F368307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 110 | 516 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300046458|Ga0495591_000402|Ga0495591_000402_16315_17247 |
| Length | 310 |
| Sequence | VEYELAVHIMSELKVHARPCDIEPMVQIEEIRAAFASRLKKSLAEKGIDQWGAGARLAEMTKVTPKAASKWLNGESIPGPAKMQAIAENLGVKIEWLQHGSGDGPGMLVDQPVVGDSLTAADKIREMLAGKKLGDDRLQKLLSVAEGTDQDDTIEVLVNDAYKPGIGKVGDEVWIAHYDVRGALGGGEVAHDFPEMLQDVRVSPSQLRSMGVEFKEHYHLKVITGWGQSMTPTIKHGDPCLVDISIKEFIGDGIYYFSYQGFQYIKRLQMKGKDKFKMISDNRKHKAEDIFIDETYIQARVLFVWNGNLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 4 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 5 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 6 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 7 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 8 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 9 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 10 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 13 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 14 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 15 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 16 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 20 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 21 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 22 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 23 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 24 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 25 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 26 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 27 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 28 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 29 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 30 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 31 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 32 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 33 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 34 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 35 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 38 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 89 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 90 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 91 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 92 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 93 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 94 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 95 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 96 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 97 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 98 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 101 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 102 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 103 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 104 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 105 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 106 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 107 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 108 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 109 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 110 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 0 |
| Isolates | 3.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 1.94 |
