F368339

General Info

Members Datasets Scaffolds Average Seq Length
258 181 516 257

Family's Representative Sequence

Representative Sequence 3300046526|Ga0495666_0202121|Ga0495666_0202121_93_884
Length 263
Sequence VSGVGRGDEEDAGVSDVRYALISDIHANLPALDAVLRDIDERSDTDVVYHLGDLVGYAPWPNEVVRRLRDAGIEGISGNYDSTVATDYKHCGCRYEDPRQEELSHVSYAWTRANVSADTKAFLGHTASPTLVLVHGTPVNNVTYWTEDRSDEFCAKMGQAAGVRAGDVIAFGHTHLPWHRVVDGVHFVNTGSVGRPKDGDWRAGYVRLEFDATGARVEFRRVEYDIERASSAILASTLPDEFASYLRTGGTPPIVATADRSRS

Samples

Sample ID Description Type Environment
1 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.1
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495666_0202121 3300046526 Unclassified 913
2 MBSR1b_contig_2588999 2162886012 Unclassified 1127
3 Ga0065715_10092361 3300005293 Bacteria 5164
4 Ga0070676_10024909 3300005328 Bacteria 3376
5 Ga0070683_100057649 3300005329 Bacteria 3608
6 Ga0070683_100063725 3300005329 Bacteria 3430
7 Ga0070683_100109290 3300005329 Bacteria 2608
8 Ga0070680_100008141 3300005336 Bacteria 8009
9 Ga0070680_100247521 3300005336 Unclassified 1507
10 Ga0070682_100001821 3300005337 Bacteria 11871
11 Ga0070682_100045149 3300005337 Bacteria 2730
12 Ga0068868_100047703 3300005338 Bacteria 3358
13 Ga0070689_100003668 3300005340 Bacteria 10246
14 Ga0070669_100003938 3300005353 Bacteria 10741
15 Ga0070675_100005186 3300005354 Bacteria 9935
16 Ga0070675_100213625 3300005354 Bacteria 1678
17 Ga0070671_100346723 3300005355 Bacteria 1267
18 Ga0070673_100188671 3300005364 Bacteria 1769
19 Ga0070667_100044925 3300005367 Bacteria 3713
20 Ga0070709_10014941 3300005434 Bacteria 4405
21 Ga0070709_10014985 3300005434 Bacteria 4401
22 Ga0070714_100004304 3300005435 Bacteria 10732
23 Ga0070714_100020126 3300005435 Bacteria 5445
24 Ga0070714_100103456 3300005435 Bacteria 2512
25 Ga0070713_100195190 3300005436 Unclassified 1826
26 Ga0070713_100351579 3300005436 Bacteria 1367
27 Ga0070701_10256914 3300005438 Unclassified 1057
28 Ga0070711_100123580 3300005439 Bacteria 1918
29 Ga0070708_100000091 3300005445 Bacteria 59200
30 Ga0070708_100000725 3300005445 Bacteria 25019
31 Ga0070662_100101623 3300005457 Bacteria 2177
32 Ga0070662_100432863 3300005457 Bacteria 1090
33 Ga0070681_10008168 3300005458 Bacteria 10246
34 Ga0070681_10094785 3300005458 Bacteria 2933
35 Ga0070681_10145054 3300005458 Bacteria 2303
36 Ga0070681_10424967 3300005458 Bacteria 1241
37 Ga0070707_100001150 3300005468 Bacteria 25996
38 Ga0070707_100425273 3300005468 Bacteria 1289
39 Ga0070699_100368020 3300005518 Unclassified 1296
40 Ga0070679_100512412 3300005530 Bacteria 1143
41 Ga0070684_100037488 3300005535 Unclassified 4158
42 Ga0070684_100045651 3300005535 Bacteria 3794
43 Ga0070697_100112915 3300005536 Unclassified 2266
44 Ga0068853_100008710 3300005539 Bacteria 8162
45 Ga0070695_100002105 3300005545 Bacteria 11389
46 Ga0070695_100222175 3300005545 Unclassified 1361
