F368265

General Info

Members Datasets Scaffolds Average Seq Length
258 167 258 234

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0796622|Ga0451807_0796622_2977_3690
Length 237
Sequence MQEIRRGNERGYADHGWLKSFHTFSFADYFDAEHVEYGPLRVINEDRVSPGRGFGSHGHRDMEIISYVLEGQLAHKDSTGTESSIGPGDVQRMSAGRGVVHSEFNPSNSEGVHFLQIWIQPNVLGIEPSYEEKRFDDKRGRLQQIASPDRAEGSVLIHQDARVYAGLIDGVESARLALQPDRRLYLHVARGRVTANGALLNAGDALKLDGVPELALENGIQAEVIVFDLPGPDDRKN

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
105 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
112 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
113 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
118 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 2.33
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10014346 3300005290 Bacteria 1865
2 Ga0065712_10131397 3300005290 Bacteria 1545
3 Ga0068869_100084605 3300005334 Bacteria 2375
4 Ga0068869_100504862 3300005334 Bacteria 1010
5 Ga0070666_10028422 3300005335 Bacteria 3669
6 Ga0070680_100000519 3300005336 Bacteria 26424
7 Ga0070680_100012725 3300005336 Bacteria 6541
8 Ga0070680_100168029 3300005336 Bacteria 1845
9 Ga0070680_100359112 3300005336 Bacteria 1239
10 Ga0068868_100032304 3300005338 Bacteria 4026
11 Ga0070689_100020320 3300005340 Bacteria 4926
12 Ga0070689_100278536 3300005340 Bacteria 1387
13 Ga0070668_100259671 3300005347 Bacteria 1444
14 Ga0070669_100735925 3300005353 Bacteria 835
15 Ga0070675_100251235 3300005354 Bacteria 1548
16 Ga0070671_100207846 3300005355 Bacteria 1660
17 Ga0070673_100101022 3300005364 Bacteria 2375
18 Ga0070659_100132917 3300005366 Bacteria 2022
19 Ga0070667_100010842 3300005367 Bacteria 7535
20 Ga0070667_100547911 3300005367 Bacteria 1063
21 Ga0070681_10049410 3300005458 Bacteria 4200
22 Ga0068867_100120128 3300005459 Bacteria 2030
23 Ga0068867_100181943 3300005459 Bacteria 1672
24 Ga0070679_100001338 3300005530 Bacteria 21747
25 Ga0070679_100013133 3300005530 Bacteria 7929
26 Ga0070679_100020641 3300005530 Bacteria 6424
27 Ga0070679_100205958 3300005530 Bacteria 1932
28 Ga0070679_100266141 3300005530 Bacteria 1669
29 Ga0070672_100214259 3300005543 Bacteria 1614
30 Ga0070695_100081006 3300005545 Bacteria 2147
31 Ga0070665_100002460 3300005548 Bacteria 20415
32 Ga0070665_100006030 3300005548 Bacteria 12383
33 Ga0070665_100015917 3300005548 Bacteria 7549
34 Ga0070665_100107268 3300005548 Bacteria 2795
35 Ga0070704_100856526 3300005549 Bacteria 815
36 Ga0070704_100891235 3300005549 Bacteria 800
37 Ga0068855_100002086 3300005563 Bacteria 24750
38 Ga0068855_100002586 3300005563 Bacteria 22304
39 Ga0068855_100037890 3300005563 Bacteria 5730
40 Ga0068856_100181782 3300005614 Bacteria 2116
41 Ga0068859_100295245 3300005617 Bacteria 1714
42 Ga0068864_100211631 3300005618 Bacteria 1785
43 Ga0068861_100274658 3300005719 Bacteria 1449
44 Ga0068863_100011421 3300005841 Bacteria 8590
45 Ga0068858_100039819 3300005842 Bacteria 4357
46 Ga0068858_100177371 3300005842 Bacteria 2011
47 Ga0068860_100012899 3300005843 Bacteria 8213
48 Ga0081455_10000296 3300005937 Bacteria 65970
49 Ga0081539_10029764 3300005985 Bacteria 3404
50 Ga0097621_100006196 3300006237 Bacteria 8480
51 Ga0068871_100006155 3300006358 Bacteria 8456
52 Ga0075433_10014325 3300006852 Bacteria 6477
53 Ga0075434_100015228 3300006871 Bacteria 7369
54 Ga0075434_100543316 3300006871 Bacteria 1182
55 Ga0097620_100295244 3300006931 Bacteria 1714
56 Ga0075435_100094269 3300007076 Bacteria 2474
57 Ga0105240_10000921 3300009093 Bacteria 52415
58 Ga0105240_10004891 3300009093 Bacteria 20165
59 Ga0105240_10008294 3300009093 Bacteria 14868
60 Ga0105240_10027236 3300009093 Bacteria 7486
61 Ga0105240_10391441 3300009093 Bacteria 1567
62 Ga0111539_10033114 3300009094 Bacteria 6275
