F367532

General Info

Members Datasets Scaffolds Average Seq Length
257 169 514 202

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0037230|Ga0495582_0037230_1621_2343
Length 240
Sequence LDRALSNDHLVGITAQAHYAALMSMLTPPGMGGQYRITGDKYPRMRRPRRRGRLVLMVVASVAVLGVGGWGTLQLIDVFTGGGKQAAAAGPKADCATKASPSASTGTSTDSTVPKPAQITVNVYNATPRSGLAKSTADELKKRGFKIGDVGNASAQWDKKVKGTGVLLGPAASLDTSLPVLATQLTGAERRTEATRKGSTVDLIIGTAFKDLTAKAAADKALAALAGPEPTASASPKACS

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
30 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
35 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
36 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
37 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
38 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
39 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
47 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
48 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
75 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
132 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
133 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
138 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
139 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
140 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
141 2643221647 Streptomyces sp. Root369 Isolate Unclassified
142 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
143 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
144 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
145 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
146 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
147 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
148 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
149 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
150 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
151 2867428634 Streptomyces sp. RP5T Isolate Unclassified
152 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
153 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
154 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
155 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
156 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
157 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
158 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
159 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
160 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
161 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
162 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
163 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
164 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
165 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
166 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
167 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
169 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.77
Metatranscriptomes 0.39
Isolates 12.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0.39
Rhizoplane 0.39
Rhizosphere 87.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0037230 3300046473 Bacteria 2676
2 JGI24738J21930_10014199 3300002075 Bacteria 1712