| Rhizoplane | 2.71 |
| Rhizosphere | 89.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495591_000402 | 3300046458 | Bacteria | 36129 |
| 2 | Ga0065714_10067198 | 3300005288 | Bacteria | 5772 |
| 3 | Ga0075364_10097345 | 3300006051 | Bacteria | 1957 |
| 4 | Ga0075432_10000228 | 3300006058 | Bacteria | 14986 |
| 5 | Ga0075432_10000321 | 3300006058 | Bacteria | 13559 |
| 6 | Ga0075432_10000731 | 3300006058 | Bacteria | 10152 |
| 7 | Ga0099823_1000067 | 3300006944 | Bacteria | 49708 |
| 8 | Ga0105251_10001391 | 3300009011 | Bacteria | 20919 |
| 9 | Ga0105251_10006359 | 3300009011 | Bacteria | 7543 |
| 10 | Ga0105244_10003648 | 3300009036 | Bacteria | 10901 |
| 11 | Ga0105244_10010764 | 3300009036 | Bacteria | 5527 |
| 12 | Ga0105244_10032867 | 3300009036 | Bacteria | 2742 |
| 13 | Ga0157373_10002734 | 3300013100 | Bacteria | 13360 |
| 14 | Ga0157371_10000333 | 3300013102 | Bacteria | 60809 |
| 15 | Ga0157371_10000334 | 3300013102 | Bacteria | 60797 |
| 16 | Ga0157371_10002221 | 3300013102 | Bacteria | 18780 |
| 17 | Ga0157370_10025510 | 3300013104 | Bacteria | 5852 |
| 18 | Ga0157370_10050823 | 3300013104 | Bacteria | 3961 |
| 19 | Ga0157370_10090570 | 3300013104 | Bacteria | 2872 |
| 20 | Ga0157370_10098348 | 3300013104 | Bacteria | 2744 |
| 21 | Ga0157369_10002428 | 3300013105 | Bacteria | 22391 |
| 22 | Ga0157369_10003082 | 3300013105 | Bacteria | 19917 |
| 23 | Ga0157369_10033108 | 3300013105 | Bacteria | 5681 |
| 24 | Ga0182008_10002637 | 3300014497 | Bacteria | 11130 |
| 25 | Ga0182008_10010126 | 3300014497 | Bacteria | 5055 |
| 26 | Ga0182008_10023883 | 3300014497 | Bacteria | 3117 |
| 27 | Ga0182008_10038361 | 3300014497 | Bacteria | 2395 |
| 28 | Ga0182006_1001178 | 3300015261 | Bacteria | 16423 |
| 29 | Ga0182006_1001903 | 3300015261 | Bacteria | 11904 |
| 30 | Ga0182006_1002716 | 3300015261 | Bacteria | 9492 |
| 31 | Ga0182007_10001931 | 3300015262 | Bacteria | 10725 |
| 32 | Ga0182007_10026547 | 3300015262 | Bacteria | 2006 |
| 33 | Ga0182005_1000396 | 3300015265 | Bacteria | 23771 |
| 34 | Ga0182005_1000448 | 3300015265 | Bacteria | 21912 |
| 35 | Ga0182005_1001292 | 3300015265 | Bacteria | 10288 |
| 36 | Ga0182005_1004163 | 3300015265 | Bacteria | 4729 |
| 37 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 38 | Ga0207655_1000094 | 3300025728 | Bacteria | 196748 |
| 39 | Ga0207713_1004785 | 3300025735 | Bacteria | 8699 |
| 40 | Ga0207713_1011186 | 3300025735 | Bacteria | 4905 |
| 41 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 42 | Ga0209389_1000038 | 3300027296 | Bacteria | 125072 |
| 43 | Ga0207428_10001451 | 3300027907 | Bacteria | 24809 |
| 44 | Ga0207428_10006930 | 3300027907 | Bacteria | 10388 |
| 45 | Ga0307511_10152327 | 3300030521 | Bacteria | 1323 |
| 46 | Ga0307408_100003303 | 3300031548 | Bacteria | 11089 |
| 47 | Ga0307405_10019535 | 3300031731 | Bacteria | 3766 |
| 48 | Ga0307413_10040960 | 3300031824 | Bacteria | 2708 |
| 49 | Ga0307412_10000173 | 3300031911 | Bacteria | 45901 |
| 50 | Ga0307412_10000976 | 3300031911 | Bacteria | 16351 |
| 51 | Ga0307412_10022591 | 3300031911 | Bacteria | 3858 |
| 52 | Ga0439438_000107 | 3300041405 | Bacteria | 38582 |
| 53 | Ga0439466_0012129 | 3300041411 | Bacteria | 3181 |
| 54 | Ga0439466_0071687 | 3300041411 | Bacteria | 1102 |
| 55 | Ga0439452_000241 | 3300042010 | Bacteria | 37760 |