47 Ga0070696_100122658 3300005546 Bacteria 1882
48 Ga0070693_100041195 3300005547 Bacteria 2597
49 Ga0070693_100402812 3300005547 Bacteria 949
50 Ga0068855_100008967 3300005563 Bacteria 12089
51 Ga0068855_100031379 3300005563 Bacteria 6345
52 Ga0070664_100027038 3300005564 Bacteria 4765
53 Ga0070664_100103121 3300005564 Bacteria 2483
54 Ga0068856_100186897 3300005614 Unclassified 2086
55 Ga0070702_100210559 3300005615 Bacteria 1293
56 Ga0068859_100328992 3300005617 Bacteria 1622
57 Ga0068862_100104522 3300005844 Bacteria 2481
58 Ga0070716_100023165 3300006173 Bacteria 3289
59 Ga0070712_100255168 3300006175 Bacteria 1403
60 Ga0075434_100037088 3300006871 Bacteria 4825
61 Ga0075436_100002504 3300006914 Bacteria 12631
62 Ga0097620_100328999 3300006931 Bacteria 1622
63 Ga0075435_100095775 3300007076 Bacteria 2455
64 Ga0075435_100169699 3300007076 Bacteria 1840
65 Ga0105240_10010260 3300009093 Bacteria 13186
66 Ga0105245_10022237 3300009098 Bacteria 5566
67 Ga0105245_10078998 3300009098 Bacteria 3003
68 Ga0105245_10101535 3300009098 Bacteria 2663
69 Ga0105247_10176826 3300009101 Bacteria 1422
70 Ga0105241_10549192 3300009174 Bacteria 1037
71 Ga0105237_10185741 3300009545 Unclassified 2079
72 Ga0105238_10054907 3300009551 Bacteria 4000
73 Ga0105249_10174854 3300009553 Bacteria 2085
74 Ga0105239_10169418 3300010375 Bacteria 2442
75 Ga0105246_10286003 3300011119 Bacteria 1325
76 Ga0157370_10000240 3300013104 Bacteria 69901
77 Ga0157370_10080761 3300013104 Bacteria 3061
78 Ga0157378_10021000 3300013297 Bacteria 5745
79 Ga0157378_10063156 3300013297 Bacteria 3309
80 Ga0157372_10009940 3300013307 Bacteria 10119
81 Ga0157372_10044049 3300013307 Bacteria 4944
82 Ga0157375_10013037 3300013308 Bacteria 7387
83 Ga0163163_10409281 3300014325 Bacteria 1415
84 Ga0157380_10432537 3300014326 Bacteria 1258
85 Ga0157377_10043656 3300014745 Bacteria 2496
86 Ga0207697_10063278 3300025315 Bacteria 1542
87 Ga0207682_10108756 3300025893 Bacteria 1219
88 Ga0207710_10212168 3300025900 Bacteria 959
89 Ga0207699_10015108 3300025906 Bacteria 4004
90 Ga0207699_10078577 3300025906 Bacteria 2038
91 Ga0207684_10032252 3300025910 Bacteria 4455
92 Ga0207684_10255823 3300025910 Bacteria 1511
93 Ga0207707_10003622 3300025912 Bacteria 13697
94 Ga0207707_10407417 3300025912 Bacteria 1167
95 Ga0207671_10531763 3300025914 Unclassified 937
96 Ga0207693_10343410 3300025915 Bacteria 1168
97 Ga0207663_10087163 3300025916 Bacteria 2061
98 Ga0207663_10243168 3300025916 Bacteria 1321
99 Ga0207660_10056273 3300025917 Bacteria 2814
100 Ga0207662_10002580 3300025918 Bacteria 9133
101 Ga0207652_10103404 3300025921 Bacteria 2518
102 Ga0207646_10000213 3300025922 Bacteria 79744
103 Ga0207646_10445370 3300025922 Bacteria 1169
104 Ga0207681_10153092 3300025923 Bacteria 1730
105 Ga0207694_10327836 3300025924 Bacteria 1264
106 Ga0207659_10153071 3300025926 Bacteria 1802
