845
59 Ga0097620_100265349 3300006931 Unclassified 1809
60 Ga0097620_100492284 3300006931 Unclassified 1321
61 Ga0075435_100511793 3300007076 Bacteria 1038
62 Ga0105240_10001199 3300009093 Bacteria 45226
63 Ga0105240_10018870 3300009093 Bacteria 9234
64 Ga0105240_10297215 3300009093 Bacteria 1848
65 Ga0105240_10477834 3300009093 Bacteria 1390
66 Ga0105240_10950582 3300009093 Bacteria 922
67 Ga0105240_10983383 3300009093 Bacteria 903
68 Ga0105245_10919223 3300009098 Bacteria 917
69 Ga0105245_11258416 3300009098 Bacteria 788
70 Ga0105243_10632256 3300009148 Bacteria 1035
71 Ga0105243_11227492 3300009148 Unclassified 764
72 Ga0105241_10008042 3300009174 Bacteria 7757
73 Ga0105241_10582665 3300009174 Unclassified 1008
74 Ga0105242_10171398 3300009176 Bacteria 1908
75 Ga0105242_11104880 3300009176 Bacteria 807
76 Ga0105248_10023213 3300009177 Bacteria 6889
77 Ga0105248_10034907 3300009177 Bacteria 5628
78 Ga0105248_10132842 3300009177 Bacteria 2808
79 Ga0105237_10042117 3300009545 Bacteria 4605
80 Ga0105237_10135951 3300009545 Bacteria 2452
81 Ga0105237_10415739 3300009545 Unclassified 1350
82 Ga0105237_10767313 3300009545 Unclassified 971
83 Ga0105238_10008531 3300009551 Bacteria 10257
84 Ga0105238_10077374 3300009551 Bacteria 3318
85 Ga0105238_10646452 3300009551 Unclassified 1067
86 Ga0105239_10004074 3300010375 Bacteria 17630
87 Ga0105239_10107360 3300010375 Unclassified 3093
88 Ga0105239_10784120 3300010375 Unclassified 1092
89 Ga0105239_10851666 3300010375 Bacteria 1045
90 Ga0157370_10042987 3300013104 Bacteria 4351
91 Ga0157369_10334730 3300013105 Bacteria 1573
92 Ga0157369_10405326 3300013105 Bacteria 1414
93 Ga0157369_10516147 3300013105 Bacteria 1236
94 Ga0157374_10287649 3300013296 Bacteria 1624
95 Ga0157374_10349105 3300013296 Bacteria 1470
96 Ga0157378_10238519 3300013297 Bacteria 1736
97 Ga0157378_10613648 3300013297 Bacteria 1100
98 Ga0163162_10884066 3300013306 Bacteria 1007
99 Ga0157372_10564259 3300013307 Bacteria 1327
100 Ga0157375_10049808 3300013308 Bacteria 4106
101 Ga0157375_10618632 3300013308 Bacteria 1241
102 Ga0163163_10026814 3300014325 Bacteria 5511
103 Ga0163163_10104639 3300014325 Unclassified 2856
104 Ga0163163_11254845 3300014325 Unclassified 803
105 Ga0157380_10862031 3300014326 Bacteria 928
106 Ga0157376_10295852 3300014969 Bacteria 1530
107 Ga0157376_10455583 3300014969 Unclassified 1249
108 Ga0213875_10030996 3300021388 Bacteria 2532
109 Ga0207692_10167222 3300025898 Unclassified 1272
110 Ga0207699_10016437 3300025906 Unclassified 3872
111 Ga0207699_10031232 3300025906 Bacteria 2989
112 Ga0207705_10026011 3300025909 Bacteria 4176
113 Ga0207654_10009545 3300025911 Bacteria 4931
114 Ga0207654_10390191 3300025911 Unclassified 966
115 Ga0207707_10075264 3300025912 Unclassified 2945
116 Ga0207707_10125409 3300025912 Bacteria 2245
117 Ga0207707_10137116 3300025912 Bacteria 2139
118 Ga0207695_10006075 3300025913 Bacteria 15761
119 Ga0207695_10006115 3300025913 Bacteria 15708
120 Ga0207671_10170911 3300025914 Unclassified 1688
121 Ga0207693_10503597 3300025915 Bacteria 945
122 Ga0207663_10135807 3300025916 Unclassified 1706
123 Ga0207660_10075352 3300025917 Bacteria 2465
124 Ga0207657_10000881 3300025919 Bacteria 31750
125 Ga0207657_10610710 3300025919 Unclassified 851
126 Ga0207652_10045324 3300025921 Bacteria 3749
127 Ga0207646_10000054 3300025922 Bacteria 160414
128 Ga0207694_10411507 3300025924 Bacteria 1125
