F368307

General Info

Members Datasets Scaffolds Average Seq Length
258 110 516 284

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_000402|Ga0495591_000402_16315_17247
Length 310
Sequence VEYELAVHIMSELKVHARPCDIEPMVQIEEIRAAFASRLKKSLAEKGIDQWGAGARLAEMTKVTPKAASKWLNGESIPGPAKMQAIAENLGVKIEWLQHGSGDGPGMLVDQPVVGDSLTAADKIREMLAGKKLGDDRLQKLLSVAEGTDQDDTIEVLVNDAYKPGIGKVGDEVWIAHYDVRGALGGGEVAHDFPEMLQDVRVSPSQLRSMGVEFKEHYHLKVITGWGQSMTPTIKHGDPCLVDISIKEFIGDGIYYFSYQGFQYIKRLQMKGKDKFKMISDNRKHKAEDIFIDETYIQARVLFVWNGNLV

Samples

Sample ID Description Type Environment
1 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
4 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
5 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
6 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
9 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
10 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
16 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
20 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
21 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
22 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
23 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
24 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
25 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
26 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
27 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
28 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
29 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
30 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
31 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
32 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
33 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
34 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
35 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
36 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
37 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
38 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
39 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
40 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
41 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
42 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
43 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
44 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
45 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
46 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
49 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
50 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
51 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
52 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
53 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
54 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
55 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
56 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
57 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
58 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
59 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