107 Ga0207687_10229821 3300025927 Bacteria 1465
108 Ga0207687_10315203 3300025927 Unclassified 1264
109 Ga0207700_10088978 3300025928 Unclassified 2433
110 Ga0207664_10002315 3300025929 Bacteria 12577
111 Ga0207664_10415059 3300025929 Bacteria 1198
112 Ga0207644_10125585 3300025931 Bacteria 1958
113 Ga0207644_10414973 3300025931 Bacteria 1102
114 Ga0207670_10144401 3300025936 Bacteria 1758
115 Ga0207669_10115272 3300025937 Bacteria 1811
116 Ga0207665_10010807 3300025939 Bacteria 5992
117 Ga0207691_10002420 3300025940 Bacteria 18265
118 Ga0207661_10036306 3300025944 Bacteria 3846
119 Ga0207661_10043656 3300025944 Bacteria 3539
120 Ga0207679_10078176 3300025945 Bacteria 2520
121 Ga0207679_10083109 3300025945 Bacteria 2453
122 Ga0207658_10049679 3300025986 Bacteria 3083
123 Ga0207677_10086965 3300026023 Bacteria 2261
124 Ga0207703_10190848 3300026035 Bacteria 1814
125 Ga0207703_10313967 3300026035 Bacteria 1433
126 Ga0207676_10539829 3300026095 Bacteria 1113
127 Ga0207674_10003605 3300026116 Bacteria 18878
128 Ga0207683_10555956 3300026121 Archaea 1061
129 Ga0209995_1018053 3300027471 Unclassified 1162
130 Ga0268265_10109110 3300028380 Bacteria 2255
131 Ga0307405_10026299 3300031731 Bacteria 3355
132 Ga0307413_10064642 3300031824 Bacteria 2274
133 Ga0307413_10074927 3300031824 Bacteria 2146
134 Ga0307413_10203329 3300031824 Bacteria 1432
135 Ga0307410_10119466 3300031852 Bacteria 1920
136 Ga0307410_10383404 3300031852 Bacteria 1131
137 Ga0307412_10135862 3300031911 Bacteria 1794
138 Ga0307412_10167071 3300031911 Bacteria 1641
139 Ga0307409_100000942 3300031995 Bacteria 13550
140 Ga0307409_100047272 3300031995 Bacteria 3265
141 Ga0307409_100546228 3300031995 Bacteria 1136
142 Ga0307416_100139816 3300032002 Bacteria 2198
143 Ga0307416_100532214 3300032002 Bacteria 1245
144 Ga0307416_101252938 3300032002 Bacteria 847
145 Ga0307414_10104182 3300032004 Bacteria 2142
146 Ga0307414_10135236 3300032004 Bacteria 1921
147 Ga0307415_100400153 3300032126 Bacteria 1172
148 Ga0373954_0084713 3300035118 Bacteria 1517
149 Ga0373943_0058839 3300035170 Bacteria 1914
150 Ga0373955_0028404 3300035172 Bacteria 2899
151 Ga0373942_0075004 3300035207 Unclassified 995
152 Ga0373935_0179672 3300035692 Unclassified 1452
153 Ga0373927_0024526 3300035695 Bacteria 3943
154 Ga0373927_0247868 3300035695 Bacteria 1171
155 Ga0373933_0038424 3300035724 Bacteria 2812
156 Ga0373947_0078532 3300035725 Unclassified 2038
157 Ga0373937_0007446 3300036401 Bacteria 9472
158 Ga0373925_0070612 3300037068 Bacteria 2640
159 Ga0439461_0017393 3300041410 Bacteria 1397
160 Ga0451577_0029490 3300042876 Bacteria 4959
161 Ga0451576_0282395 3300045051 Bacteria 1736
162 Ga0451576_0418653 3300045051 Archaea 1405
163 Ga0495629_0008894 3300046459 Bacteria 7387
164 Ga0495629_0118481 3300046459 Bacteria 1845
165 Ga0495651_0041101 3300046462 Bacteria 3592
166 Ga0495653_0048402 3300046463 Bacteria 3282