63 Ga0111539_10175158 3300009094 Bacteria 2506
64 Ga0111539_10455377 3300009094 Bacteria 1490
65 Ga0105245_10006170 3300009098 Bacteria 10548
66 Ga0105241_10355792 3300009174 Bacteria 1273
67 Ga0105242_10013402 3300009176 Bacteria 6335
68 Ga0105248_10004863 3300009177 Bacteria 14873
69 Ga0105237_10051194 3300009545 Bacteria 4148
70 Ga0105237_10156280 3300009545 Bacteria 2278
71 Ga0105237_10599332 3300009545 Bacteria 1109
72 Ga0105238_10005982 3300009551 Bacteria 12065
73 Ga0105238_10178588 3300009551 Bacteria 2100
74 Ga0105249_10105365 3300009553 Bacteria 2658
75 Ga0105030_101474 3300009987 Bacteria 2080
76 Ga0157370_10000715 3300013104 Bacteria 41556
77 Ga0157370_10057967 3300013104 Bacteria 3681
78 Ga0157369_10004931 3300013105 Bacteria 15632
79 Ga0157374_10161865 3300013296 Bacteria 2180
80 Ga0163162_10028723 3300013306 Bacteria 5505
81 Ga0157514_127300 3300013874 Bacteria 1178
82 Ga0157380_10003340 3300014326 Bacteria 11014
83 Ga0157380_10549184 3300014326 Bacteria 1133
84 Ga0157379_10018794 3300014968 Bacteria 6095
85 Ga0157376_10023424 3300014969 Bacteria 4832
86 Ga0206354_10409564 3300020081 Bacteria 903
87 Ga0207707_10000038 3300025912 Bacteria 143359
88 Ga0207707_10003548 3300025912 Bacteria 13811
89 Ga0207695_10045738 3300025913 Bacteria 4644
90 Ga0207695_10061306 3300025913 Bacteria 3888
91 Ga0207695_10102061 3300025913 Bacteria 2862
92 Ga0207660_10161625 3300025917 Bacteria 1728
93 Ga0207662_10183473 3300025918 Bacteria 1347
94 Ga0207652_10001122 3300025921 Bacteria 24107
95 Ga0207652_10072093 3300025921 Bacteria 3003
96 Ga0207652_10706048 3300025921 Bacteria 900
97 Ga0207694_10023403 3300025924 Bacteria 4689
98 Ga0207694_10304585 3300025924 Bacteria 1312
99 Ga0207644_10175783 3300025931 Bacteria 1675
100 Ga0207690_10259209 3300025932 Bacteria 1346
101 Ga0207690_10603372 3300025932 Bacteria 896
102 Ga0207686_10106183 3300025934 Bacteria 1885
103 Ga0207670_10014096 3300025936 Bacteria 4734
104 Ga0207704_10067621 3300025938 Bacteria 2249
105 Ga0207704_10150883 3300025938 Bacteria 1640
106 Ga0207665_10483672 3300025939 Bacteria 954
107 Ga0207711_10138960 3300025941 Bacteria 2184
108 Ga0207667_10002606 3300025949 Bacteria 22356
109 Ga0207667_10023591 3300025949 Bacteria 6773
110 Ga0207667_10584138 3300025949 Bacteria 1127
111 Ga0207712_10150653 3300025961 Bacteria 1796
112 Ga0207640_10592166 3300025981 Bacteria 938
113 Ga0207658_10110916 3300025986 Bacteria 2168
114 Ga0207703_10015014 3300026035 Bacteria 6045
115 Ga0207702_10383125 3300026078 Bacteria 1353
116 Ga0207641_10078212 3300026088 Bacteria 2864
117 Ga0207648_10056800 3300026089 Bacteria 3415
118 Ga0207648_10330120 3300026089 Bacteria 1372
119 Ga0207676_10213737 3300026095 Bacteria 1713
120 Ga0207675_100206338 3300026118 Bacteria 1889
121 Ga0207675_100264882 3300026118 Bacteria 1666
122 Ga0210002_1016232 3300027617 Bacteria 1178
123 Ga0209983_1010616 3300027665 Bacteria 1882
124 Ga0209966_1044003 3300027695 Bacteria 937
125 Ga0207428_10158222 3300027907 Bacteria 1721
126 Ga0268266_10014757 3300028379 Bacteria 6710
127 Ga0268266_10063277 3300028379 Bacteria 3194
128 Ga0268266_10173517 3300028379 Bacteria 1958
129 Ga0268264_10016792 3300028381 Bacteria 5990
130 Ga0268264_10200499 3300028381 Bacteria 1825
131 Ga0265334_10001601 3300028573 Bacteria 10882
132 Ga0265338_10005194 3300028800 Bacteria 17098
133 Ga0265338_10123351 3300028800 Bacteria 2060
134 Ga0265339_10039096 3300031249 Bacteria 2643
135 Ga0265331_10012721 3300031250 Bacteria 4548
136 Ga0265327_10000096 3300031251 Bacteria 193827
137 Ga0307509_10000074 3300031507 Bacteria 140111
138 Ga0307408_100201794 3300031548 Bacteria 1610
139 Ga0307408_100725471 3300031548 Bacteria 895
140 Ga0307405_10035839 3300031731 Bacteria 2967
141 Ga0307413_10128785 3300031824 Bacteria 1728