129 Ga0207650_10434306 3300025925 Bacteria 1091
130 Ga0207650_10787241 3300025925 Unclassified 806
131 Ga0207687_10762432 3300025927 Unclassified 824
132 Ga0207700_10048428 3300025928 Unclassified 3156
133 Ga0207700_10204695 3300025928 Unclassified 1665
134 Ga0207700_10265090 3300025928 Bacteria 1472
135 Ga0207664_10258055 3300025929 Unclassified 1523
136 Ga0207644_10018911 3300025931 Bacteria 4670
137 Ga0207665_10128147 3300025939 Bacteria 1799
138 Ga0207711_10081094 3300025941 Bacteria 2834
139 Ga0207711_10334752 3300025941 Bacteria 1400
140 Ga0207689_10142486 3300025942 Bacteria 1975
141 Ga0207661_10000017 3300025944 Bacteria 289163
142 Ga0207667_10020011 3300025949 Bacteria 7456
143 Ga0207667_10027871 3300025949 Bacteria 6141
144 Ga0207667_10168842 3300025949 Bacteria 2249
145 Ga0207651_10055268 3300025960 Unclassified 2726
146 Ga0207703_10021714 3300026035 Bacteria 5025
147 Ga0207703_10308320 3300026035 Bacteria 1446
148 Ga0207639_10254827 3300026041 Bacteria 1532
149 Ga0207702_10027152 3300026078 Unclassified 4754
150 Ga0207702_10066362 3300026078 Bacteria 3092
151 Ga0207676_10199473 3300026095 Bacteria 1767
152 Ga0207676_10428006 3300026095 Bacteria 1243
153 Ga0207674_10003990 3300026116 Bacteria 17944
154 Ga0207683_10242697 3300026121 Unclassified 1643
155 Ga0207698_10314819 3300026142 Bacteria 1463
156 Ga0265357_1002029 3300028023 Bacteria 1597
157 Ga0268266_10189539 3300028379 Bacteria 1877
158 Ga0268266_10368490 3300028379 Unclassified 1353
159 Ga0268266_10413853 3300028379 Unclassified 1277
160 Ga0268264_10926692 3300028381 Unclassified 875
161 Ga0265323_10000235 3300028653 Bacteria 32680
162 Ga0265338_10004581 3300028800 Bacteria 18590
163 Ga0265324_10012655 3300029957 Unclassified 3176
164 Ga0265770_1004803 3300030878 Bacteria 1852
165 Ga0265765_1002735 3300030879 Bacteria 1729
166 Ga0265760_10018160 3300031090 Bacteria 2023
167 Ga0265325_10007487 3300031241 Bacteria 6529
168 Ga0265325_10013221 3300031241 Bacteria 4704
169 Ga0265325_10152219 3300031241 Unclassified 1093
170 Ga0265329_10005797 3300031242 Bacteria 4959
171 Ga0265329_10018906 3300031242 Bacteria 2349
172 Ga0265340_10008005 3300031247 Bacteria 5727
173 Ga0265331_10000918 3300031250 Bacteria 23615
174 Ga0265331_10224613 3300031250 Unclassified 844
175 Ga0265316_10003469 3300031344 Bacteria 15932
176 Ga0265316_10005281 3300031344 Bacteria 12602
177 Ga0265316_10058570 3300031344 Bacteria 2999
178 Ga0265316_10070203 3300031344 Unclassified 2702
179 Ga0307408_100575452 3300031548 Unclassified 997
180 Ga0265314_10009703 3300031711 Bacteria 8095
181 Ga0265314_10011930 3300031711 Bacteria 7133
182 Ga0373941_0054709 3300035115 Bacteria 1280
183 Ga0373953_0209185 3300035117 Unclassified 844
184 Ga0373955_0488006 3300035172 Bacteria 752
185 Ga0373931_0121547 3300035691 Unclassified 1493
186 Ga0373933_0012400 3300035724 Bacteria 4706
187 Ga0373933_0101147 3300035724 Bacteria 1788
188 Ga0373937_0000049 3300036401 Bacteria 106227
189 Ga0373937_0003693 3300036401 Bacteria 12930
190 Ga0373937_0413053 3300036401 Unclassified 1281
191 Ga0373925_0041378 3300037068 Unclassified 3416
192 Ga0373925_0586684 3300037068 Unclassified 918
193 Ga0373925_0688078 3300037068 Unclassified 843
194 Ga0436364_0676648 3300037853 Bacteria 2921
195 Ga0451577_0234643 3300042876 Unclassified 1659
196 Ga0451577_0454080 3300042876 Bacteria 1164
197 Ga0453683_0008774 3300044673 Bacteria 6775
198 Ga0453683_0010805 3300044673 Bacteria 6042