62 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
63 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
69 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
70 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
84 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
101 2511231011 Pseudomonas sp. GM30 Isolate Nodule
102 2511231015 Pseudomonas sp. GM49 Isolate Nodule
103 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
104 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
105 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
106 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
107 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
108 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
109 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
110 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.94
Rhizoplane 2.71
Rhizosphere 89.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495591_000402 3300046458 Bacteria 36129
2 Ga0065714_10067198 3300005288 Bacteria 5772
3 Ga0075364_10097345 3300006051 Bacteria 1957
4 Ga0075432_10000228 3300006058 Bacteria 14986
5 Ga0075432_10000321 3300006058 Bacteria 13559
6 Ga0075432_10000731 3300006058 Bacteria 10152
7 Ga0099823_1000067 3300006944 Bacteria 49708
8 Ga0105251_10001391 3300009011 Bacteria 20919
9 Ga0105251_10006359 3300009011 Bacteria 7543
10 Ga0105244_10003648 3300009036 Bacteria 10901
11 Ga0105244_10010764 3300009036 Bacteria 5527
12 Ga0105244_10032867 3300009036 Bacteria 2742
13 Ga0157373_10002734 3300013100 Bacteria 13360
14 Ga0157371_10000333 3300013102 Bacteria 60809
15 Ga0157371_10000334 3300013102 Bacteria 60797
16 Ga0157371_10002221 3300013102 Bacteria 18780
17 Ga0157370_10025510 3300013104 Bacteria 5852
18 Ga0157370_10050823 3300013104 Bacteria 3961
19 Ga0157370_10090570 3300013104 Bacteria 2872
20 Ga0157370_10098348 3300013104 Bacteria 2744
21 Ga0157369_10002428 3300013105 Bacteria 22391
22 Ga0157369_10003082 3300013105 Bacteria 19917
23 Ga0157369_10033108 3300013105 Bacteria 5681
24 Ga0182008_10002637 3300014497 Bacteria 11130
25 Ga0182008_10010126 3300014497 Bacteria 5055
26 Ga0182008_10023883 3300014497 Bacteria 3117
27 Ga0182008_10038361 3300014497 Bacteria 2395
28 Ga0182006_1001178 3300015261 Bacteria 16423
29 Ga0182006_1001903 3300015261 Bacteria 11904
30 Ga0182006_1002716 3300015261 Bacteria 9492
31 Ga0182007_10001931 3300015262 Bacteria 10725
32 Ga0182007_10026547 3300015262 Bacteria 2006
33 Ga0182005_1000396 3300015265 Bacteria 23771
34 Ga0182005_1000448 3300015265 Bacteria 21912
35 Ga0182005_1001292 3300015265 Bacteria 10288
36 Ga0182005_1004163 3300015265 Bacteria 4729
37 Ga0207696_1000045 3300025711 Bacteria 296484
38 Ga0207655_1000094 3300025728 Bacteria 196748
39 Ga0207713_1004785 3300025735 Bacteria 8699
40 Ga0207713_1011186 3300025735 Bacteria 4905
41 Ga0209281_1000015 3300027111 Bacteria 590084
42 Ga0209389_1000038 3300027296 Bacteria 125072
43 Ga0207428_10001451 3300027907 Bacteria 24809
44 Ga0207428_10006930 3300027907 Bacteria 10388
45 Ga0307511_10152327 3300030521 Bacteria 1323
46 Ga0307408_100003303 3300031548 Bacteria 11089
47 Ga0307405_10019535 3300031731 Bacteria 3766