142 Ga0307413_10405193 3300031824 Bacteria 1070
143 Ga0307410_10637287 3300031852 Bacteria 893
144 Ga0307406_10206443 3300031901 Bacteria 1450
145 Ga0307407_10052521 3300031903 Bacteria 2341
146 Ga0307412_10142857 3300031911 Bacteria 1755
147 Ga0307409_100018526 3300031995 Bacteria 4685
148 Ga0307416_100114003 3300032002 Bacteria 2390
149 Ga0307416_100127266 3300032002 Bacteria 2284
150 Ga0307416_100625634 3300032002 Bacteria 1159
151 Ga0307414_10486855 3300032004 Bacteria 1089
152 Ga0307411_10038342 3300032005 Bacteria 3022
153 Ga0307411_10360260 3300032005 Bacteria 1189
154 Ga0307415_100021862 3300032126 Bacteria 3940
155 Ga0307415_100433192 3300032126 Bacteria 1132
156 Ga0307415_100670781 3300032126 Bacteria 932
157 Ga0436365_0089675 3300039437 Bacteria 1140
158 Ga0439461_0000368 3300041410 Bacteria 6416
159 Ga0451804_0410565 3300041463 Bacteria 1467
160 Ga0451807_0796622 3300041486 Bacteria 8214
161 Ga0451833_1114430 3300041491 Bacteria 2537
162 Ga0451845_0296868 3300041501 Bacteria 1251
163 Ga0451853_0233784 3300041512 Bacteria 1317
164 Ga0451853_2689812 3300041512 Bacteria 1923
165 Ga0439431_0004302 3300041997 Bacteria 3127
166 Ga0450923_001888 3300042125 Bacteria 2890
167 Ga0450923_002786 3300042125 Bacteria 2558
168 Ga0450897_007272 3300042128 Bacteria 1008
169 Ga0450896_002484 3300042133 Bacteria 2382
170 Ga0439446_0000150 3300042156 Bacteria 12148
171 Ga0439434_0000316 3300042435 Bacteria 13750
172 Ga0439435_0000128 3300042436 Bacteria 10004
173 Ga0439444_0002053 3300042437 Bacteria 2700
174 Ga0450916_025395 3300042530 Bacteria 836
175 Ga0451577_0076770 3300042876 Bacteria 2979
176 Ga0466960_0021837 3300044901 Bacteria 2855
177 Ga0466959_0011312 3300045049 Bacteria 6408
178 Ga0466959_0231854 3300045049 Bacteria 1278
179 Ga0495580_0093662 3300046472 Bacteria 2090
180 Ga0495662_0186780 3300046476 Bacteria 1022
181 Ga0495616_0054226 3300046513 Bacteria 1989
182 Ga0495611_0175354 3300046648 Bacteria 1002
183 Ga0495625_0283160 3300046660 Bacteria 1066
184 Ga0495602_0388384 3300048088 Bacteria 998
185 Ga0496104_0016081 3300048907 Bacteria 6790
186 Ga0496105_0016568 3300048908 Bacteria 5885
187 Ga0496108_0636707 3300048911 Bacteria 927
188 Ga0496111_0008249 3300048914 Bacteria 6887
189 Ga0496126_0012085 3300048929 Bacteria 8869
190 Ga0501031_0052861 3300049568 Bacteria 2646
191 Ga0501032_0000195 3300049569 Bacteria 50432
192 Ga0501032_0008834 3300049569 Bacteria 7327
193 Ga0501032_0096333 3300049569 Bacteria 1961
194 Ga0501032_0145263 3300049569 Bacteria 1561
195 Ga0501033_0040440 3300049570 Bacteria 3480
196 Ga0501033_0082390 3300049570 Bacteria 2359
197 Ga0501033_0320555 3300049570 Bacteria 1089
198 Ga0501034_0079912 3300049571 Bacteria 3274
199 Ga0501034_0740676 3300049571 Bacteria 879
200 Ga0501036_0032140 3300049572 Bacteria 4433
201 Ga0501036_0060166 3300049572 Bacteria 3217
202 Ga0501036_0089718 3300049572 Bacteria 2597
203 Ga0501036_0121100 3300049572 Bacteria 2209
204 Ga0501036_0246663 3300049572 Bacteria 1497
205 Ga0501038_0009495 3300049574 Bacteria 8926
206 Ga0501038_0016210 3300049574 Bacteria 6757
207 Ga0501038_0103710 3300049574 Bacteria 2364
208 Ga0501038_0210795 3300049574 Bacteria 1554
209 Ga0501039_0037543 3300049575 Bacteria 3739
210 Ga0501039_0297214 3300049575 Bacteria 1269
211 Ga0501039_0342347 3300049575 Bacteria 1175
212 Ga0501042_0078841 3300049578 Bacteria 2359
213 Ga0501042_0161013 3300049578 Bacteria 1619
214 Ga0501043_0096925 3300049579 Bacteria 2318
215 Ga0501043_0233059 3300049579 Unclassified 1421
216 Ga0501043_0271904 3300049579 Bacteria 1300
217 Ga0501043_0485552 3300049579 Unclassified 924
218 Ga0501046_0014062 3300049580 Bacteria 6758
219 Ga0501046_0350495 3300049580 Bacteria 1072
220 Ga0501047_0009664 3300049581 Bacteria 9116