199 Ga0453683_0045673 3300044673 Unclassified 2746
200 Ga0453683_0401163 3300044673 Bacteria 884
201 Ga0453684_0176797 3300044712 Unclassified 2509
202 Ga0451576_0068930 3300045051 Bacteria 3681
203 Ga0451576_0224359 3300045051 Unclassified 1962
204 Ga0451576_0241080 3300045051 Bacteria 1889
205 Ga0495651_0001730 3300046462 Bacteria 16857
206 Ga0495651_0149986 3300046462 Bacteria 1682
207 Ga0495653_0116154 3300046463 Bacteria 1914
208 Ga0495580_0007304 3300046472 Bacteria 8883
209 Ga0495580_0045620 3300046472 Bacteria 3113
210 Ga0495580_0061806 3300046472 Bacteria 2629
211 Ga0495580_0216692 3300046472 Bacteria 1316
212 Ga0495662_0001528 3300046476 Bacteria 11497
213 Ga0495664_0004229 3300046477 Bacteria 7839
214 Ga0495594_0263810 3300046499 Unclassified 981
215 Ga0495608_0056650 3300046511 Bacteria 2588
216 Ga0495608_0219519 3300046511 Bacteria 1193
217 Ga0495628_0019781 3300046516 Bacteria 5561
218 Ga0495630_0002473 3300046517 Bacteria 12808
219 Ga0495652_0039123 3300046529 Bacteria 4102
220 Ga0495665_0057013 3300046531 Bacteria 2062
221 Ga0495640_0101057 3300046533 Unclassified 1893
222 Ga0495586_0042532 3300046535 Bacteria 2447
223 Ga0495587_0000181 3300046536 Bacteria 46248
224 Ga0495587_0030123 3300046536 Bacteria 3291
225 Ga0495645_0005211 3300046543 Bacteria 8907
226 Ga0495645_0068589 3300046543 Bacteria 2560
227 Ga0495667_0007070 3300046559 Bacteria 7617
228 Ga0495667_0034890 3300046559 Bacteria 3364
229 Ga0495667_0169293 3300046559 Bacteria 1404
230 Ga0495634_0079242 3300046642 Bacteria 2151
231 Ga0495635_0003735 3300046663 Bacteria 10563
232 Ga0495657_0083002 3300046675 Bacteria 2069
233 Ga0495623_0020817 3300046679 Bacteria 4239
234 Ga0495646_0032772 3300046680 Bacteria 3232
235 Ga0495600_0057949 3300046809 Bacteria 2530
236 Ga0495604_0023812 3300047317 Bacteria 4886
237 Ga0495604_0083903 3300047317 Bacteria 2380
238 Ga0495604_0179753 3300047317 Unclassified 1481
239 Ga0495604_0328351 3300047317 Bacteria 1021
240 Ga0495674_0015513 3300047319 Bacteria 7118
241 Ga0495674_0023886 3300047319 Bacteria 5627
242 Ga0495674_0044999 3300047319 Bacteria 3921
243 Ga0495674_0218970 3300047319 Bacteria 1574
244 Ga0495674_0822840 3300047319 Unclassified 721
245 Ga0495680_0005715 3300047322 Bacteria 11645
246 Ga0495675_0025298 3300047444 Bacteria 3785
247 Ga0495675_0042330 3300047444 Bacteria 2901
248 Ga0495684_0012853 3300047471 Bacteria 6462
249 Ga0495684_0013679 3300047471 Bacteria 6249
250 Ga0495684_0085094 3300047471 Bacteria 2398
251 Ga0495602_0002206 3300048088 Bacteria 19670
252 Ga0495602_0054589 3300048088 Bacteria 3526
253 Ga0501249_034552 3300049679 Unclassified 1134
254 nmdc:mga05p37_865053_c1 3300050507 Bacteria 980
255 nmdc:mga06r32_254430_c1 3300050510 Unclassified 1744
256 nmdc:mga08x19_1203_c1 3300050514 Bacteria 16167
257 nmdc:mga08x19_279508_c1 3300050514 Bacteria 1156
258 Ga0495601_0242901 3300053077 Bacteria 1175
259 Ga0501082_0001212 3300060353 Bacteria 22668
260 Ga0070683_100000004
261 Ga0070676_10369047
262 Ga0070670_100489295
263 Ga0070670_100869925
264 Ga0070680_100035795
265 Ga0068868_100004313
266 Ga0070660_100002627
267 Ga0070689_100384204
268 Ga0070673_100128475
269 Ga0070688_100076769
270 Ga0070709_10141861
271 Ga0070709_10391825
272 Ga0070714_100238847
273 Ga0070713_100188221
274 Ga0070713_100277758
275 Ga0070711_100247488
276 Ga0070711_100248101
277 Ga0070681_10095117
278 Ga0070681_10101665
279 Ga0070706_100077980