48 Ga0307413_10040960 3300031824 Bacteria 2708
49 Ga0307412_10000173 3300031911 Bacteria 45901
50 Ga0307412_10000976 3300031911 Bacteria 16351
51 Ga0307412_10022591 3300031911 Bacteria 3858
52 Ga0439438_000107 3300041405 Bacteria 38582
53 Ga0439466_0012129 3300041411 Bacteria 3181
54 Ga0439466_0071687 3300041411 Bacteria 1102
55 Ga0439452_000241 3300042010 Bacteria 37760
56 Ga0439452_002875 3300042010 Bacteria 6187
57 Ga0450920_001911 3300042122 Bacteria 3499
58 Ga0450905_000001 3300042142 Bacteria 51289
59 Ga0450907_000217 3300042146 Bacteria 20404
60 Ga0450910_000050 3300042147 Bacteria 12267
61 Ga0450908_000026 3300042184 Bacteria 34631
62 Ga0495627_000369 3300046453 Bacteria 41831
63 Ga0495592_0000277 3300046454 Bacteria 43977
64 Ga0495590_0000048 3300046457 Bacteria 116368
65 Ga0495591_000298 3300046458 Bacteria 45382
66 Ga0495591_000522 3300046458 Bacteria 30008
67 Ga0495638_0001371 3300046460 Bacteria 22322
68 Ga0495638_0001415 3300046460 Bacteria 21799
69 Ga0495638_0009502 3300046460 Bacteria 6820
70 Ga0495638_0033334 3300046460 Bacteria 3294
71 Ga0495653_0000245 3300046463 Bacteria 43673
72 Ga0495650_0000923 3300046471 Bacteria 34487
73 Ga0495650_0001902 3300046471 Bacteria 18512
74 Ga0495650_0036666 3300046471 Bacteria 2143
75 Ga0495650_0038902 3300046471 Bacteria 2056
76 Ga0495605_0001170 3300046474 Bacteria 17419
77 Ga0495605_0004084 3300046474 Bacteria 8614
78 Ga0495605_0005049 3300046474 Bacteria 7711
79 Ga0495605_0043407 3300046474 Bacteria 2229
80 Ga0495584_0000099 3300046491 Bacteria 57784
81 Ga0495584_0001321 3300046491 Bacteria 15063
82 Ga0495584_0007162 3300046491 Bacteria 5826
83 Ga0495584_0038370 3300046491 Bacteria 2421
84 Ga0495585_0000182 3300046492 Bacteria 66842
85 Ga0495585_0003768 3300046492 Bacteria 10119
86 Ga0495585_0039394 3300046492 Bacteria 2656
87 Ga0495596_0000122 3300046500 Bacteria 53601
88 Ga0495596_0000349 3300046500 Bacteria 29914
89 Ga0495607_0000326 3300046501 Bacteria 49364
90 Ga0495607_0000404 3300046501 Bacteria 43821
91 Ga0495607_0003351 3300046501 Bacteria 12287
92 Ga0495607_0004282 3300046501 Bacteria 10549
93 Ga0495607_0011878 3300046501 Bacteria 5769
94 Ga0495583_0000371 3300046506 Bacteria 69919
95 Ga0495583_0005178 3300046506 Bacteria 8979
96 Ga0495606_0000796 3300046507 Bacteria 48127
97 Ga0495606_0000910 3300046507 Bacteria 43886
98 Ga0495606_0004128 3300046507 Bacteria 14749
99 Ga0495610_0000383 3300046512 Bacteria 45677
100 Ga0495610_0000516 3300046512 Bacteria 38838
101 Ga0495610_0000630 3300046512 Bacteria 34615
102 Ga0495616_0007271 3300046513 Bacteria 6629
103 Ga0495616_0016418 3300046513 Bacteria 4098
104 Ga0495620_0000138 3300046515 Bacteria 59518
105 Ga0495620_0001461 3300046515 Bacteria 14145
106 Ga0495630_0007919 3300046517 Bacteria 7620
107 Ga0495631_0000140 3300046518 Bacteria 49175
108 Ga0495632_0000276 3300046519 Bacteria 50343
109 Ga0495632_0000611 3300046519 Bacteria 32999
110 Ga0495632_0001370 3300046519 Bacteria 20470
111 Ga0495632_0002581 3300046519 Bacteria 13671
112 Ga0495632_0016894 3300046519 Bacteria 4044
113 Ga0495632_0022924 3300046519 Bacteria 3341
114 Ga0495632_0034531 3300046519 Bacteria 2587