3 JGI25160J50197_1029098 3300003354 Bacteria 1469
4 Ga0006562J51391_1123115 3300003578 Bacteria 1480
5 Ga0070670_100333289 3300005331 Bacteria 1331
6 Ga0070672_100412856 3300005543 Bacteria 1158
7 Ga0068855_100296296 3300005563 Bacteria 1792
8 Ga0068856_100257439 3300005614 Bacteria 1760
9 Ga0068852_100208463 3300005616 Bacteria 1853
10 Ga0068860_100953014 3300005843 Bacteria 875
11 Ga0070715_10068626 3300006163 Bacteria 1577
12 Ga0105245_10075510 3300009098 Bacteria 3069
13 Ga0105243_10258544 3300009148 Bacteria 1558
14 Ga0105248_10188797 3300009177 Bacteria 2322
15 Ga0105238_10355402 3300009551 Bacteria 1454
16 Ga0157369_10044925 3300013105 Bacteria 4807
17 Ga0207426_1001729 3300025302 Bacteria 16693
18 Ga0207647_10007139 3300025904 Bacteria 8101
19 Ga0207694_10205277 3300025924 Bacteria 1604
20 Ga0207711_10261956 3300025941 Bacteria 1589
21 Ga0207667_10220238 3300025949 Bacteria 1944
22 Ga0207702_10119157 3300026078 Bacteria 2359
23 Ga0207674_10438023 3300026116 Bacteria 1263
24 Ga0207698_10194127 3300026142 Bacteria 1812
25 Ga0268266_10287624 3300028379 Bacteria 1530
26 Ga0268264_10755778 3300028381 Bacteria 969
27 Ga0307517_10011216 3300028786 Bacteria 12438
28 Ga0307515_10000928 3300028794 Bacteria 67239
29 Ga0307511_10000945 3300030521 Bacteria 30807
30 Ga0307511_10028071 3300030521 Bacteria 5120
31 Ga0307512_10042429 3300030522 Bacteria 3767
32 Ga0307508_10226263 3300031616 Bacteria 1469
33 Ga0307516_10124188 3300031730 Bacteria 2368
34 Ga0307413_10428470 3300031824 Bacteria 1044
35 Ga0307507_10007659 3300033179 Bacteria 15491
36 Ga0307507_10051559 3300033179 Bacteria 3958
37 Ga0307507_10084714 3300033179 Bacteria 2761
38 Ga0451841_0290531 3300041498 Bacteria 1050
39 Ga0439448_0002250 3300042005 Bacteria 5217
40 Ga0439455_0045502 3300042012 Bacteria 1135
41 Ga0450903_000370 3300042138 Bacteria 9791
42 Ga0439458_0000095 3300042157 Bacteria 17129
43 Ga0466969_0030830 3300044656 Bacteria 2731
44 Ga0466969_0110378 3300044656 Bacteria 1288
45 Ga0466972_0004986 3300044658 Bacteria 6660
46 Ga0466972_0064478 3300044658 Bacteria 1753
47 Ga0466972_0113998 3300044658 Bacteria 1276
48 Ga0466972_0414590 3300044658 Bacteria 632
49 Ga0466965_0022131 3300044683 Bacteria 3064
50 Ga0466965_0120404 3300044683 Bacteria 1355
51 Ga0466966_0004196 3300044684 Bacteria 9515
52 Ga0466966_0004723 3300044684 Bacteria 8963
53 Ga0466966_0455306 3300044684 Bacteria 769
54 Ga0466961_0001990 3300044693 Bacteria 12714
55 Ga0466961_0278668 3300044693 Bacteria 1023
56 Ga0466963_0000690 3300044694 Bacteria 16420
57 Ga0466963_0683735 3300044694 Bacteria 724
58 Ga0466964_0001649 3300044706 Bacteria 7713
59 Ga0466971_0000277 3300044719 Bacteria 19725
60 Ga0466971_0053812 3300044719 Bacteria 1814
61 Ga0466968_0423569 3300044735 Bacteria 655
62 Ga0466970_0015835 3300044765 Bacteria 3881
63 Ga0466970_0198398 3300044765 Bacteria 1116
64 Ga0466957_0005359 3300044842 Bacteria 7201
65 Ga0466960_0003953 3300044901 Bacteria 5758
66 Ga0466960_0597221 3300044901 Bacteria 655
67 Ga0466959_0000619 3300045049 Bacteria 20595
68 Ga0466959_0136631 3300045049 Bacteria 1735
69 Ga0466958_0000999 3300045836 Bacteria 12806
70 Ga0466967_0003397 3300045976 Bacteria 10378
71 Ga0466967_0010753 3300045976 Bacteria 6881