167 Ga0495580_0013732 3300046472 Bacteria 6168
168 Ga0495580_0059273 3300046472 Bacteria 2690
169 Ga0495582_0018233 3300046473 Bacteria 3841
170 Ga0495582_0021320 3300046473 Bacteria 3547
171 Ga0495639_0007161 3300046475 Bacteria 4788
172 Ga0495639_0026214 3300046475 Bacteria 2575
173 Ga0495664_0007071 3300046477 Bacteria 6218
174 Ga0495594_0009235 3300046499 Bacteria 5090
175 Ga0495594_0021924 3300046499 Bacteria 3413
176 Ga0495596_0016055 3300046500 Bacteria 3117
177 Ga0495628_0181018 3300046516 Bacteria 1594
178 Ga0495628_0251273 3300046516 Unclassified 1320
179 Ga0495630_0033971 3300046517 Bacteria 3805
180 Ga0495652_0099483 3300046529 Unclassified 2361
181 Ga0495665_0009443 3300046531 Bacteria 5280
182 Ga0495665_0021461 3300046531 Bacteria 3469
183 Ga0495665_0032246 3300046531 Bacteria 2803
184 Ga0495586_0061089 3300046535 Bacteria 2050
185 Ga0495586_0233135 3300046535 Bacteria 1048
186 Ga0495587_0001106 3300046536 Bacteria 17722
187 Ga0495587_0011623 3300046536 Bacteria 5573
188 Ga0495621_0002960 3300046539 Bacteria 4629
189 Ga0495645_0002106 3300046543 Bacteria 13501
190 Ga0495645_0045494 3300046543 Bacteria 3202
191 Ga0495667_0007961 3300046559 Bacteria 7187
192 Ga0495667_0059543 3300046559 Bacteria 2506
193 Ga0495667_0103627 3300046559 Bacteria 1840
194 Ga0495667_0231685 3300046559 Bacteria 1177
195 Ga0495635_0084348 3300046663 Unclassified 2174
196 Ga0495657_0034850 3300046675 Bacteria 3493
197 Ga0495599_0090129 3300046678 Bacteria 1913
198 Ga0495658_0037920 3300046683 Bacteria 2666
199 Ga0495600_0158118 3300046809 Bacteria 1466
200 Ga0495600_0211222 3300046809 Bacteria 1244
201 Ga0495581_0025669 3300047315 Bacteria 3416
202 Ga0495581_0118008 3300047315 Bacteria 1543
203 Ga0495604_0039626 3300047317 Bacteria 3702
204 Ga0495674_0086668 3300047319 Bacteria 2681
205 Ga0495674_0087899 3300047319 Bacteria 2659
206 Ga0495674_0428750 3300047319 Bacteria 1065
207 Ga0495680_0257903 3300047322 Unclassified 1234
208 Ga0495675_0001418 3300047444 Bacteria 14526
209 Ga0495675_0029361 3300047444 Bacteria 3507
210 Ga0495675_0121067 3300047444 Bacteria 1630
211 Ga0495685_007154 3300047447 Bacteria 3678
212 Ga0495684_0071969 3300047471 Bacteria 2627
213 Ga0495593_0193788 3300047673 Unclassified 1022
214 Ga0495602_0108324 3300048088 Bacteria 2262
215 Ga0495614_0184145 3300048089 Unclassified 940
216 Ga0496104_0138348 3300048907 Bacteria 2340
217 Ga0496106_0043263 3300048909 Bacteria 3379
218 Ga0496108_0004917 3300048911 Bacteria 10796
219 Ga0496109_0068978 3300048912 Bacteria 3241
220 Ga0496110_0472093 3300048913 Bacteria 1143
221 Ga0496112_0000747 3300048915 Bacteria 22703
222 Ga0496112_0010539 3300048915 Bacteria 8392
223 Ga0496113_0005892 3300048916 Bacteria 7694
224 Ga0501031_0125088 3300049568 Unclassified 1680
225 Ga0501032_0001251 3300049569 Bacteria 20388
226 Ga0501033_0026376 3300049570 Bacteria 4374
227 Ga0501034_0012836 3300049571 Bacteria 8639