| 56 | Ga0439452_002875 | 3300042010 | Bacteria | 6187 |
| 57 | Ga0450920_001911 | 3300042122 | Bacteria | 3499 |
| 58 | Ga0450905_000001 | 3300042142 | Bacteria | 51289 |
| 59 | Ga0450907_000217 | 3300042146 | Bacteria | 20404 |
| 60 | Ga0450910_000050 | 3300042147 | Bacteria | 12267 |
| 61 | Ga0450908_000026 | 3300042184 | Bacteria | 34631 |
| 62 | Ga0495627_000369 | 3300046453 | Bacteria | 41831 |
| 63 | Ga0495592_0000277 | 3300046454 | Bacteria | 43977 |
| 64 | Ga0495590_0000048 | 3300046457 | Bacteria | 116368 |
| 65 | Ga0495591_000298 | 3300046458 | Bacteria | 45382 |
| 66 | Ga0495591_000522 | 3300046458 | Bacteria | 30008 |
| 67 | Ga0495638_0001371 | 3300046460 | Bacteria | 22322 |
| 68 | Ga0495638_0001415 | 3300046460 | Bacteria | 21799 |
| 69 | Ga0495638_0009502 | 3300046460 | Bacteria | 6820 |
| 70 | Ga0495638_0033334 | 3300046460 | Bacteria | 3294 |
| 71 | Ga0495653_0000245 | 3300046463 | Bacteria | 43673 |
| 72 | Ga0495650_0000923 | 3300046471 | Bacteria | 34487 |
| 73 | Ga0495650_0001902 | 3300046471 | Bacteria | 18512 |
| 74 | Ga0495650_0036666 | 3300046471 | Bacteria | 2143 |
| 75 | Ga0495650_0038902 | 3300046471 | Bacteria | 2056 |
| 76 | Ga0495605_0001170 | 3300046474 | Bacteria | 17419 |
| 77 | Ga0495605_0004084 | 3300046474 | Bacteria | 8614 |
| 78 | Ga0495605_0005049 | 3300046474 | Bacteria | 7711 |
| 79 | Ga0495605_0043407 | 3300046474 | Bacteria | 2229 |
| 80 | Ga0495584_0000099 | 3300046491 | Bacteria | 57784 |
| 81 | Ga0495584_0001321 | 3300046491 | Bacteria | 15063 |
| 82 | Ga0495584_0007162 | 3300046491 | Bacteria | 5826 |
| 83 | Ga0495584_0038370 | 3300046491 | Bacteria | 2421 |
| 84 | Ga0495585_0000182 | 3300046492 | Bacteria | 66842 |
| 85 | Ga0495585_0003768 | 3300046492 | Bacteria | 10119 |
| 86 | Ga0495585_0039394 | 3300046492 | Bacteria | 2656 |
| 87 | Ga0495596_0000122 | 3300046500 | Bacteria | 53601 |
| 88 | Ga0495596_0000349 | 3300046500 | Bacteria | 29914 |
| 89 | Ga0495607_0000326 | 3300046501 | Bacteria | 49364 |
| 90 | Ga0495607_0000404 | 3300046501 | Bacteria | 43821 |
| 91 | Ga0495607_0003351 | 3300046501 | Bacteria | 12287 |
| 92 | Ga0495607_0004282 | 3300046501 | Bacteria | 10549 |
| 93 | Ga0495607_0011878 | 3300046501 | Bacteria | 5769 |
| 94 | Ga0495583_0000371 | 3300046506 | Bacteria | 69919 |
| 95 | Ga0495583_0005178 | 3300046506 | Bacteria | 8979 |
| 96 | Ga0495606_0000796 | 3300046507 | Bacteria | 48127 |
| 97 | Ga0495606_0000910 | 3300046507 | Bacteria | 43886 |
| 98 | Ga0495606_0004128 | 3300046507 | Bacteria | 14749 |
| 99 | Ga0495610_0000383 | 3300046512 | Bacteria | 45677 |
| 100 | Ga0495610_0000516 | 3300046512 | Bacteria | 38838 |
| 101 | Ga0495610_0000630 | 3300046512 | Bacteria | 34615 |
| 102 | Ga0495616_0007271 | 3300046513 | Bacteria | 6629 |
| 103 | Ga0495616_0016418 | 3300046513 | Bacteria | 4098 |
| 104 | Ga0495620_0000138 | 3300046515 | Bacteria | 59518 |
| 105 | Ga0495620_0001461 | 3300046515 | Bacteria | 14145 |
| 106 | Ga0495630_0007919 | 3300046517 | Bacteria | 7620 |
| 107 | Ga0495631_0000140 | 3300046518 | Bacteria | 49175 |
| 108 | Ga0495632_0000276 | 3300046519 | Bacteria | 50343 |
| 109 | Ga0495632_0000611 | 3300046519 | Bacteria | 32999 |
| 110 | Ga0495632_0001370 | 3300046519 | Bacteria | 20470 |
| 111 | Ga0495632_0002581 | 3300046519 | Bacteria | 13671 |
| 112 | Ga0495632_0016894 | 3300046519 | Bacteria | 4044 |
| 113 | Ga0495632_0022924 | 3300046519 | Bacteria | 3341 |