280 Ga0070707_100000190
281 Ga0070707_100456019
282 Ga0070699_100014077
283 Ga0070679_100134108
284 Ga0070684_100000009
285 Ga0070684_100065014
286 Ga0070684_100263982
287 Ga0070684_100360903
288 Ga0070684_100956825
289 Ga0070697_100638871
290 Ga0068853_100109182
291 Ga0070696_100000202
292 Ga0070665_100073981
293 Ga0070665_100094780
294 Ga0070665_100639992
295 Ga0068855_100010327
296 Ga0068855_100206114
297 Ga0070664_100628605
298 Ga0068857_100090341
299 Ga0068856_100032893
300 Ga0068856_100041130
301 Ga0068852_100085503
302 Ga0068852_100242799
303 Ga0068859_100492274
304 Ga0068864_100876012
305 Ga0068863_100154169
306 Ga0068858_100009643
307 Ga0068860_100501234
308 Ga0068860_100644500
309 Ga0081539_10068249
310 Ga0070717_10342640
311 Ga0070717_10380347
312 Ga0070712_100565243
313 Ga0097621_100049595
314 Ga0097621_100194565
315 Ga0097621_101027282
316 Ga0068871_100036179
317 Ga0075431_100009338
318 Ga0097620_100265349
319 Ga0097620_100492284
320 Ga0075435_100511793
321 Ga0105240_10001199
322 Ga0105240_10018870
323 Ga0105240_10297215
324 Ga0105240_10477834
325 Ga0105240_10950582
326 Ga0105240_10983383
327 Ga0105245_10919223
328 Ga0105245_11258416
329 Ga0105243_10632256
330 Ga0105243_11227492
331 Ga0105241_10008042
332 Ga0105241_10582665
333 Ga0105242_10171398
334 Ga0105242_11104880
335 Ga0105248_10023213
336 Ga0105248_10034907
337 Ga0105248_10132842
338 Ga0105237_10042117
339 Ga0105237_10135951
340 Ga0105237_10415739
341 Ga0105237_10767313
342 Ga0105238_10008531
343 Ga0105238_10077374
344 Ga0105238_10646452
345 Ga0105239_10004074
346 Ga0105239_10107360
347 Ga0105239_10784120
348 Ga0105239_10851666
349 Ga0157370_10042987
350 Ga0157369_10334730
351 Ga0157369_10405326
352 Ga0157369_10516147
353 Ga0157374_10287649
354 Ga0157374_10349105
355 Ga0157378_10238519
356 Ga0157378_10613648
357 Ga0163162_10884066
358 Ga0157372_10564259
359 Ga0157375_10049808
360 Ga0157375_10618632
361 Ga0163163_10026814
362 Ga0163163_10104639
363 Ga0163163_11254845
364 Ga0157380_10862031
365 Ga0157376_10295852
366 Ga0157376_10455583
367 Ga0213875_10030996
368 Ga0207692_10167222
369 Ga0207699_10016437
370 Ga0207699_10031232
371 Ga0207705_10026011
372 Ga0207654_10009545
373 Ga0207654_10390191
374 Ga0207707_10075264
375 Ga0207707_10125409
376 Ga0207707_10137116
377 Ga0207695_10006075
378 Ga0207695_10006115
379 Ga0207671_10170911
380 Ga0207693_10503597
381 Ga0207663_10135807
382 Ga0207660_10075352
383 Ga0207657_10000881
384 Ga0207657_10610710
385 Ga0207652_10045324
386 Ga0207646_10000054
387 Ga0207694_10411507
388 Ga0207650_10434306
389 Ga0207650_10787241
390 Ga0207687_10762432
391 Ga0207700_10048428
392 Ga0207700_10204695
393 Ga0207700_10265090
394 Ga0207664_10258055
395 Ga0207644_10018911
396 Ga0207665_10128147
397 Ga0207711_10081094
398 Ga0207711_10334752
399 Ga0207689_10142486
400 Ga0207661_10000017
401 Ga0207667_10020011
402 Ga0207667_10027871
403 Ga0207667_10168842
404 Ga0207651_10055268
405 Ga0207703_10021714
406 Ga0207703_10308320
407 Ga0207639_10254827
408 Ga0207702_10027152
409 Ga0207702_10066362
410 Ga0207676_10199473
411 Ga0207676_10428006
412 Ga0207674_10003990
413 Ga0207683_10242697
414 Ga0207698_10314819
415 Ga0265357_1002029
416 Ga0268266_10189539
417 Ga0268266_10368490
418 Ga0268266_10413853
419 Ga0268264_10926692
420 Ga0265323_10000235
421 Ga0265338_10004581
422 Ga0265324_10012655
423 Ga0265770_1004803
424 Ga0265765_1002735
425 Ga0265760_10018160
426 Ga0265325_10007487