228 Ga0501036_0040881 3300049572 Bacteria 3923
229 Ga0501037_0009403 3300049573 Bacteria 7173
230 Ga0501039_0114593 3300049575 Unclassified 2109
231 Ga0501040_0036192 3300049576 Bacteria 3348
232 Ga0501042_0026498 3300049578 Bacteria 4073
233 Ga0501046_0014866 3300049580 Bacteria 6553
234 Ga0501047_0027999 3300049581 Bacteria 5430
235 Ga0501048_0075255 3300049582 Bacteria 2382
236 Ga0501048_0415857 3300049582 Unclassified 962
237 Ga0501068_0231139 3300049584 Bacteria 1176
238 Ga0501070_0025184 3300049586 Bacteria 4990
239 Ga0501070_0201182 3300049586 Bacteria 1636
240 Ga0501070_0456611 3300049586 Unclassified 1030
241 Ga0501072_0069765 3300049588 Bacteria 2775
242 Ga0501073_0192253 3300049589 Bacteria 1412
243 Ga0501076_0069115 3300049592 Bacteria 2822
244 Ga0501076_0170820 3300049592 Unclassified 1772
245 Ga0501076_0228280 3300049592 Bacteria 1522
246 Ga0501076_0322417 3300049592 Bacteria 1267
247 Ga0501249_002648 3300049679 Bacteria 3607
248 Ga0501079_0007993 3300049741 Bacteria 8017
249 Ga0501080_0262429 3300049742 Bacteria 1573
250 Ga0501035_0000489 3300049822 Bacteria 44518
251 Ga0501044_0235111 3300049823 Bacteria 1778
252 nmdc:mga0n895_234863_c1 3300050512 Archaea 1861
253 nmdc:mga08x19_63999_c1 3300050514 Bacteria 2387
254 Ga0495601_0061809 3300053077 Bacteria 2378
255 Ga0501084_0106544 3300054114 Bacteria 2355
256 Ga0501084_0401270 3300054114 Unclassified 1159
257 Ga0501082_0060606 3300060353 Unclassified 3258
258 Ga0501082_0107204 3300060353 Bacteria 2417
259 Ga0495666_0202121
260 MBSR1b_contig_2588999
261 Ga0065715_10092361
262 Ga0070676_10024909
263 Ga0070683_100057649
264 Ga0070683_100063725
265 Ga0070683_100109290
266 Ga0070680_100008141
267 Ga0070680_100247521
268 Ga0070682_100001821
269 Ga0070682_100045149
270 Ga0068868_100047703
271 Ga0070689_100003668
272 Ga0070669_100003938
273 Ga0070675_100005186
274 Ga0070675_100213625
275 Ga0070671_100346723
276 Ga0070673_100188671
277 Ga0070667_100044925
278 Ga0070709_10014941
279 Ga0070709_10014985
280 Ga0070714_100004304
281 Ga0070714_100020126
282 Ga0070714_100103456
283 Ga0070713_100195190
284 Ga0070713_100351579
285 Ga0070701_10256914
286 Ga0070711_100123580
287 Ga0070708_100000091
288 Ga0070708_100000725
289 Ga0070662_100101623
290 Ga0070662_100432863
291 Ga0070681_10008168
292 Ga0070681_10094785
293 Ga0070681_10145054
294 Ga0070681_10424967
295 Ga0070707_100001150
296 Ga0070707_100425273
297 Ga0070699_100368020
298 Ga0070679_100512412
299 Ga0070684_100037488
300 Ga0070684_100045651
301 Ga0070697_100112915
302 Ga0068853_100008710
303 Ga0070695_100002105
304 Ga0070695_100222175
305 Ga0070696_100122658
306 Ga0070693_100041195
307 Ga0070693_100402812
308 Ga0068855_100008967
309 Ga0068855_100031379
310 Ga0070664_100027038
311 Ga0070664_100103121
312 Ga0068856_100186897
313 Ga0070702_100210559
314 Ga0068859_100328992
315 Ga0068862_100104522
316 Ga0070716_100023165