115 Ga0495632_0041094 3300046519 Bacteria 2325
116 Ga0495637_0000030 3300046520 Bacteria 138704
117 Ga0495637_0000191 3300046520 Bacteria 47977
118 Ga0495637_0003646 3300046520 Bacteria 8155
119 Ga0495637_0006885 3300046520 Bacteria 5678
120 Ga0495637_0098105 3300046520 Bacteria 1148
121 Ga0495643_0018928 3300046522 Bacteria 3988
122 Ga0495643_0158547 3300046522 Bacteria 1115
123 Ga0495644_0000006 3300046523 Bacteria 113088
124 Ga0495644_0000022 3300046523 Bacteria 79714
125 Ga0495644_0001671 3300046523 Bacteria 9005
126 Ga0495644_0003688 3300046523 Bacteria 6028
127 Ga0495648_0011184 3300046524 Bacteria 6779
128 Ga0495648_0039031 3300046524 Bacteria 3027
129 Ga0495648_0140108 3300046524 Bacteria 1274
130 Ga0495666_0000041 3300046526 Bacteria 47296
131 Ga0495666_0004773 3300046526 Bacteria 6854
132 Ga0495642_0000042 3300046528 Bacteria 75891
133 Ga0495654_0000177 3300046530 Bacteria 62703
134 Ga0495654_0000275 3300046530 Bacteria 46540
135 Ga0495654_0000309 3300046530 Bacteria 42970
136 Ga0495654_0003281 3300046530 Bacteria 9979
137 Ga0495654_0008167 3300046530 Bacteria 5798
138 Ga0495654_0014304 3300046530 Bacteria 4225
139 Ga0495654_0018993 3300046530 Bacteria 3597
140 Ga0495654_0020956 3300046530 Bacteria 3404
141 Ga0495654_0092195 3300046530 Bacteria 1404
142 Ga0495609_0000011 3300046538 Bacteria 334377
143 Ga0495609_0000037 3300046538 Bacteria 185912
144 Ga0495609_0000043 3300046538 Bacteria 166590
145 Ga0495609_0000301 3300046538 Bacteria 45226
146 Ga0495597_0002121 3300046542 Bacteria 13126
147 Ga0495597_0007003 3300046542 Bacteria 5778
148 Ga0495597_0024267 3300046542 Bacteria 2800
149 Ga0495597_0067383 3300046542 Bacteria 1548
150 Ga0495597_0095930 3300046542 Bacteria 1254
151 Ga0495597_0119661 3300046542 Bacteria 1098
152 Ga0495656_0056489 3300046615 Bacteria 1696
153 Ga0495668_0000886 3300046616 Bacteria 33702
154 Ga0495668_0001599 3300046616 Bacteria 21230
155 Ga0495668_0004612 3300046616 Bacteria 9689
156 Ga0495611_0008498 3300046648 Bacteria 4342
157 Ga0495625_0001201 3300046660 Bacteria 32943
158 Ga0495625_0008956 3300046660 Bacteria 8452
159 Ga0495625_0045218 3300046660 Bacteria 3184
160 Ga0495635_0051144 3300046663 Bacteria 2848
161 Ga0495659_0000099 3300046664 Bacteria 38226
162 Ga0495661_0000024 3300046665 Bacteria 188844
163 Ga0495661_0019011 3300046665 Bacteria 4507
164 Ga0495661_0086574 3300046665 Bacteria 1793
165 Ga0495661_0125044 3300046665 Bacteria 1416
166 Ga0495669_0086122 3300046684 Bacteria 1446
167 Ga0495670_0013050 3300046691 Bacteria 4085
168 Ga0495670_0089829 3300046691 Bacteria 1572
169 Ga0495671_0000172 3300046692 Bacteria 57446
170 Ga0495671_0000205 3300046692 Bacteria 51902
171 Ga0495671_0000477 3300046692 Bacteria 31095
172 Ga0495671_0005676 3300046692 Bacteria 7279
173 Ga0495671_0020229 3300046692 Bacteria 3509
174 Ga0495671_0082076 3300046692 Bacteria 1579
175 Ga0495671_0095913 3300046692 Bacteria 1451
176 Ga0495649_0000140 3300046694 Bacteria 62872
177 Ga0495649_0000189 3300046694 Bacteria 54079
178 Ga0495649_0004048 3300046694 Bacteria 9652
179 Ga0495649_0011530 3300046694 Bacteria 5180
180 Ga0495649_0048718 3300046694 Bacteria 2303