427 Ga0265325_10013221
428 Ga0265325_10152219
429 Ga0265329_10005797
430 Ga0265329_10018906
431 Ga0265340_10008005
432 Ga0265331_10000918
433 Ga0265331_10224613
434 Ga0265316_10003469
435 Ga0265316_10005281
436 Ga0265316_10058570
437 Ga0265316_10070203
438 Ga0307408_100575452
439 Ga0265314_10009703
440 Ga0265314_10011930
441 Ga0373941_0054709
442 Ga0373953_0209185
443 Ga0373955_0488006
444 Ga0373931_0121547
445 Ga0373933_0012400
446 Ga0373933_0101147
447 Ga0373937_0000049
448 Ga0373937_0003693
449 Ga0373937_0413053
450 Ga0373925_0041378
451 Ga0373925_0586684
452 Ga0373925_0688078
453 Ga0436364_0676648
454 Ga0451577_0234643
455 Ga0451577_0454080
456 Ga0453683_0008774
457 Ga0453683_0010805
458 Ga0453683_0045673
459 Ga0453683_0401163
460 Ga0453684_0176797
461 Ga0451576_0068930
462 Ga0451576_0224359
463 Ga0451576_0241080
464 Ga0495651_0001730
465 Ga0495651_0149986
466 Ga0495653_0116154
467 Ga0495580_0007304
468 Ga0495580_0045620
469 Ga0495580_0061806
470 Ga0495580_0216692
471 Ga0495662_0001528
472 Ga0495664_0004229
473 Ga0495594_0263810
474 Ga0495608_0056650
475 Ga0495608_0219519
476 Ga0495628_0019781
477 Ga0495630_0002473
478 Ga0495652_0039123
479 Ga0495665_0057013
480 Ga0495640_0101057
481 Ga0495586_0042532
482 Ga0495587_0000181
483 Ga0495587_0030123
484 Ga0495645_0005211
485 Ga0495645_0068589
486 Ga0495667_0007070
487 Ga0495667_0034890
488 Ga0495667_0169293
489 Ga0495634_0079242
490 Ga0495635_0003735
491 Ga0495657_0083002
492 Ga0495623_0020817
493 Ga0495646_0032772
494 Ga0495600_0057949
495 Ga0495604_0023812
496 Ga0495604_0083903
497 Ga0495604_0179753
498 Ga0495604_0328351
499 Ga0495674_0015513
500 Ga0495674_0023886
501 Ga0495674_0044999
502 Ga0495674_0218970
503 Ga0495674_0822840
504 Ga0495680_0005715
505 Ga0495675_0025298
506 Ga0495675_0042330
507 Ga0495684_0012853
508 Ga0495684_0013679
509 Ga0495684_0085094
510 Ga0495602_0002206
511 Ga0495602_0054589
512 Ga0501249_034552
513 nmdc:mga05p37_865053_c1
514 nmdc:mga06r32_254430_c1
515 nmdc:mga08x19_1203_c1
516 nmdc:mga08x19_279508_c1
517 Ga0495601_0242901
518 Ga0501082_0001212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

21

190

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.8307 1 178
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7977 1 178
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7421 4 187
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7352 4 187
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.7079 1 178
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.935 2 183 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9025 1 177 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8903 2 183 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8683 1 177 1.20.120.1760
af_Q2FZ11_2_191_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8601 2 185 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2V7YR78-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9738 1 181 GO:0005886
GO:0008444
GO:0046474
AF-A0A2V7XJ66-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9734 1 188 GO:0005886
GO:0008444
GO:0046474
AF-A0A7V5YS63-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9679 1 157 GO:0005886
GO:0008444
GO:0046474
AF-A0A2G9PP09-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9673 1 181 GO:0005886
GO:0008444
GO:0046474
AF-A0A535HSS4-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9656 1 183 GO:0005886
GO:0008444
GO:0046474

Map