221 Ga0501048_0005538 3300049582 Bacteria 9604
222 Ga0501048_0139609 3300049582 Unclassified 1713
223 Ga0501067_0189141 3300049583 Bacteria 1147
224 Ga0501068_0001088 3300049584 Bacteria 14394
225 Ga0501068_0023192 3300049584 Bacteria 3635
226 Ga0501068_0176420 3300049584 Bacteria 1350
227 Ga0501071_0039057 3300049587 Bacteria 3394
228 Ga0501071_0090100 3300049587 Bacteria 2252
229 Ga0501073_0060295 3300049589 Bacteria 2648
230 Ga0501073_0107180 3300049589 Bacteria 1938
231 Ga0501074_0154272 3300049590 Bacteria 1641
232 Ga0501074_0185779 3300049590 Bacteria 1482
233 Ga0501075_0002597 3300049591 Bacteria 12060
234 Ga0501076_0001209 3300049592 Bacteria 17163
235 Ga0501076_0085877 3300049592 Bacteria 2529
236 Ga0501077_0000709 3300049593 Bacteria 20134
237 Ga0501079_0014114 3300049741 Bacteria 6089
238 Ga0501080_0003968 3300049742 Bacteria 13104
239 Ga0501083_0509578 3300049744 Bacteria 783
240 Ga0501035_0000827 3300049822 Bacteria 33027
241 Ga0501035_0044581 3300049822 Bacteria 3993
242 Ga0501035_0055517 3300049822 Bacteria 3536
243 Ga0501044_0000248 3300049823 Bacteria 68598
244 Ga0501044_0004061 3300049823 Bacteria 16418
245 nmdc:mga08y16_126180_c1 3300050511 Bacteria 2662
246 nmdc:mga08y16_281615_c1 3300050511 Bacteria 1715
247 nmdc:mga0n895_8458_c1 3300050512 Bacteria 8910
248 nmdc:mga0rr50_43133_c1 3300050513 Bacteria 2509
249 nmdc:mga0a205_16315_c1 3300050515 Bacteria 6956
250 Ga0500641_0101237 3300053096 Bacteria 1236
251 Ga0500648_206790 3300053097 Bacteria 979
252 Ga0500616_0000155 3300053153 Bacteria 114811
253 Ga0501084_0005979 3300054114 Bacteria 10012
254 Ga0501084_0032463 3300054114 Bacteria 4367
255 Ga0501082_0002806 3300060353 Bacteria 15205
256 Ga0501082_0023899 3300060353 Bacteria 5270
257 Ga0530510_0020322 3300061734 Bacteria 4721
258 Ga0530510_0274822 3300061734 Bacteria 1258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10001601 Ga0265334_100016016 208
2 3300031249 Ga0265339_10039096 Ga0265339_100390962 208
3 3300032126 Ga0307415_100670781 Ga0307415_1006707811 211
4 3300053097 Ga0500648_206790 Ga0500648_206790_139_840 213
5 3300005290 Ga0065712_10131397 Ga0065712_101313971 220
6 3300005334 Ga0068869_100504862 Ga0068869_1005048621 220
7 3300005549 Ga0070704_100891235 Ga0070704_1008912351 220
8 3300009094 Ga0111539_10455377 Ga0111539_104553772 222
9 3300041463 Ga0451804_0410565 Ga0451804_0410565_564_1265 230
10 3300041486 Ga0451807_0796622 Ga0451807_0796622_2977_3690 230
11 3300041512 Ga0451853_0233784 Ga0451853_0233784_540_1253 230
12 3300046476 Ga0495662_0186780 Ga0495662_0186780_50_745 231
13 3300046513 Ga0495616_0054226 Ga0495616_0054226_34_741 231
14 3300046660 Ga0495625_0283160 Ga0495625_0283160_312_1019 231
15 3300005290 Ga0065712_10014346 Ga0065712_100143462 232
16 3300005334 Ga0068869_100084605 Ga0068869_1000846052 232
17 3300005335 Ga0070666_10028422 Ga0070666_100284222 232
18 3300005336 Ga0070680_100000519 Ga0070680_10000051910 232
19 3300005336 Ga0070680_100012725 Ga0070680_1000127254 232
20 3300005336 Ga0070680_100168029 Ga0070680_1001680291 232
21 3300005336 Ga0070680_100359112 Ga0070680_1003591122 232
22 3300005338 Ga0068868_100032304 Ga0068868_1000323042 232
23 3300005340 Ga0070689_100020320 Ga0070689_1000203204 232
24 3300005340 Ga0070689_100278536 Ga0070689_1002785362 232
25 3300005347 Ga0070668_100259671 Ga0070668_1002596712 232
26 3300005353 Ga0070669_100735925 Ga0070669_1007359251 232
27 3300005354 Ga0070675_100251235 Ga0070675_1002512352 232
28 3300005355 Ga0070671_100207846 Ga0070671_1002078462 232
29 3300005364 Ga0070673_100101022 Ga0070673_1001010223 232
30 3300005366 Ga0070659_100132917 Ga0070659_1001329171 232
31 3300005367 Ga0070667_100010842 Ga0070667_1000108424 232
32 3300005367 Ga0070667_100547911 Ga0070667_1005479112 232