| 114 | Ga0495632_0034531 | 3300046519 | Bacteria | 2587 |
| 115 | Ga0495632_0041094 | 3300046519 | Bacteria | 2325 |
| 116 | Ga0495637_0000030 | 3300046520 | Bacteria | 138704 |
| 117 | Ga0495637_0000191 | 3300046520 | Bacteria | 47977 |
| 118 | Ga0495637_0003646 | 3300046520 | Bacteria | 8155 |
| 119 | Ga0495637_0006885 | 3300046520 | Bacteria | 5678 |
| 120 | Ga0495637_0098105 | 3300046520 | Bacteria | 1148 |
| 121 | Ga0495643_0018928 | 3300046522 | Bacteria | 3988 |
| 122 | Ga0495643_0158547 | 3300046522 | Bacteria | 1115 |
| 123 | Ga0495644_0000006 | 3300046523 | Bacteria | 113088 |
| 124 | Ga0495644_0000022 | 3300046523 | Bacteria | 79714 |
| 125 | Ga0495644_0001671 | 3300046523 | Bacteria | 9005 |
| 126 | Ga0495644_0003688 | 3300046523 | Bacteria | 6028 |
| 127 | Ga0495648_0011184 | 3300046524 | Bacteria | 6779 |
| 128 | Ga0495648_0039031 | 3300046524 | Bacteria | 3027 |
| 129 | Ga0495648_0140108 | 3300046524 | Bacteria | 1274 |
| 130 | Ga0495666_0000041 | 3300046526 | Bacteria | 47296 |
| 131 | Ga0495666_0004773 | 3300046526 | Bacteria | 6854 |
| 132 | Ga0495642_0000042 | 3300046528 | Bacteria | 75891 |
| 133 | Ga0495654_0000177 | 3300046530 | Bacteria | 62703 |
| 134 | Ga0495654_0000275 | 3300046530 | Bacteria | 46540 |
| 135 | Ga0495654_0000309 | 3300046530 | Bacteria | 42970 |
| 136 | Ga0495654_0003281 | 3300046530 | Bacteria | 9979 |
| 137 | Ga0495654_0008167 | 3300046530 | Bacteria | 5798 |
| 138 | Ga0495654_0014304 | 3300046530 | Bacteria | 4225 |
| 139 | Ga0495654_0018993 | 3300046530 | Bacteria | 3597 |
| 140 | Ga0495654_0020956 | 3300046530 | Bacteria | 3404 |
| 141 | Ga0495654_0092195 | 3300046530 | Bacteria | 1404 |
| 142 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 143 | Ga0495609_0000037 | 3300046538 | Bacteria | 185912 |
| 144 | Ga0495609_0000043 | 3300046538 | Bacteria | 166590 |
| 145 | Ga0495609_0000301 | 3300046538 | Bacteria | 45226 |
| 146 | Ga0495597_0002121 | 3300046542 | Bacteria | 13126 |
| 147 | Ga0495597_0007003 | 3300046542 | Bacteria | 5778 |
| 148 | Ga0495597_0024267 | 3300046542 | Bacteria | 2800 |
| 149 | Ga0495597_0067383 | 3300046542 | Bacteria | 1548 |
| 150 | Ga0495597_0095930 | 3300046542 | Bacteria | 1254 |
| 151 | Ga0495597_0119661 | 3300046542 | Bacteria | 1098 |
| 152 | Ga0495656_0056489 | 3300046615 | Bacteria | 1696 |
| 153 | Ga0495668_0000886 | 3300046616 | Bacteria | 33702 |
| 154 | Ga0495668_0001599 | 3300046616 | Bacteria | 21230 |
| 155 | Ga0495668_0004612 | 3300046616 | Bacteria | 9689 |
| 156 | Ga0495611_0008498 | 3300046648 | Bacteria | 4342 |
| 157 | Ga0495625_0001201 | 3300046660 | Bacteria | 32943 |
| 158 | Ga0495625_0008956 | 3300046660 | Bacteria | 8452 |
| 159 | Ga0495625_0045218 | 3300046660 | Bacteria | 3184 |
| 160 | Ga0495635_0051144 | 3300046663 | Bacteria | 2848 |
| 161 | Ga0495659_0000099 | 3300046664 | Bacteria | 38226 |
| 162 | Ga0495661_0000024 | 3300046665 | Bacteria | 188844 |
| 163 | Ga0495661_0019011 | 3300046665 | Bacteria | 4507 |
| 164 | Ga0495661_0086574 | 3300046665 | Bacteria | 1793 |
| 165 | Ga0495661_0125044 | 3300046665 | Bacteria | 1416 |
| 166 | Ga0495669_0086122 | 3300046684 | Bacteria | 1446 |
| 167 | Ga0495670_0013050 | 3300046691 | Bacteria | 4085 |
| 168 | Ga0495670_0089829 | 3300046691 | Bacteria | 1572 |
| 169 | Ga0495671_0000172 | 3300046692 | Bacteria | 57446 |