317 Ga0070712_100255168
318 Ga0075434_100037088
319 Ga0075436_100002504
320 Ga0097620_100328999
321 Ga0075435_100095775
322 Ga0075435_100169699
323 Ga0105240_10010260
324 Ga0105245_10022237
325 Ga0105245_10078998
326 Ga0105245_10101535
327 Ga0105247_10176826
328 Ga0105241_10549192
329 Ga0105237_10185741
330 Ga0105238_10054907
331 Ga0105249_10174854
332 Ga0105239_10169418
333 Ga0105246_10286003
334 Ga0157370_10000240
335 Ga0157370_10080761
336 Ga0157378_10021000
337 Ga0157378_10063156
338 Ga0157372_10009940
339 Ga0157372_10044049
340 Ga0157375_10013037
341 Ga0163163_10409281
342 Ga0157380_10432537
343 Ga0157377_10043656
344 Ga0207697_10063278
345 Ga0207682_10108756
346 Ga0207710_10212168
347 Ga0207699_10015108
348 Ga0207699_10078577
349 Ga0207684_10032252
350 Ga0207684_10255823
351 Ga0207707_10003622
352 Ga0207707_10407417
353 Ga0207671_10531763
354 Ga0207693_10343410
355 Ga0207663_10087163
356 Ga0207663_10243168
357 Ga0207660_10056273
358 Ga0207662_10002580
359 Ga0207652_10103404
360 Ga0207646_10000213
361 Ga0207646_10445370
362 Ga0207681_10153092
363 Ga0207694_10327836
364 Ga0207659_10153071
365 Ga0207687_10229821
366 Ga0207687_10315203
367 Ga0207700_10088978
368 Ga0207664_10002315
369 Ga0207664_10415059
370 Ga0207644_10125585
371 Ga0207644_10414973
372 Ga0207670_10144401
373 Ga0207669_10115272
374 Ga0207665_10010807
375 Ga0207691_10002420
376 Ga0207661_10036306
377 Ga0207661_10043656
378 Ga0207679_10078176
379 Ga0207679_10083109
380 Ga0207658_10049679
381 Ga0207677_10086965
382 Ga0207703_10190848
383 Ga0207703_10313967
384 Ga0207676_10539829
385 Ga0207674_10003605
386 Ga0207683_10555956
387 Ga0209995_1018053
388 Ga0268265_10109110
389 Ga0307405_10026299
390 Ga0307413_10064642
391 Ga0307413_10074927
392 Ga0307413_10203329
393 Ga0307410_10119466
394 Ga0307410_10383404
395 Ga0307412_10135862
396 Ga0307412_10167071
397 Ga0307409_100000942
398 Ga0307409_100047272
399 Ga0307409_100546228
400 Ga0307416_100139816
401 Ga0307416_100532214
402 Ga0307416_101252938
403 Ga0307414_10104182
404 Ga0307414_10135236
405 Ga0307415_100400153
406 Ga0373954_0084713
407 Ga0373943_0058839
408 Ga0373955_0028404
409 Ga0373942_0075004
410 Ga0373935_0179672
411 Ga0373927_0024526
412 Ga0373927_0247868
413 Ga0373933_0038424
414 Ga0373947_0078532
415 Ga0373937_0007446
416 Ga0373925_0070612
417 Ga0439461_0017393
418 Ga0451577_0029490
419 Ga0451576_0282395
420 Ga0451576_0418653
421 Ga0495629_0008894
422 Ga0495629_0118481
423 Ga0495651_0041101
424 Ga0495653_0048402
425 Ga0495580_0013732
426 Ga0495580_0059273
427 Ga0495582_0018233
428 Ga0495582_0021320
429 Ga0495639_0007161
430 Ga0495639_0026214
431 Ga0495664_0007071
432 Ga0495594_0009235
433 Ga0495594_0021924
434 Ga0495596_0016055
435 Ga0495628_0181018
436 Ga0495628_0251273
437 Ga0495630_0033971
438 Ga0495652_0099483
439 Ga0495665_0009443
440 Ga0495665_0021461
441 Ga0495665_0032246
442 Ga0495586_0061089