72 Ga0466967_0096003 3300045976 Bacteria 2703
73 Ga0466967_0391805 3300045976 Bacteria 1350
74 Ga0495592_0001071 3300046454 Bacteria 18930
75 Ga0495592_0026784 3300046454 Bacteria 4370
76 Ga0495592_0045694 3300046454 Bacteria 3266
77 Ga0495603_0026005 3300046455 Bacteria 3538
78 Ga0495603_0031025 3300046455 Bacteria 3217
79 Ga0495603_0053873 3300046455 Bacteria 2386
80 Ga0495629_0002230 3300046459 Bacteria 14936
81 Ga0495629_0046429 3300046459 Bacteria 3046
82 Ga0495629_0067314 3300046459 Bacteria 2499
83 Ga0495629_0088454 3300046459 Bacteria 2160
84 Ga0495629_0131059 3300046459 Bacteria 1746
85 Ga0495629_0276398 3300046459 Bacteria 1153
86 Ga0495638_0028584 3300046460 Bacteria 3599
87 Ga0495641_0241749 3300046461 Bacteria 811
88 Ga0495651_0008657 3300046462 Bacteria 7808
89 Ga0495651_0014295 3300046462 Bacteria 6135
90 Ga0495651_0154212 3300046462 Bacteria 1652
91 Ga0495580_0028295 3300046472 Bacteria 4075
92 Ga0495582_0011699 3300046473 Bacteria 4836
93 Ga0495605_0031970 3300046474 Bacteria 2683
94 Ga0495662_0000395 3300046476 Bacteria 19477
95 Ga0495662_0027632 3300046476 Bacteria 2740
96 Ga0495662_0134432 3300046476 Bacteria 1216
97 Ga0495662_0278653 3300046476 Bacteria 823
98 Ga0495664_0003661 3300046477 Bacteria 8374
99 Ga0495607_0038836 3300046501 Bacteria 2848
100 Ga0495583_0034018 3300046506 Bacteria 2446
101 Ga0495606_0023817 3300046507 Bacteria 4426
102 Ga0495608_0210523 3300046511 Bacteria 1222
103 Ga0495616_0039824 3300046513 Bacteria 2404
104 Ga0495618_0110794 3300046514 Bacteria 1757
105 Ga0495620_0024173 3300046515 Bacteria 2893
106 Ga0495620_0096780 3300046515 Bacteria 1179
107 Ga0495628_0043565 3300046516 Bacteria 3573
108 Ga0495628_0098168 3300046516 Bacteria 2262
109 Ga0495630_0392308 3300046517 Bacteria 1063
110 Ga0495631_0002725 3300046518 Bacteria 9797
111 Ga0495643_0095948 3300046522 Bacteria 1525
112 Ga0495648_0168380 3300046524 Bacteria 1125
113 Ga0495652_0006068 3300046529 Bacteria 11300
114 Ga0495652_0020054 3300046529 Bacteria 5947
115 Ga0495652_0038643 3300046529 Bacteria 4133
116 Ga0495654_0008607 3300046530 Bacteria 5626
117 Ga0495665_0167332 3300046531 Bacteria 1145
118 Ga0495640_0008509 3300046533 Bacteria 8042
119 Ga0495640_0024854 3300046533 Bacteria 4352
120 Ga0495586_0114532 3300046535 Bacteria 1503
121 Ga0495587_0006149 3300046536 Bacteria 7835
122 Ga0495609_0022331 3300046538 Bacteria 2914
123 Ga0495597_0036792 3300046542 Bacteria 2201
124 Ga0495645_0036041 3300046543 Bacteria 3606
125 Ga0495645_0149334 3300046543 Bacteria 1625
126 Ga0495622_0166546 3300046557 Bacteria 992
127 Ga0495633_0016937 3300046558 Bacteria 3739
128 Ga0495667_0096114 3300046559 Bacteria 1918
129 Ga0495668_0040418 3300046616 Bacteria 2600
130 Ga0495668_0042153 3300046616 Bacteria 2541
131 Ga0495634_0004279 3300046642 Bacteria 11254
132 Ga0495634_0008573 3300046642 Bacteria 7593
133 Ga0495635_0000602 3300046663 Bacteria 23157
134 Ga0495635_0039840 3300046663 Bacteria 3249
135 Ga0495635_0575665 3300046663 Bacteria 737
136 Ga0495661_0062378 3300046665 Bacteria 2208
137 Ga0495588_0061565 3300046674 Bacteria 1944
138 Ga0495588_0096057 3300046674 Bacteria 1554
139 Ga0495657_0002744 3300046675 Bacteria 14684