33 3300005458 Ga0070681_10049410 Ga0070681_100494104 232
34 3300005459 Ga0068867_100120128 Ga0068867_1001201283 232
35 3300005459 Ga0068867_100181943 Ga0068867_1001819432 232
36 3300005530 Ga0070679_100001338 Ga0070679_1000013388 232
37 3300005530 Ga0070679_100013133 Ga0070679_1000131337 232
38 3300005530 Ga0070679_100020641 Ga0070679_1000206414 232
39 3300005530 Ga0070679_100205958 Ga0070679_1002059582 232
40 3300005530 Ga0070679_100266141 Ga0070679_1002661411 232
41 3300005543 Ga0070672_100214259 Ga0070672_1002142592 232
42 3300005545 Ga0070695_100081006 Ga0070695_1000810062 232
43 3300005548 Ga0070665_100002460 Ga0070665_10000246017 232
44 3300005548 Ga0070665_100006030 Ga0070665_10000603015 232
45 3300005548 Ga0070665_100015917 Ga0070665_1000159174 232
46 3300005548 Ga0070665_100107268 Ga0070665_1001072682 232
47 3300005549 Ga0070704_100856526 Ga0070704_1008565261 232
48 3300005563 Ga0068855_100002086 Ga0068855_1000020862 232
49 3300005563 Ga0068855_100002586 Ga0068855_1000025862 232
50 3300005563 Ga0068855_100037890 Ga0068855_1000378902 232
51 3300005614 Ga0068856_100181782 Ga0068856_1001817822 232
52 3300005617 Ga0068859_100295245 Ga0068859_1002952452 232
53 3300005618 Ga0068864_100211631 Ga0068864_1002116313 232
54 3300005719 Ga0068861_100274658 Ga0068861_1002746582 232
55 3300005841 Ga0068863_100011421 Ga0068863_1000114213 232
56 3300005842 Ga0068858_100039819 Ga0068858_1000398194 232
57 3300005842 Ga0068858_100177371 Ga0068858_1001773712 232
58 3300005843 Ga0068860_100012899 Ga0068860_1000128994 232
59 3300005937 Ga0081455_10000296 Ga0081455_1000029630 232
60 3300005985 Ga0081539_10029764 Ga0081539_100297642 232
61 3300006237 Ga0097621_100006196 Ga0097621_1000061969 232
62 3300006358 Ga0068871_100006155 Ga0068871_1000061553 232
63 3300006852 Ga0075433_10014325 Ga0075433_100143255 232
64 3300006871 Ga0075434_100015228 Ga0075434_1000152285 232
65 3300006871 Ga0075434_100543316 Ga0075434_1005433161 232
66 3300006931 Ga0097620_100295244 Ga0097620_1002952442 232
67 3300007076 Ga0075435_100094269 Ga0075435_1000942692 232
68 3300009093 Ga0105240_10000921 Ga0105240_1000092112 232
69 3300009093 Ga0105240_10004891 Ga0105240_1000489112 232
70 3300009093 Ga0105240_10008294 Ga0105240_100082943 232
71 3300009093 Ga0105240_10027236 Ga0105240_100272367 232
72 3300009093 Ga0105240_10391441 Ga0105240_103914412 232
73 3300009094 Ga0111539_10033114 Ga0111539_100331143 232
74 3300009094 Ga0111539_10175158 Ga0111539_101751582 232
75 3300009098 Ga0105245_10006170 Ga0105245_1000617011 232
76 3300009174 Ga0105241_10355792 Ga0105241_103557921 232
77 3300009176 Ga0105242_10013402 Ga0105242_100134027 232
78 3300009177 Ga0105248_10004863 Ga0105248_100048635 232
79 3300009545 Ga0105237_10051194 Ga0105237_100511943 232
80 3300009545 Ga0105237_10156280 Ga0105237_101562802 232
81 3300009545 Ga0105237_10599332 Ga0105237_105993321 232
82 3300009551 Ga0105238_10005982 Ga0105238_100059829 232
83 3300009551 Ga0105238_10178588 Ga0105238_101785883 232
84 3300009553 Ga0105249_10105365 Ga0105249_101053653 232
85 3300009987 Ga0105030_101474 Ga0105030_1014743 232
86 3300013104 Ga0157370_10000715 Ga0157370_1000071525 232
87 3300013104 Ga0157370_10057967 Ga0157370_100579674 232
88 3300013105 Ga0157369_10004931 Ga0157369_100049316 232
89 3300013296 Ga0157374_10161865 Ga0157374_101618653 232
90 3300013306 Ga0163162_10028723 Ga0163162_100287237 232
91 3300013874 Ga0157514_127300 Ga0157514_1273002 232
92 3300014326 Ga0157380_10003340 Ga0157380_1000334011 232
93 3300014326 Ga0157380_10549184 Ga0157380_105491842 232
94 3300014968 Ga0157379_10018794 Ga0157379_100187943 232
95 3300014969 Ga0157376_10023424 Ga0157376_100234243 232
96 3300020081 Ga0206354_10409564 Ga0206354_104095642 232
97 3300025912 Ga0207707_10000038 Ga0207707_1000003871 232
98 3300025912 Ga0207707_10003548 Ga0207707_1000354812 232
99 3300025913 Ga0207695_10045738 Ga0207695_100457385 232
100 3300025913 Ga0207695_10061306 Ga0207695_100613063 232
101 3300025913 Ga0207695_10102061 Ga0207695_101020611 232
102 3300025917 Ga0207660_10161625 Ga0207660_101616251 232
103 3300025918 Ga0207662_10183473 Ga0207662_101834732 232
104 3300025921 Ga0207652_10001122 Ga0207652_1000112221 232
105 3300025921 Ga0207652_10072093 Ga0207652_100720933 232
106 3300025921 Ga0207652_10706048 Ga0207652_107060481 232
107 3300025924 Ga0207694_10023403 Ga0207694_100234034 232
108 3300025924 Ga0207694_10304585 Ga0207694_103045852 232
109 3300025931 Ga0207644_10175783 Ga0207644_101757832 232
110 3300025932 Ga0207690_10259209 Ga0207690_102592092 232
111 3300025932 Ga0207690_10603372 Ga0207690_106033722 232
112 3300025934 Ga0207686_10106183 Ga0207686_101061832 232
113 3300025936 Ga0207670_10014096 Ga0207670_100140964 232
114 3300025938 Ga0207704_10067621 Ga0207704_100676213 232
115 3300025938 Ga0207704_10150883 Ga0207704_101508832 232
116 3300025939 Ga0207665_10483672 Ga0207665_104836722 232
117 3300025941 Ga0207711_10138960 Ga0207711_101389603 232
118 3300025949 Ga0207667_10002606 Ga0207667_100026062 232
119 3300025949 Ga0207667_10023591 Ga0207667_100235912 232
120 3300025949 Ga0207667_10584138 Ga0207667_105841382 232
121 3300025961 Ga0207712_10150653 Ga0207712_101506532 232
122 3300025981 Ga0207640_10592166 Ga0207640_105921662 232
123 3300025986 Ga0207658_10110916 Ga0207658_101109162 232
124 3300026035 Ga0207703_10015014 Ga0207703_100150145 232
125 3300026078 Ga0207702_10383125 Ga0207702_103831252 232
126 3300026088 Ga0207641_10078212 Ga0207641_100782123 232
127 3300026089 Ga0207648_10056800 Ga0207648_100568003 232
128 3300026089 Ga0207648_10330120 Ga0207648_103301202 232
129 3300026095 Ga0207676_10213737 Ga0207676_102137372 232
130 3300026118 Ga0207675_100206338 Ga0207675_1002063382 232
131 3300026118 Ga0207675_100264882 Ga0207675_1002648822 232
132 3300027617 Ga0210002_1016232 Ga0210002_10162322 232
133 3300027665 Ga0209983_1010616 Ga0209983_10106162 232
134 3300027695 Ga0209966_1044003 Ga0209966_10440031 232
135 3300027907 Ga0207428_10158222 Ga0207428_101582222 232
136 3300028379 Ga0268266_10014757 Ga0268266_100147571 232
137 3300028379 Ga0268266_10063277 Ga0268266_100632773 232
138 3300028379 Ga0268266_10173517 Ga0268266_101735172 232
139 3300028381 Ga0268264_10016792 Ga0268264_100167927 232
140 3300028381 Ga0268264_10200499 Ga0268264_102004992 232
141 3300028800 Ga0265338_10005194 Ga0265338_1000519414 232
142 3300028800 Ga0265338_10123351 Ga0265338_101233512 232
143 3300031250 Ga0265331_10012721 Ga0265331_100127211 232
144 3300031251 Ga0265327_10000096 Ga0265327_10000096101 232
145 3300031507 Ga0307509_10000074 Ga0307509_1000007418 232
146 3300031548 Ga0307408_100201794 Ga0307408_1002017942 232
147 3300031548 Ga0307408_100725471 Ga0307408_1007254712 232
148 3300031731 Ga0307405_10035839 Ga0307405_100358394 232
149 3300031824 Ga0307413_10128785 Ga0307413_101287852 232
150 3300031824 Ga0307413_10405193 Ga0307413_104051931 232
151 3300031852 Ga0307410_10637287 Ga0307410_106372871 232
152 3300031901 Ga0307406_10206443 Ga0307406_102064432 232
153 3300031903 Ga0307407_10052521 Ga0307407_100525213 232
154 3300031911 Ga0307412_10142857 Ga0307412_101428573 232
155 3300031995 Ga0307409_100018526 Ga0307409_1000185263 232
156 3300032002 Ga0307416_100114003 Ga0307416_1001140033 232
157 3300032002 Ga0307416_100127266 Ga0307416_1001272662 232
158 3300032002 Ga0307416_100625634 Ga0307416_1006256341 232
159 3300032004 Ga0307414_10486855 Ga0307414_104868552 232
160 3300032005 Ga0307411_10038342 Ga0307411_100383421 232
161 3300032005 Ga0307411_10360260 Ga0307411_103602602 232
162 3300032126 Ga0307415_100021862 Ga0307415_1000218625 232
163 3300032126 Ga0307415_100433192 Ga0307415_1004331923 232
164 3300039437 Ga0436365_0089675 Ga0436365_0089675_74_775 232
165 3300041410 Ga0439461_0000368 Ga0439461_0000368_4616_5314 232
166 3300041491 Ga0451833_1114430 Ga0451833_1114430_1158_1862 232
167 3300041501 Ga0451845_0296868 Ga0451845_0296868_171_875 232
168 3300041512 Ga0451853_2689812 Ga0451853_2689812_153_857 232
169 3300041997 Ga0439431_0004302 Ga0439431_0004302_1266_1964 232
170 3300042125 Ga0450923_001888 Ga0450923_001888_2077_2775 232
171 3300042125 Ga0450923_002786 Ga0450923_002786_1069_1788 232
172 3300042128 Ga0450897_007272 Ga0450897_007272_64_774 232
173 3300042133 Ga0450896_002484 Ga0450896_002484_667_1386 232
174 3300042156 Ga0439446_0000150 Ga0439446_0000150_8672_9370 232
175 3300042435 Ga0439434_0000316 Ga0439434_0000316_7335_8033 232
176 3300042436 Ga0439435_0000128 Ga0439435_0000128_116_814 232
177 3300042437 Ga0439444_0002053 Ga0439444_0002053_557_1255 232
178 3300042530 Ga0450916_025395 Ga0450916_025395_90_788 232
179 3300042876 Ga0451577_0076770 Ga0451577_0076770_751_1458 232
180 3300044901 Ga0466960_0021837 Ga0466960_0021837_311_1021 232
181 3300045049 Ga0466959_0011312 Ga0466959_0011312_4762_5466 232
182 3300045049 Ga0466959_0231854 Ga0466959_0231854_469_1254 232
183 3300046472 Ga0495580_0093662 Ga0495580_0093662_272_970 232
184 3300046648 Ga0495611_0175354 Ga0495611_0175354_66_767 232
185 3300048088 Ga0495602_0388384 Ga0495602_0388384_63_767 232
186 3300048907 Ga0496104_0016081 Ga0496104_0016081_4396_5100 232
187 3300048908 Ga0496105_0016568 Ga0496105_0016568_897_1601 232
188 3300048911 Ga0496108_0636707 Ga0496108_0636707_44_748 232
189 3300048914 Ga0496111_0008249 Ga0496111_0008249_4840_5544 232
190 3300048929 Ga0496126_0012085 Ga0496126_0012085_6125_6826 232
191 3300049568 Ga0501031_0052861 Ga0501031_0052861_784_1482 232
192 3300049569 Ga0501032_0000195 Ga0501032_0000195_23165_23863 232
193 3300049569 Ga0501032_0008834 Ga0501032_0008834_1241_1939 232
194 3300049569 Ga0501032_0096333 Ga0501032_0096333_281_979 232
195 3300049569 Ga0501032_0145263 Ga0501032_0145263_113_811 232
196 3300049570 Ga0501033_0040440 Ga0501033_0040440_169_867 232
197 3300049570 Ga0501033_0082390 Ga0501033_0082390_827_1537 232
198 3300049570 Ga0501033_0320555 Ga0501033_0320555_106_804 232
199 3300049571 Ga0501034_0079912 Ga0501034_0079912_79_777 232
200 3300049571 Ga0501034_0740676 Ga0501034_0740676_61_768 232
201 3300049572 Ga0501036_0032140 Ga0501036_0032140_158_856 232
202 3300049572 Ga0501036_0060166 Ga0501036_0060166_1102_1800 232
203 3300049572 Ga0501036_0089718 Ga0501036_0089718_1868_2575 232
204 3300049572 Ga0501036_0121100 Ga0501036_0121100_1210_1908 232
205 3300049572 Ga0501036_0246663 Ga0501036_0246663_309_1016 232
206 3300049574 Ga0501038_0009495 Ga0501038_0009495_3291_3989 232
207 3300049574 Ga0501038_0016210 Ga0501038_0016210_5902_6600 232
208 3300049574 Ga0501038_0103710 Ga0501038_0103710_1519_2217 232
209 3300049574 Ga0501038_0210795 Ga0501038_0210795_374_1081 232
210 3300049575 Ga0501039_0037543 Ga0501039_0037543_398_1096 232
211 3300049575 Ga0501039_0297214 Ga0501039_0297214_80_778 232
212 3300049575 Ga0501039_0342347 Ga0501039_0342347_428_1135 232
213 3300049578 Ga0501042_0078841 Ga0501042_0078841_1302_2012 232
214 3300049578 Ga0501042_0161013 Ga0501042_0161013_234_941 232
215 3300049579 Ga0501043_0096925 Ga0501043_0096925_614_1312 232
216 3300049579 Ga0501043_0233059 Ga0501043_0233059_398_1096 232
217 3300049579 Ga0501043_0271904 Ga0501043_0271904_313_1011 232
218 3300049579 Ga0501043_0485552 Ga0501043_0485552_146_844 232
219 3300049580 Ga0501046_0014062 Ga0501046_0014062_5903_6601 232
220 3300049580 Ga0501046_0350495 Ga0501046_0350495_142_849 232