| 170 | Ga0495671_0000205 | 3300046692 | Bacteria | 51902 |
| 171 | Ga0495671_0000477 | 3300046692 | Bacteria | 31095 |
| 172 | Ga0495671_0005676 | 3300046692 | Bacteria | 7279 |
| 173 | Ga0495671_0020229 | 3300046692 | Bacteria | 3509 |
| 174 | Ga0495671_0082076 | 3300046692 | Bacteria | 1579 |
| 175 | Ga0495671_0095913 | 3300046692 | Bacteria | 1451 |
| 176 | Ga0495649_0000140 | 3300046694 | Bacteria | 62872 |
| 177 | Ga0495649_0000189 | 3300046694 | Bacteria | 54079 |
| 178 | Ga0495649_0004048 | 3300046694 | Bacteria | 9652 |
| 179 | Ga0495649_0011530 | 3300046694 | Bacteria | 5180 |
| 180 | Ga0495649_0048718 | 3300046694 | Bacteria | 2303 |
| 181 | Ga0495649_0104383 | 3300046694 | Bacteria | 1505 |
| 182 | Ga0495589_0000374 | 3300046794 | Bacteria | 34286 |
| 183 | Ga0495589_0000708 | 3300046794 | Bacteria | 21718 |
| 184 | Ga0495589_0009780 | 3300046794 | Bacteria | 4979 |
| 185 | Ga0495589_0015137 | 3300046794 | Bacteria | 3972 |
| 186 | Ga0495660_0000185 | 3300046810 | Bacteria | 67242 |
| 187 | Ga0495660_0000241 | 3300046810 | Bacteria | 53414 |
| 188 | Ga0495660_0000398 | 3300046810 | Bacteria | 37497 |
| 189 | Ga0495660_0000648 | 3300046810 | Bacteria | 27008 |
| 190 | Ga0495660_0000778 | 3300046810 | Bacteria | 23878 |
| 191 | Ga0495660_0001694 | 3300046810 | Bacteria | 14749 |
| 192 | Ga0495660_0013255 | 3300046810 | Bacteria | 4775 |
| 193 | Ga0495660_0016776 | 3300046810 | Bacteria | 4220 |
| 194 | Ga0495660_0035873 | 3300046810 | Bacteria | 2768 |
| 195 | Ga0495660_0064102 | 3300046810 | Bacteria | 1965 |
| 196 | Ga0495604_0000657 | 3300047317 | Bacteria | 29371 |
| 197 | Ga0495636_0009232 | 3300047318 | Bacteria | 3882 |
| 198 | Ga0495672_0059804 | 3300047320 | Bacteria | 2203 |
| 199 | Ga0495672_0111051 | 3300047320 | Bacteria | 1471 |
| 200 | Ga0495676_0000141 | 3300047321 | Bacteria | 55004 |
| 201 | Ga0495680_0000524 | 3300047322 | Bacteria | 43233 |
| 202 | Ga0495680_0042310 | 3300047322 | Bacteria | 3616 |
| 203 | Ga0495683_0000172 | 3300047323 | Bacteria | 63287 |
| 204 | Ga0495683_0010926 | 3300047323 | Bacteria | 4788 |
| 205 | Ga0495683_0024786 | 3300047323 | Bacteria | 3077 |
| 206 | Ga0495683_0077240 | 3300047323 | Bacteria | 1628 |
| 207 | Ga0495675_0070075 | 3300047444 | Bacteria | 2213 |
| 208 | Ga0495679_000249 | 3300047446 | Bacteria | 44622 |
| 209 | Ga0495679_006646 | 3300047446 | Bacteria | 4946 |
| 210 | Ga0495679_008331 | 3300047446 | Bacteria | 4225 |
| 211 | Ga0495673_0000276 | 3300047469 | Bacteria | 69967 |
| 212 | Ga0495673_0001208 | 3300047469 | Bacteria | 21516 |
| 213 | Ga0495673_0001513 | 3300047469 | Bacteria | 18324 |
| 214 | Ga0495673_0013391 | 3300047469 | Bacteria | 4310 |
| 215 | Ga0495673_0021247 | 3300047469 | Bacteria | 3211 |
| 216 | Ga0495681_0000142 | 3300047470 | Bacteria | 60399 |
| 217 | Ga0495681_0000233 | 3300047470 | Bacteria | 46046 |
| 218 | Ga0495681_0002255 | 3300047470 | Bacteria | 13860 |
| 219 | Ga0495681_0005674 | 3300047470 | Bacteria | 8313 |
| 220 | Ga0495681_0006872 | 3300047470 | Bacteria | 7388 |
| 221 | Ga0495681_0008302 | 3300047470 | Bacteria | 6523 |
| 222 | Ga0495681_0015748 | 3300047470 | Bacteria | 4269 |
| 223 | Ga0495681_0037912 | 3300047470 | Bacteria | 2368 |
| 224 | Ga0495684_0022251 | 3300047471 | Bacteria | 4881 |
| 225 | Ga0495626_0000238 | 3300048091 | Bacteria | 63755 |
| 226 | Ga0495626_0000297 | 3300048091 | Bacteria | 53415 |