181 Ga0495649_0104383 3300046694 Bacteria 1505
182 Ga0495589_0000374 3300046794 Bacteria 34286
183 Ga0495589_0000708 3300046794 Bacteria 21718
184 Ga0495589_0009780 3300046794 Bacteria 4979
185 Ga0495589_0015137 3300046794 Bacteria 3972
186 Ga0495660_0000185 3300046810 Bacteria 67242
187 Ga0495660_0000241 3300046810 Bacteria 53414
188 Ga0495660_0000398 3300046810 Bacteria 37497
189 Ga0495660_0000648 3300046810 Bacteria 27008
190 Ga0495660_0000778 3300046810 Bacteria 23878
191 Ga0495660_0001694 3300046810 Bacteria 14749
192 Ga0495660_0013255 3300046810 Bacteria 4775
193 Ga0495660_0016776 3300046810 Bacteria 4220
194 Ga0495660_0035873 3300046810 Bacteria 2768
195 Ga0495660_0064102 3300046810 Bacteria 1965
196 Ga0495604_0000657 3300047317 Bacteria 29371
197 Ga0495636_0009232 3300047318 Bacteria 3882
198 Ga0495672_0059804 3300047320 Bacteria 2203
199 Ga0495672_0111051 3300047320 Bacteria 1471
200 Ga0495676_0000141 3300047321 Bacteria 55004
201 Ga0495680_0000524 3300047322 Bacteria 43233
202 Ga0495680_0042310 3300047322 Bacteria 3616
203 Ga0495683_0000172 3300047323 Bacteria 63287
204 Ga0495683_0010926 3300047323 Bacteria 4788
205 Ga0495683_0024786 3300047323 Bacteria 3077
206 Ga0495683_0077240 3300047323 Bacteria 1628
207 Ga0495675_0070075 3300047444 Bacteria 2213
208 Ga0495679_000249 3300047446 Bacteria 44622
209 Ga0495679_006646 3300047446 Bacteria 4946
210 Ga0495679_008331 3300047446 Bacteria 4225
211 Ga0495673_0000276 3300047469 Bacteria 69967
212 Ga0495673_0001208 3300047469 Bacteria 21516
213 Ga0495673_0001513 3300047469 Bacteria 18324
214 Ga0495673_0013391 3300047469 Bacteria 4310
215 Ga0495673_0021247 3300047469 Bacteria 3211
216 Ga0495681_0000142 3300047470 Bacteria 60399
217 Ga0495681_0000233 3300047470 Bacteria 46046
218 Ga0495681_0002255 3300047470 Bacteria 13860
219 Ga0495681_0005674 3300047470 Bacteria 8313
220 Ga0495681_0006872 3300047470 Bacteria 7388
221 Ga0495681_0008302 3300047470 Bacteria 6523
222 Ga0495681_0015748 3300047470 Bacteria 4269
223 Ga0495681_0037912 3300047470 Bacteria 2368
224 Ga0495684_0022251 3300047471 Bacteria 4881
225 Ga0495626_0000238 3300048091 Bacteria 63755
226 Ga0495626_0000297 3300048091 Bacteria 53415
227 Ga0495626_0059162 3300048091 Bacteria 1749
228 Ga0495626_0070127 3300048091 Bacteria 1577
229 Ga0496111_0275977 3300048914 Bacteria 1247
230 Ga0496113_0257138 3300048916 Bacteria 1395
231 Ga0496115_0087191 3300048918 Bacteria 2547
232 Ga0496116_0000207 3300048919 Bacteria 111531
233 Ga0496117_0260985 3300048920 Bacteria 939
234 Ga0496119_0061006 3300048922 Bacteria 2255
235 Ga0496121_0002034 3300048924 Bacteria 32019
236 Ga0496122_0055966 3300048925 Bacteria 2946
237 Ga0496123_0060416 3300048926 Bacteria 2444
238 Ga0496124_0000421 3300048927 Bacteria 75739
239 Ga0496124_0001227 3300048927 Bacteria 39540
240 Ga0495678_000407 3300049459 Bacteria 43484
241 Ga0495678_001450 3300049459 Bacteria 18662
242 Ga0495678_002118 3300049459 Bacteria 14094
243 Ga0495678_007315 3300049459 Bacteria 5740
244 Ga0495678_054232 3300049459 Bacteria 1535
245 Ga0495682_0000123 3300049460 Bacteria 67837
246 Ga0495682_0013248 3300049460 Bacteria 3143