140 Ga0495657_0037131 3300046675 Bacteria 3360
141 Ga0495657_0084761 3300046675 Bacteria 2043
142 Ga0495657_0156588 3300046675 Bacteria 1411
143 Ga0495646_0000580 3300046680 Bacteria 19850
144 Ga0495613_0005135 3300046689 Bacteria 9824
145 Ga0495613_0011930 3300046689 Bacteria 6459
146 Ga0495613_0038222 3300046689 Bacteria 3557
147 Ga0495613_0054568 3300046689 Bacteria 2937
148 Ga0495624_0170677 3300046690 Bacteria 1327
149 Ga0495624_0196796 3300046690 Bacteria 1225
150 Ga0495671_0007790 3300046692 Bacteria 6066
151 Ga0495671_0112896 3300046692 Bacteria 1327
152 Ga0495649_0021093 3300046694 Bacteria 3652
153 Ga0495589_0049325 3300046794 Bacteria 2083
154 Ga0495589_0112356 3300046794 Bacteria 1314
155 Ga0495600_0009202 3300046809 Bacteria 6094
156 Ga0495600_0010174 3300046809 Bacteria 5828
157 Ga0495600_0139982 3300046809 Bacteria 1570
158 Ga0495600_0237168 3300046809 Bacteria 1163
159 Ga0495660_0068181 3300046810 Bacteria 1893
160 Ga0495660_0122689 3300046810 Bacteria 1312
161 Ga0495581_0002329 3300047315 Bacteria 10703
162 Ga0495581_0119029 3300047315 Bacteria 1537
163 Ga0495581_0259888 3300047315 Bacteria 1015
164 Ga0495581_0370424 3300047315 Bacteria 836
165 Ga0495604_0004679 3300047317 Bacteria 10852
166 Ga0495604_0109848 3300047317 Bacteria 2012
167 Ga0495604_0222261 3300047317 Bacteria 1299
168 Ga0495636_0013873 3300047318 Bacteria 3200
169 Ga0495674_0200614 3300047319 Bacteria 1655
170 Ga0495672_0285428 3300047320 Bacteria 787
171 Ga0495676_0007131 3300047321 Bacteria 10258
172 Ga0495676_0086840 3300047321 Bacteria 2352
173 Ga0495676_0105249 3300047321 Bacteria 2080
174 Ga0495680_0034020 3300047322 Bacteria 4122
175 Ga0495683_0037233 3300047323 Bacteria 2467
176 Ga0495683_0113944 3300047323 Bacteria 1288
177 Ga0495687_002133 3300047443 Bacteria 16528
178 Ga0495687_063815 3300047443 Bacteria 1506
179 Ga0495687_071384 3300047443 Bacteria 1391
180 Ga0495687_121384 3300047443 Bacteria 942
181 Ga0495675_0101574 3300047444 Bacteria 1799
182 Ga0495675_0105371 3300047444 Bacteria 1762
183 Ga0495675_0111691 3300047444 Bacteria 1706
184 Ga0495675_0139003 3300047444 Bacteria 1506
185 Ga0495685_035912 3300047447 Bacteria 1702
186 Ga0495685_052225 3300047447 Bacteria 1385
187 Ga0495685_072283 3300047447 Bacteria 1154
188 Ga0495673_0025181 3300047469 Bacteria 2861
189 Ga0495681_0001458 3300047470 Bacteria 17698
190 Ga0495681_0019064 3300047470 Bacteria 3758
191 Ga0495684_0055966 3300047471 Bacteria 3008
192 Ga0495686_0088487 3300047472 Bacteria 1882
193 Ga0495593_0000360 3300047673 Bacteria 25155
194 Ga0495593_0031148 3300047673 Bacteria 2915
195 Ga0495602_0013430 3300048088 Bacteria 8371
196 Ga0495614_0006245 3300048089 Bacteria 5357
197 Ga0495614_0015180 3300048089 Bacteria 3359
198 Ga0495614_0382236 3300048089 Bacteria 659
199 Ga0495626_0023905 3300048091 Bacteria 3002
200 Ga0496105_0783710 3300048908 Bacteria 726
201 Ga0501034_0021226 3300049571 Bacteria 6623
202 Ga0501034_0116328 3300049571 Bacteria 2662
203 Ga0501036_0002415 3300049572 Bacteria 14618
204 Ga0501036_0164706 3300049572 Bacteria 1869
205 Ga0501038_0017963 3300049574 Bacteria 6388
206 Ga0501038_0138109 3300049574 Bacteria 1996
207 Ga0501043_0071719 3300049579 Bacteria 2720
208 Ga0501043_0107977 3300049579 Bacteria 2186
209 Ga0501047_0188807 3300049581 Bacteria 1925
210 Ga0501035_0088678 3300049822 Bacteria 2725
211 Ga0501035_0093642 3300049822 Bacteria 2643
212 Ga0501035_0154774 3300049822 Bacteria 1987
213 Ga0501044_0018278 3300049823 Bacteria 7513
214 Ga0501044_0115180 3300049823 Bacteria 2693
215 Ga0501044_0299262 3300049823 Bacteria 1538
216 Ga0501044_0423802 3300049823 Bacteria 1240
217 Ga0495612_0102186 3300053078 Bacteria 1221
218 Ga0500640_010358 3300053095 Bacteria 3767
219 Ga0500553_134949 3300053101 Bacteria 986
220 Ga0500560_004702 3300053107 Bacteria 2938
221 Ga0500572_008087 3300053111 Bacteria 2450
222 Ga0500600_0187597 3300053149 Bacteria 988
223 Ga0466962_0000163 3300061719 Bacteria 28323
224 Ga0466962_0066106 3300061719 Bacteria 1726
225 2585311001 2582581313 Bacteria 10042643
226 2585314432 2582581314 Bacteria 11452267
227 2616700237 2616644814 Bacteria 11555299
228 2616904928 2616644941 Bacteria 8510691
229 2644262984 2643221647 Bacteria 10741251
230 2768642290 2767802112 Bacteria 6465194
231 2785369856 2784746768 Bacteria 10036182
232 2786670937 2786546132 Bacteria 10419719
233 2808920875 2808606375 Bacteria 9466072
234 2812357753 2811994879 Bacteria 9313447
235 2812480239 2811994917 Bacteria 7761064
236 2862179051 2862178590 Bacteria 8583590
237 2862285973 2862281513 Bacteria 9621493
238 2862508014 2862507626 Bacteria 9425308
239 2867437108 2867428634 Bacteria 9590268
240 2877680775 2877676314 Bacteria 9512378
241 2946068118 2946064051 Bacteria 8957905
242 2954385880 2954380949 Bacteria 10050426
243 2954677263 2954673503 Bacteria 9685905
244 2954686892 2954682443 Bacteria 9862841
245 2954696539 2954691527 Bacteria 10720516
246 2954705747 2954701450 Bacteria 10834262
247 2954715901 2954711539 Bacteria 10867210
248 2954725823 2954721474 Bacteria 10456478
249 2954735979 2954731030 Bacteria 10243860
250 2954744778 2954740390 Bacteria 10229294
251 2954754821 2954749733 Bacteria 10366972
252 2954763741 2954759201 Bacteria 9358192
253 2997459199 2997451912 Bacteria 8492419
254 3006393912 3006393351 Bacteria 6615579
255 8008566935 8008558824 Bacteria 10610750
256 8008578606 8008574985 Bacteria 7815457
257 8056833362 8056829672 Bacteria 9045328
258 Ga0495582_0037230
259 JGI24738J21930_10014199
260 JGI25160J50197_1029098
261 Ga0006562J51391_1123115
262 Ga0070670_100333289
263 Ga0070672_100412856
264 Ga0068855_100296296
265 Ga0068856_100257439
266 Ga0068852_100208463
267 Ga0068860_100953014
268 Ga0070715_10068626
269 Ga0105245_10075510
270 Ga0105243_10258544
271 Ga0105248_10188797
272 Ga0105238_10355402
273 Ga0157369_10044925
274 Ga0207426_1001729
275 Ga0207647_10007139
276 Ga0207694_10205277
277 Ga0207711_10261956
278 Ga0207667_10220238
279 Ga0207702_10119157
280 Ga0207674_10438023
281 Ga0207698_10194127
282 Ga0268266_10287624
283 Ga0268264_10755778
284 Ga0307517_10011216
285 Ga0307515_10000928
286 Ga0307511_10000945
287 Ga0307511_10028071
288 Ga0307512_10042429
289 Ga0307508_10226263
290 Ga0307516_10124188
291 Ga0307413_10428470
292 Ga0307507_10007659
293 Ga0307507_10051559
294 Ga0307507_10084714
295 Ga0451841_0290531
296 Ga0439448_0002250
297 Ga0439455_0045502
298 Ga0450903_000370
299 Ga0439458_0000095
300 Ga0466969_0030830
301 Ga0466969_0110378
302 Ga0466972_0004986
303 Ga0466972_0064478
304 Ga0466972_0113998
305 Ga0466972_0414590
306 Ga0466965_0022131
307 Ga0466965_0120404
308 Ga0466966_0004196
309 Ga0466966_0004723
310 Ga0466966_0455306
311 Ga0466961_0001990
312 Ga0466961_0278668
313 Ga0466963_0000690
314 Ga0466963_0683735
315 Ga0466964_0001649
316 Ga0466971_0000277
317 Ga0466971_0053812
318 Ga0466968_0423569
319 Ga0466970_0015835
320 Ga0466970_0198398
321 Ga0466957_0005359
322 Ga0466960_0003953
323 Ga0466960_0597221
324 Ga0466959_0000619
325 Ga0466959_0136631
326 Ga0466958_0000999
327 Ga0466967_0003397
328 Ga0466967_0010753
329 Ga0466967_0096003
330 Ga0466967_0391805
331 Ga0495592_0001071
332 Ga0495592_0026784
333 Ga0495592_0045694
334 Ga0495603_0026005
335 Ga0495603_0031025
336 Ga0495603_0053873
337 Ga0495629_0002230
338 Ga0495629_0046429
339 Ga0495629_0067314
340 Ga0495629_0088454
341 Ga0495629_0131059
342 Ga0495629_0276398
343 Ga0495638_0028584
344 Ga0495641_0241749
345 Ga0495651_0008657
346 Ga0495651_0014295
347 Ga0495651_0154212
348 Ga0495580_0028295
349 Ga0495582_0011699
350 Ga0495605_0031970
351 Ga0495662_0000395
352 Ga0495662_0027632
353 Ga0495662_0134432
354 Ga0495662_0278653
355 Ga0495664_0003661
356 Ga0495607_0038836
357 Ga0495583_0034018
358 Ga0495606_0023817
359 Ga0495608_0210523
360 Ga0495616_0039824
361 Ga0495618_0110794
362 Ga0495620_0024173
363 Ga0495620_0096780
364 Ga0495628_0043565
365 Ga0495628_0098168
366 Ga0495630_0392308
367 Ga0495631_0002725
368 Ga0495643_0095948
369 Ga0495648_0168380
370 Ga0495652_0006068
371 Ga0495652_0020054
372 Ga0495652_0038643
373 Ga0495654_0008607
374 Ga0495665_0167332
375 Ga0495640_0008509
376 Ga0495640_0024854
377 Ga0495586_0114532
378 Ga0495587_0006149
379 Ga0495609_0022331
380 Ga0495597_0036792
381 Ga0495645_0036041
382 Ga0495645_0149334
383 Ga0495622_0166546
384 Ga0495633_0016937
385 Ga0495667_0096114
386 Ga0495668_0040418
387 Ga0495668_0042153
388 Ga0495634_0004279
389 Ga0495634_0008573
390 Ga0495635_0000602
391 Ga0495635_0039840
392 Ga0495635_0575665
393 Ga0495661_0062378
394 Ga0495588_0061565
395 Ga0495588_0096057
396 Ga0495657_0002744
397 Ga0495657_0037131
398 Ga0495657_0084761
399 Ga0495657_0156588
400 Ga0495646_0000580
401 Ga0495613_0005135
402 Ga0495613_0011930
403 Ga0495613_0038222
404 Ga0495613_0054568
405 Ga0495624_0170677
406 Ga0495624_0196796
407 Ga0495671_0007790
408 Ga0495671_0112896
409 Ga0495649_0021093
410 Ga0495589_0049325
411 Ga0495589_0112356
412 Ga0495600_0009202
413 Ga0495600_0010174
414 Ga0495600_0139982
415 Ga0495600_0237168
416 Ga0495660_0068181
417 Ga0495660_0122689
418 Ga0495581_0002329
419 Ga0495581_0119029
420 Ga0495581_0259888
421 Ga0495581_0370424
422 Ga0495604_0004679
423 Ga0495604_0109848
424 Ga0495604_0222261
425 Ga0495636_0013873
426 Ga0495674_0200614
427 Ga0495672_0285428
428 Ga0495676_0007131
429 Ga0495676_0086840
430 Ga0495676_0105249
431 Ga0495680_0034020
432 Ga0495683_0037233
433 Ga0495683_0113944
434 Ga0495687_002133
435 Ga0495687_063815
436 Ga0495687_071384
437 Ga0495687_121384
438 Ga0495675_0101574
439 Ga0495675_0105371
440 Ga0495675_0111691
441 Ga0495675_0139003
442 Ga0495685_035912
443 Ga0495685_052225
444 Ga0495685_072283