| 227 | Ga0495626_0059162 | 3300048091 | Bacteria | 1749 |
| 228 | Ga0495626_0070127 | 3300048091 | Bacteria | 1577 |
| 229 | Ga0496111_0275977 | 3300048914 | Bacteria | 1247 |
| 230 | Ga0496113_0257138 | 3300048916 | Bacteria | 1395 |
| 231 | Ga0496115_0087191 | 3300048918 | Bacteria | 2547 |
| 232 | Ga0496116_0000207 | 3300048919 | Bacteria | 111531 |
| 233 | Ga0496117_0260985 | 3300048920 | Bacteria | 939 |
| 234 | Ga0496119_0061006 | 3300048922 | Bacteria | 2255 |
| 235 | Ga0496121_0002034 | 3300048924 | Bacteria | 32019 |
| 236 | Ga0496122_0055966 | 3300048925 | Bacteria | 2946 |
| 237 | Ga0496123_0060416 | 3300048926 | Bacteria | 2444 |
| 238 | Ga0496124_0000421 | 3300048927 | Bacteria | 75739 |
| 239 | Ga0496124_0001227 | 3300048927 | Bacteria | 39540 |
| 240 | Ga0495678_000407 | 3300049459 | Bacteria | 43484 |
| 241 | Ga0495678_001450 | 3300049459 | Bacteria | 18662 |
| 242 | Ga0495678_002118 | 3300049459 | Bacteria | 14094 |
| 243 | Ga0495678_007315 | 3300049459 | Bacteria | 5740 |
| 244 | Ga0495678_054232 | 3300049459 | Bacteria | 1535 |
| 245 | Ga0495682_0000123 | 3300049460 | Bacteria | 67837 |
| 246 | Ga0495682_0013248 | 3300049460 | Bacteria | 3143 |
| 247 | Ga0495682_0047852 | 3300049460 | Bacteria | 1559 |
| 248 | Ga0500659_0001313 | 3300053135 | Bacteria | 15897 |
| 249 | 2511296087 | 2511231011 | Bacteria | 6149768 |
| 250 | 2511318450 | 2511231015 | Bacteria | 6598026 |
| 251 | 2599328836 | 2599185155 | Bacteria | 5827168 |
| 252 | 2599971392 | 2599185307 | Bacteria | 6194719 |
| 253 | 2600037413 | 2599185318 | Bacteria | 6961590 |
| 254 | 2601624673 | 2600255283 | Bacteria | 6061572 |
| 255 | 2794597476 | 2791355520 | Bacteria | 5948615 |
| 256 | 2842848709 | 2842843487 | Bacteria | 6004777 |
| 257 | 3007804112 | 3007803356 | Bacteria | 5931491 |
| 258 | 3007869561 | 3007866637 | Bacteria | 5899198 |
| 259 | Ga0495591_000402 | |||
| 260 | Ga0065714_10067198 | |||
| 261 | Ga0075364_10097345 | |||
| 262 | Ga0075432_10000228 | |||
| 263 | Ga0075432_10000321 | |||
| 264 | Ga0075432_10000731 | |||
| 265 | Ga0099823_1000067 | |||
| 266 | Ga0105251_10001391 | |||
| 267 | Ga0105251_10006359 | |||
| 268 | Ga0105244_10003648 | |||
| 269 | Ga0105244_10010764 | |||
| 270 | Ga0105244_10032867 | |||
| 271 | Ga0157373_10002734 | |||
| 272 | Ga0157371_10000333 | |||
| 273 | Ga0157371_10000334 | |||
| 274 | Ga0157371_10002221 | |||
| 275 | Ga0157370_10025510 | |||
| 276 | Ga0157370_10050823 | |||
| 277 | Ga0157370_10090570 | |||
| 278 | Ga0157370_10098348 | |||
| 279 | Ga0157369_10002428 | |||
| 280 | Ga0157369_10003082 | |||
| 281 | Ga0157369_10033108 | |||
| 282 | Ga0182008_10002637 | |||
| 283 | Ga0182008_10010126 | |||
| 284 | Ga0182008_10023883 | |||
| 285 | Ga0182008_10038361 | |||
| 286 | Ga0182006_1001178 | |||
| 287 | Ga0182006_1001903 | |||
| 288 | Ga0182006_1002716 | |||
| 289 | Ga0182007_10001931 | |||
| 290 | Ga0182007_10026547 | |||
| 291 | Ga0182005_1000396 | |||
| 292 | Ga0182005_1000448 | |||
| 293 | Ga0182005_1001292 | |||
| 294 | Ga0182005_1004163 | |||
| 295 | Ga0207696_1000045 | |||
| 296 | Ga0207655_1000094 | |||
| 297 | Ga0207713_1004785 | |||
| 298 | Ga0207713_1011186 | |||
| 299 | Ga0209281_1000015 | |||
| 300 | Ga0209389_1000038 | |||
| 301 | Ga0207428_10001451 | |||
| 302 | Ga0207428_10006930 | |||
| 303 | Ga0307511_10152327 | |||
| 304 | Ga0307408_100003303 | |||