247 Ga0495682_0047852 3300049460 Bacteria 1559
248 Ga0500659_0001313 3300053135 Bacteria 15897
249 2511296087 2511231011 Bacteria 6149768
250 2511318450 2511231015 Bacteria 6598026
251 2599328836 2599185155 Bacteria 5827168
252 2599971392 2599185307 Bacteria 6194719
253 2600037413 2599185318 Bacteria 6961590
254 2601624673 2600255283 Bacteria 6061572
255 2794597476 2791355520 Bacteria 5948615
256 2842848709 2842843487 Bacteria 6004777
257 3007804112 3007803356 Bacteria 5931491
258 3007869561 3007866637 Bacteria 5899198
259 Ga0495591_000402
260 Ga0065714_10067198
261 Ga0075364_10097345
262 Ga0075432_10000228
263 Ga0075432_10000321
264 Ga0075432_10000731
265 Ga0099823_1000067
266 Ga0105251_10001391
267 Ga0105251_10006359
268 Ga0105244_10003648
269 Ga0105244_10010764
270 Ga0105244_10032867
271 Ga0157373_10002734
272 Ga0157371_10000333
273 Ga0157371_10000334
274 Ga0157371_10002221
275 Ga0157370_10025510
276 Ga0157370_10050823
277 Ga0157370_10090570
278 Ga0157370_10098348
279 Ga0157369_10002428
280 Ga0157369_10003082
281 Ga0157369_10033108
282 Ga0182008_10002637
283 Ga0182008_10010126
284 Ga0182008_10023883
285 Ga0182008_10038361
286 Ga0182006_1001178
287 Ga0182006_1001903
288 Ga0182006_1002716
289 Ga0182007_10001931
290 Ga0182007_10026547
291 Ga0182005_1000396
292 Ga0182005_1000448
293 Ga0182005_1001292
294 Ga0182005_1004163
295 Ga0207696_1000045
296 Ga0207655_1000094
297 Ga0207713_1004785
298 Ga0207713_1011186
299 Ga0209281_1000015
300 Ga0209389_1000038
301 Ga0207428_10001451
302 Ga0207428_10006930
303 Ga0307511_10152327
304 Ga0307408_100003303
305 Ga0307405_10019535
306 Ga0307413_10040960
307 Ga0307412_10000173
308 Ga0307412_10000976
309 Ga0307412_10022591
310 Ga0439438_000107
311 Ga0439466_0012129
312 Ga0439466_0071687
313 Ga0439452_000241
314 Ga0439452_002875
315 Ga0450920_001911
316 Ga0450905_000001
317 Ga0450907_000217
318 Ga0450910_000050
319 Ga0450908_000026
320 Ga0495627_000369
321 Ga0495592_0000277
322 Ga0495590_0000048
323 Ga0495591_000298
324 Ga0495591_000522
325 Ga0495638_0001371
326 Ga0495638_0001415
327 Ga0495638_0009502
328 Ga0495638_0033334
329 Ga0495653_0000245
330 Ga0495650_0000923
331 Ga0495650_0001902
332 Ga0495650_0036666
333 Ga0495650_0038902
334 Ga0495605_0001170
335 Ga0495605_0004084
336 Ga0495605_0005049
337 Ga0495605_0043407
338 Ga0495584_0000099
339 Ga0495584_0001321
340 Ga0495584_0007162
341 Ga0495584_0038370
342 Ga0495585_0000182
343 Ga0495585_0003768
344 Ga0495585_0039394
345 Ga0495596_0000122
346 Ga0495596_0000349
347 Ga0495607_0000326
348 Ga0495607_0000404
349 Ga0495607_0003351
350 Ga0495607_0004282
351 Ga0495607_0011878
352 Ga0495583_0000371
353 Ga0495583_0005178
354 Ga0495606_0000796
355 Ga0495606_0000910
356 Ga0495606_0004128
357 Ga0495610_0000383
358 Ga0495610_0000516
359 Ga0495610_0000630
360 Ga0495616_0007271
361 Ga0495616_0016418
362 Ga0495620_0000138
363 Ga0495620_0001461
364 Ga0495630_0007919
365 Ga0495631_0000140
366 Ga0495632_0000276
367 Ga0495632_0000611
368 Ga0495632_0001370
369 Ga0495632_0002581
370 Ga0495632_0016894
371 Ga0495632_0022924
372 Ga0495632_0034531
373 Ga0495632_0041094
374 Ga0495637_0000030
375 Ga0495637_0000191
376 Ga0495637_0003646
377 Ga0495637_0006885
378 Ga0495637_0098105
379 Ga0495643_0018928
380 Ga0495643_0158547
381 Ga0495644_0000006
382 Ga0495644_0000022
383 Ga0495644_0001671
384 Ga0495644_0003688
385 Ga0495648_0011184
386 Ga0495648_0039031
387 Ga0495648_0140108
388 Ga0495666_0000041
389 Ga0495666_0004773
390 Ga0495642_0000042
391 Ga0495654_0000177
392 Ga0495654_0000275
393 Ga0495654_0000309
394 Ga0495654_0003281
395 Ga0495654_0008167
396 Ga0495654_0014304
397 Ga0495654_0018993
398 Ga0495654_0020956
399 Ga0495654_0092195
400 Ga0495609_0000011
401 Ga0495609_0000037
402 Ga0495609_0000043
403 Ga0495609_0000301
404 Ga0495597_0002121
405 Ga0495597_0007003
406 Ga0495597_0024267
407 Ga0495597_0067383
408 Ga0495597_0095930
409 Ga0495597_0119661
410 Ga0495656_0056489
411 Ga0495668_0000886
412 Ga0495668_0001599
413 Ga0495668_0004612
414 Ga0495611_0008498
415 Ga0495625_0001201
416 Ga0495625_0008956
417 Ga0495625_0045218
418 Ga0495635_0051144
419 Ga0495659_0000099
420 Ga0495661_0000024
421 Ga0495661_0019011
422 Ga0495661_0086574
423 Ga0495661_0125044
424 Ga0495669_0086122
425 Ga0495670_0013050
426 Ga0495670_0089829
427 Ga0495671_0000172
428 Ga0495671_0000205
429 Ga0495671_0000477
430 Ga0495671_0005676
431 Ga0495671_0020229
432 Ga0495671_0082076
433 Ga0495671_0095913
434 Ga0495649_0000140
435 Ga0495649_0000189
436 Ga0495649_0004048
437 Ga0495649_0011530
438 Ga0495649_0048718
439 Ga0495649_0104383
440 Ga0495589_0000374
441 Ga0495589_0000708
442 Ga0495589_0009780
443 Ga0495589_0015137
444 Ga0495660_0000185
445 Ga0495660_0000241
446 Ga0495660_0000398
447 Ga0495660_0000648
448 Ga0495660_0000778
449 Ga0495660_0001694
450 Ga0495660_0013255
451 Ga0495660_0016776
452 Ga0495660_0035873
453 Ga0495660_0064102
454 Ga0495604_0000657
455 Ga0495636_0009232
456 Ga0495672_0059804
457 Ga0495672_0111051
458 Ga0495676_0000141
459 Ga0495680_0000524
460 Ga0495680_0042310
461 Ga0495683_0000172
462 Ga0495683_0010926
463 Ga0495683_0024786
464 Ga0495683_0077240
465 Ga0495675_0070075
466 Ga0495679_000249
467 Ga0495679_006646
468 Ga0495679_008331
469 Ga0495673_0000276
470 Ga0495673_0001208
471 Ga0495673_0001513
472 Ga0495673_0013391
473 Ga0495673_0021247
474 Ga0495681_0000142
475 Ga0495681_0000233
476 Ga0495681_0002255
477 Ga0495681_0005674
478 Ga0495681_0006872
479 Ga0495681_0008302
480 Ga0495681_0015748
481 Ga0495681_0037912
482 Ga0495684_0022251
483 Ga0495626_0000238
484 Ga0495626_0000297
485 Ga0495626_0059162
486 Ga0495626_0070127
487 Ga0496111_0275977
488 Ga0496113_0257138
489 Ga0496115_0087191
490 Ga0496116_0000207
491 Ga0496117_0260985
492 Ga0496119_0061006
493 Ga0496121_0002034
494 Ga0496122_0055966
495 Ga0496123_0060416
496 Ga0496124_0000421
497 Ga0496124_0001227
498 Ga0495678_000407
499 Ga0495678_001450
500 Ga0495678_002118
501 Ga0495678_007315
502 Ga0495678_054232
503 Ga0495682_0000123
504 Ga0495682_0013248
505 Ga0495682_0047852
506 Ga0500659_0001313
507 2511296087
508 2511318450
509 2599328836
510 2599971392
511 2600037413
512 2601624673
513 2794597476
514 2842848709
515 3007804112
516 3007869561

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

39

97

0.92

PF00717

Peptidase_S24

Peptidase S24-like

183

302

0.84

Map