443 Ga0495586_0233135
444 Ga0495587_0001106
445 Ga0495587_0011623
446 Ga0495621_0002960
447 Ga0495645_0002106
448 Ga0495645_0045494
449 Ga0495667_0007961
450 Ga0495667_0059543
451 Ga0495667_0103627
452 Ga0495667_0231685
453 Ga0495635_0084348
454 Ga0495657_0034850
455 Ga0495599_0090129
456 Ga0495658_0037920
457 Ga0495600_0158118
458 Ga0495600_0211222
459 Ga0495581_0025669
460 Ga0495581_0118008
461 Ga0495604_0039626
462 Ga0495674_0086668
463 Ga0495674_0087899
464 Ga0495674_0428750
465 Ga0495680_0257903
466 Ga0495675_0001418
467 Ga0495675_0029361
468 Ga0495675_0121067
469 Ga0495685_007154
470 Ga0495684_0071969
471 Ga0495593_0193788
472 Ga0495602_0108324
473 Ga0495614_0184145
474 Ga0496104_0138348
475 Ga0496106_0043263
476 Ga0496108_0004917
477 Ga0496109_0068978
478 Ga0496110_0472093
479 Ga0496112_0000747
480 Ga0496112_0010539
481 Ga0496113_0005892
482 Ga0501031_0125088
483 Ga0501032_0001251
484 Ga0501033_0026376
485 Ga0501034_0012836
486 Ga0501036_0040881
487 Ga0501037_0009403
488 Ga0501039_0114593
489 Ga0501040_0036192
490 Ga0501042_0026498
491 Ga0501046_0014866
492 Ga0501047_0027999
493 Ga0501048_0075255
494 Ga0501048_0415857
495 Ga0501068_0231139
496 Ga0501070_0025184
497 Ga0501070_0201182
498 Ga0501070_0456611
499 Ga0501072_0069765
500 Ga0501073_0192253
501 Ga0501076_0069115
502 Ga0501076_0170820
503 Ga0501076_0228280
504 Ga0501076_0322417
505 Ga0501249_002648
506 Ga0501079_0007993
507 Ga0501080_0262429
508 Ga0501035_0000489
509 Ga0501044_0235111
510 nmdc:mga0n895_234863_c1
511 nmdc:mga08x19_63999_c1
512 Ga0495601_0061809
513 Ga0501084_0106544
514 Ga0501084_0401270
515 Ga0501082_0060606
516 Ga0501082_0107204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

17

177

0.77

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

17

213

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8312 1 248
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8275 1 247
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8207 3 250
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8183 1 247
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8158 1 248
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8365 4 247 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.833 1 248 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8275 1 247 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8264 4 247 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8183 1 247 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7W1IDX0-F1-model_v4 Metallophosphoesterase family protein 0.9891 3 255 GO:0005737
GO:0016791
AF-A0A7W0K7Y4-F1-model_v4 Metallophosphoesterase family protein 0.9862 2 250 GO:0005737
GO:0016791
AF-A0A5Q4DEH6-F1-model_v4 Metallophosphoesterase 0.9859 3 207 GO:0005737
GO:0016791
AF-A0A849H965-F1-model_v4 Metallophosphoesterase 0.9823 32 251
AF-A0A7C0VCY4-F1-model_v4 Metallophosphoesterase 0.9789 171 247

Map