| 305 | Ga0307405_10019535 | |||
| 306 | Ga0307413_10040960 | |||
| 307 | Ga0307412_10000173 | |||
| 308 | Ga0307412_10000976 | |||
| 309 | Ga0307412_10022591 | |||
| 310 | Ga0439438_000107 | |||
| 311 | Ga0439466_0012129 | |||
| 312 | Ga0439466_0071687 | |||
| 313 | Ga0439452_000241 | |||
| 314 | Ga0439452_002875 | |||
| 315 | Ga0450920_001911 | |||
| 316 | Ga0450905_000001 | |||
| 317 | Ga0450907_000217 | |||
| 318 | Ga0450910_000050 | |||
| 319 | Ga0450908_000026 | |||
| 320 | Ga0495627_000369 | |||
| 321 | Ga0495592_0000277 | |||
| 322 | Ga0495590_0000048 | |||
| 323 | Ga0495591_000298 | |||
| 324 | Ga0495591_000522 | |||
| 325 | Ga0495638_0001371 | |||
| 326 | Ga0495638_0001415 | |||
| 327 | Ga0495638_0009502 | |||
| 328 | Ga0495638_0033334 | |||
| 329 | Ga0495653_0000245 | |||
| 330 | Ga0495650_0000923 | |||
| 331 | Ga0495650_0001902 | |||
| 332 | Ga0495650_0036666 | |||
| 333 | Ga0495650_0038902 | |||
| 334 | Ga0495605_0001170 | |||
| 335 | Ga0495605_0004084 | |||
| 336 | Ga0495605_0005049 | |||
| 337 | Ga0495605_0043407 | |||
| 338 | Ga0495584_0000099 | |||
| 339 | Ga0495584_0001321 | |||
| 340 | Ga0495584_0007162 | |||
| 341 | Ga0495584_0038370 | |||
| 342 | Ga0495585_0000182 | |||
| 343 | Ga0495585_0003768 | |||
| 344 | Ga0495585_0039394 | |||
| 345 | Ga0495596_0000122 | |||
| 346 | Ga0495596_0000349 | |||
| 347 | Ga0495607_0000326 | |||
| 348 | Ga0495607_0000404 | |||
| 349 | Ga0495607_0003351 | |||
| 350 | Ga0495607_0004282 | |||
| 351 | Ga0495607_0011878 | |||
| 352 | Ga0495583_0000371 | |||
| 353 | Ga0495583_0005178 | |||
| 354 | Ga0495606_0000796 | |||
| 355 | Ga0495606_0000910 | |||
| 356 | Ga0495606_0004128 | |||
| 357 | Ga0495610_0000383 | |||
| 358 | Ga0495610_0000516 | |||
| 359 | Ga0495610_0000630 | |||
| 360 | Ga0495616_0007271 | |||
| 361 | Ga0495616_0016418 | |||
| 362 | Ga0495620_0000138 | |||
| 363 | Ga0495620_0001461 | |||
| 364 | Ga0495630_0007919 | |||
| 365 | Ga0495631_0000140 | |||
| 366 | Ga0495632_0000276 | |||
| 367 | Ga0495632_0000611 | |||
| 368 | Ga0495632_0001370 | |||
| 369 | Ga0495632_0002581 | |||
| 370 | Ga0495632_0016894 | |||
| 371 | Ga0495632_0022924 | |||
| 372 | Ga0495632_0034531 | |||
| 373 | Ga0495632_0041094 | |||
| 374 | Ga0495637_0000030 | |||
| 375 | Ga0495637_0000191 | |||
| 376 | Ga0495637_0003646 | |||
| 377 | Ga0495637_0006885 | |||
| 378 | Ga0495637_0098105 | |||
| 379 | Ga0495643_0018928 | |||
| 380 | Ga0495643_0158547 | |||
| 381 | Ga0495644_0000006 | |||
| 382 | Ga0495644_0000022 | |||
| 383 | Ga0495644_0001671 | |||
| 384 | Ga0495644_0003688 | |||
| 385 | Ga0495648_0011184 | |||
| 386 | Ga0495648_0039031 | |||
| 387 | Ga0495648_0140108 | |||
| 388 | Ga0495666_0000041 | |||
| 389 | Ga0495666_0004773 | |||
| 390 | Ga0495642_0000042 | |||
| 391 | Ga0495654_0000177 | |||
| 392 | Ga0495654_0000275 | |||
| 393 | Ga0495654_0000309 | |||
| 394 | Ga0495654_0003281 | |||
| 395 | Ga0495654_0008167 | |||
| 396 | Ga0495654_0014304 | |||
| 397 | Ga0495654_0018993 | |||
| 398 | Ga0495654_0020956 | |||
| 399 | Ga0495654_0092195 | |||
| 400 | Ga0495609_0000011 | |||
| 401 | Ga0495609_0000037 | |||
| 402 | Ga0495609_0000043 | |||
| 403 | Ga0495609_0000301 | |||
| 404 | Ga0495597_0002121 | |||
| 405 | Ga0495597_0007003 | |||
| 406 | Ga0495597_0024267 | |||
| 407 | Ga0495597_0067383 | |||
| 408 | Ga0495597_0095930 | |||
| 409 | Ga0495597_0119661 | |||
| 410 | Ga0495656_0056489 | |||