221 3300049581 Ga0501047_0009664 Ga0501047_0009664_6445_7143 232
222 3300049582 Ga0501048_0005538 Ga0501048_0005538_891_1661 232
223 3300049582 Ga0501048_0139609 Ga0501048_0139609_381_1079 232
224 3300049583 Ga0501067_0189141 Ga0501067_0189141_156_854 232
225 3300049584 Ga0501068_0001088 Ga0501068_0001088_1184_1882 232
226 3300049584 Ga0501068_0023192 Ga0501068_0023192_86_790 232
227 3300049584 Ga0501068_0176420 Ga0501068_0176420_129_827 232
228 3300049587 Ga0501071_0039057 Ga0501071_0039057_1266_2036 232
229 3300049587 Ga0501071_0090100 Ga0501071_0090100_910_1608 232
230 3300049589 Ga0501073_0060295 Ga0501073_0060295_67_774 232
231 3300049589 Ga0501073_0107180 Ga0501073_0107180_664_1368 232
232 3300049590 Ga0501074_0154272 Ga0501074_0154272_112_816 232
233 3300049590 Ga0501074_0185779 Ga0501074_0185779_20_790 232
234 3300049591 Ga0501075_0002597 Ga0501075_0002597_8154_8861 232
235 3300049592 Ga0501076_0001209 Ga0501076_0001209_14376_15083 232
236 3300049592 Ga0501076_0085877 Ga0501076_0085877_1298_2002 232
237 3300049593 Ga0501077_0000709 Ga0501077_0000709_11168_11872 232
238 3300049741 Ga0501079_0014114 Ga0501079_0014114_5223_5930 232
239 3300049742 Ga0501080_0003968 Ga0501080_0003968_1320_2024 232
240 3300049744 Ga0501083_0509578 Ga0501083_0509578_11_718 232
241 3300049822 Ga0501035_0000827 Ga0501035_0000827_26167_26865 232
242 3300049822 Ga0501035_0044581 Ga0501035_0044581_1513_2211 232
243 3300049822 Ga0501035_0055517 Ga0501035_0055517_178_876 232
244 3300049823 Ga0501044_0000248 Ga0501044_0000248_15348_16046 232
245 3300049823 Ga0501044_0004061 Ga0501044_0004061_1165_1863 232
246 3300050511 nmdc:mga08y16_126180_c1 nmdc:mga08y16_126180_c1_1271_1969 232
247 3300050511 nmdc:mga08y16_281615_c1 nmdc:mga08y16_281615_c1_680_1378 232
248 3300050512 nmdc:mga0n895_8458_c1 nmdc:mga0n895_8458_c1_3692_4390 232
249 3300050513 nmdc:mga0rr50_43133_c1 nmdc:mga0rr50_43133_c1_313_1011 232
250 3300050515 nmdc:mga0a205_16315_c1 nmdc:mga0a205_16315_c1_3805_4503 232
251 3300053096 Ga0500641_0101237 Ga0500641_0101237_506_1213 232
252 3300053153 Ga0500616_0000155 Ga0500616_0000155_67567_68274 232
253 3300054114 Ga0501084_0005979 Ga0501084_0005979_8001_8705 232
254 3300054114 Ga0501084_0032463 Ga0501084_0032463_1254_1961 232
255 3300060353 Ga0501082_0002806 Ga0501082_0002806_5098_5802 232
256 3300060353 Ga0501082_0023899 Ga0501082_0023899_1437_2207 232
257 3300061734 Ga0530510_0020322 Ga0530510_0020322_3062_3769 232
258 3300061734 Ga0530510_0274822 Ga0530510_0274822_364_1071 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

144

229

0.99

PF02678

Pirin

Pirin

3

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9715 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9659 1 232
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9552 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9537 1 232
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8406 34 120
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9862 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9799 11 135 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9719 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9701 13 131 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9566 144 232 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5E7G0Y5-F1-model_v4 deleted 0.9984 113 231
AF-A0A519EHU1-F1-model_v4 Quercetin 2,3-dioxygenase 0.9974 140 231 GO:0051213
AF-A0A2A4EY53-F1-model_v4 Quercetin 2,3-dioxygenase 0.9972 1 232 GO:0046872
GO:0051213
AF-A0A829YCW0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9969 1 231 GO:0051213
AF-A0A1H6TRA1-F1-model_v4 Quercetin 2,3-dioxygenase 0.9968 1 231 GO:0046872

Feature Viewer

pLDDT pTM Quality
95.84 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map