445 Ga0495673_0025181
446 Ga0495681_0001458
447 Ga0495681_0019064
448 Ga0495684_0055966
449 Ga0495686_0088487
450 Ga0495593_0000360
451 Ga0495593_0031148
452 Ga0495602_0013430
453 Ga0495614_0006245
454 Ga0495614_0015180
455 Ga0495614_0382236
456 Ga0495626_0023905
457 Ga0496105_0783710
458 Ga0501034_0021226
459 Ga0501034_0116328
460 Ga0501036_0002415
461 Ga0501036_0164706
462 Ga0501038_0017963
463 Ga0501038_0138109
464 Ga0501043_0071719
465 Ga0501043_0107977
466 Ga0501047_0188807
467 Ga0501035_0088678
468 Ga0501035_0093642
469 Ga0501035_0154774
470 Ga0501044_0018278
471 Ga0501044_0115180
472 Ga0501044_0299262
473 Ga0501044_0423802
474 Ga0495612_0102186
475 Ga0500640_010358
476 Ga0500553_134949
477 Ga0500560_004702
478 Ga0500572_008087
479 Ga0500600_0187597
480 Ga0466962_0000163
481 Ga0466962_0066106
482 2585311001
483 2585314432
484 2616700237
485 2616904928
486 2644262984
487 2768642290
488 2785369856
489 2786670937
490 2808920875
491 2812357753
492 2812480239
493 2862179051
494 2862285973
495 2862508014
496 2867437108
497 2877680775
498 2946068118
499 2954385880
500 2954677263
501 2954686892
502 2954696539
503 2954705747
504 2954715901
505 2954725823
506 2954735979
507 2954744778
508 2954754821
509 2954763741
510 2997459199
511 3006393912
512 8008566935
513 8008578606
514 8056833362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13399

LytR_C

LytR cell envelope-related transcriptional attenuator

118

209

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q10-assembly1.cif.gz_A crystal structure of the soluble domain (residues 71-217) of a conserved hypothetical secreted protein (rv2700 ortholog) from mycobacterium marinum 0.8737 64 175
4fq5-assembly1.cif.gz_B crystal structure of the maleate isomerase iso(c200a) from pseudomonas putida s16 with maleate 0.7358 71 103
2msw-assembly1.cif.gz_A ligand-induced folding of a receiver domain 0.684 71 107
6q10-assembly1.cif.gz_A crystal structure of the soluble domain (residues 71-217) of a conserved hypothetical secreted protein (rv2700 ortholog) from mycobacterium marinum 0.6649 64 175
5iva-assembly1.cif.gz_B the lps transporter lptde from pseudomonas aeruginosa, core complex 0.6623 71 105
ID Description Score Start End Superfamily
af_P96872_363_446_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.887 70 155 3.30.70.2390
af_I6WZI4_556_638_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8809 70 156 3.30.70.2390
af_P96872_363_446_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8581 70 155 3.30.70.2390
af_I6WZI4_556_638_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8516 70 156 3.30.70.2390
af_E1JH39_180_275_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.8424 67 100 3.40.50.10190
ID Description Score Start End GO Terms
AF-A0A6G3V8X4-F1-model_v4 deleted 0.9743 82 175
AF-A0A3N2FH30-F1-model_v4 LytR cell envelope-related transcriptional attenuator 0.972 64 168
AF-A0A0Q9SNM5-F1-model_v4 LytR/CpsA/Psr regulator C-terminal domain-containing protein 0.9617 64 164
AF-A0A5Q2VVT1-F1-model_v4 LytR family transcriptional regulator 0.9598 64 168 GO:0016020
AF-A0A560WDQ7-F1-model_v4 LytR cell envelope-related transcriptional attenuator 0.9576 64 165 GO:0016020

Map