| 411 | Ga0495668_0000886 | |||
| 412 | Ga0495668_0001599 | |||
| 413 | Ga0495668_0004612 | |||
| 414 | Ga0495611_0008498 | |||
| 415 | Ga0495625_0001201 | |||
| 416 | Ga0495625_0008956 | |||
| 417 | Ga0495625_0045218 | |||
| 418 | Ga0495635_0051144 | |||
| 419 | Ga0495659_0000099 | |||
| 420 | Ga0495661_0000024 | |||
| 421 | Ga0495661_0019011 | |||
| 422 | Ga0495661_0086574 | |||
| 423 | Ga0495661_0125044 | |||
| 424 | Ga0495669_0086122 | |||
| 425 | Ga0495670_0013050 | |||
| 426 | Ga0495670_0089829 | |||
| 427 | Ga0495671_0000172 | |||
| 428 | Ga0495671_0000205 | |||
| 429 | Ga0495671_0000477 | |||
| 430 | Ga0495671_0005676 | |||
| 431 | Ga0495671_0020229 | |||
| 432 | Ga0495671_0082076 | |||
| 433 | Ga0495671_0095913 | |||
| 434 | Ga0495649_0000140 | |||
| 435 | Ga0495649_0000189 | |||
| 436 | Ga0495649_0004048 | |||
| 437 | Ga0495649_0011530 | |||
| 438 | Ga0495649_0048718 | |||
| 439 | Ga0495649_0104383 | |||
| 440 | Ga0495589_0000374 | |||
| 441 | Ga0495589_0000708 | |||
| 442 | Ga0495589_0009780 | |||
| 443 | Ga0495589_0015137 | |||
| 444 | Ga0495660_0000185 | |||
| 445 | Ga0495660_0000241 | |||
| 446 | Ga0495660_0000398 | |||
| 447 | Ga0495660_0000648 | |||
| 448 | Ga0495660_0000778 | |||
| 449 | Ga0495660_0001694 | |||
| 450 | Ga0495660_0013255 | |||
| 451 | Ga0495660_0016776 | |||
| 452 | Ga0495660_0035873 | |||
| 453 | Ga0495660_0064102 | |||
| 454 | Ga0495604_0000657 | |||
| 455 | Ga0495636_0009232 | |||
| 456 | Ga0495672_0059804 | |||
| 457 | Ga0495672_0111051 | |||
| 458 | Ga0495676_0000141 | |||
| 459 | Ga0495680_0000524 | |||
| 460 | Ga0495680_0042310 | |||
| 461 | Ga0495683_0000172 | |||
| 462 | Ga0495683_0010926 | |||
| 463 | Ga0495683_0024786 | |||
| 464 | Ga0495683_0077240 | |||
| 465 | Ga0495675_0070075 | |||
| 466 | Ga0495679_000249 | |||
| 467 | Ga0495679_006646 | |||
| 468 | Ga0495679_008331 | |||
| 469 | Ga0495673_0000276 | |||
| 470 | Ga0495673_0001208 | |||
| 471 | Ga0495673_0001513 | |||
| 472 | Ga0495673_0013391 | |||
| 473 | Ga0495673_0021247 | |||
| 474 | Ga0495681_0000142 | |||
| 475 | Ga0495681_0000233 | |||
| 476 | Ga0495681_0002255 | |||
| 477 | Ga0495681_0005674 | |||
| 478 | Ga0495681_0006872 | |||
| 479 | Ga0495681_0008302 | |||
| 480 | Ga0495681_0015748 | |||
| 481 | Ga0495681_0037912 | |||
| 482 | Ga0495684_0022251 | |||
| 483 | Ga0495626_0000238 | |||
| 484 | Ga0495626_0000297 | |||
| 485 | Ga0495626_0059162 | |||
| 486 | Ga0495626_0070127 | |||
| 487 | Ga0496111_0275977 | |||
| 488 | Ga0496113_0257138 | |||
| 489 | Ga0496115_0087191 | |||
| 490 | Ga0496116_0000207 | |||
| 491 | Ga0496117_0260985 | |||
| 492 | Ga0496119_0061006 | |||
| 493 | Ga0496121_0002034 | |||
| 494 | Ga0496122_0055966 | |||
| 495 | Ga0496123_0060416 | |||
| 496 | Ga0496124_0000421 | |||
| 497 | Ga0496124_0001227 | |||
| 498 | Ga0495678_000407 | |||
| 499 | Ga0495678_001450 | |||
| 500 | Ga0495678_002118 | |||
| 501 | Ga0495678_007315 | |||
| 502 | Ga0495678_054232 | |||
| 503 | Ga0495682_0000123 | |||
| 504 | Ga0495682_0013248 | |||
| 505 | Ga0495682_0047852 | |||
| 506 | Ga0500659_0001313 | |||
| 507 | 2511296087 | |||
| 508 | 2511318450 | |||
| 509 | 2599328836 | |||
| 510 | 2599971392 | |||
| 511 | 2600037413 | |||
| 512 | 2601624673 | |||
| 513 | 2794597476 | |||
| 514 | 2842848709 | |||
| 515 | 3007804112 | |||
| 516 | 3007869561 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy