F367271

General Info

Members Datasets Scaffolds Average Seq Length
257 163 254 795

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10032432|Ga0105241_100324324
Length 866
Sequence MDKRSGEKSFSVYVALFCHSYRKTCSSPEIHFIRRNMRIVLSTNRKTIIMRRLALLPVACFLAMSVFAQQVTGNIKDQQGKALSGSTVSLLNAKDSSVVKLAASNNNGAYTFNGIKPGTYIVKISHVGYAPVYSDRFEYSGAGDMNVSALQVSKTTGDLKEVVVSSKRPMVEVKADKTILNVEGTINSVGTDALELLRKSPGVMVDKDDNISLSGKNGVQVYIDGRPTPLSGKDLSDYLKSLQSAQIESIEIITNPSAKYDAAGNAGIINIRLKKNKSFGTNGSVNAGYGIGIYPKYNGGLSLNHRNNKVNIFGNYTFNDNINESYMKLHREQLDTLFDQKSTIHMKNVSHGYKGGLDYFLNKYNTVGFIVSGNSTNFNFGNYSRTPISYIPTGVVDRILVADNSSKSKRNNTDFNLNYRFADTSGHELNVDGDYAFYRIKSNQFQPNYYFDPTGNTQTNQFIYDMIAPTNIDMYTGKADYEQNFKKGKLGLGVKSSYVKSGNDFERYNVYSNTKQLDTLRSNGFNYKENINAVYANYNRSFKGFMIQAGLRVENTNSQGRSTGQKLNGAEYVDYDSTFNRHYTDFFPSAAVTYNKNPKNQWSLTYSRRIDRPAYQDLNPFEFKLDEYTYQKGNTGLRPQYTNSIGLTNTYKFKLTSTLNYSHVKDVFTQLVDTADRSKAFITKKNLATQDIVSLNISYPFNYKWYSAFVNVNTYYSRYKANFGGGDRTINLDVVAATFYMQNSFNLGKGWTGELSGWYSTPSIWQGTFKSSQIGSVDGGFQKTLFKGKVNAKASVSDIFKTIKWKGTSDFSGQKTIASGGFDSRVFKINITYRFGNNNVKASRQRKTGVEDESKRVGSQGGGLQQ

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
147 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
150 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
151 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 0
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 7.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000732 3300003203 Bacteria 15328
2 rootH2_10027557 3300003320 Bacteria 9653
3 rootH2_10027987 3300003320 Unclassified 3093
4 rootH2_10083512 3300003320 Bacteria 9358
5 rootH2_10085969 3300003320 Bacteria 6700
6 rootL2_10059606 3300003322 Bacteria 3668
7 rootH1_10003347 3300003323 Bacteria 19564
8 rootH1_10032948 3300003323 Bacteria 4175
9 JGI25160J50197_1001007 3300003354 Bacteria 14612
10 Ga0070658_10025987 3300005327 Bacteria 4698
11 Ga0070683_100000717 3300005329 Bacteria 24153
12 Ga0070683_100022282 3300005329 Bacteria 5659
13 Ga0070670_100039643 3300005331 Bacteria 4050
14 Ga0070677_10004086 3300005333 Bacteria 4735
15 Ga0068869_100012061 3300005334 Bacteria 5696
16 Ga0070666_10021618 3300005335 Bacteria 4170
17 Ga0070680_100085861 3300005336 Bacteria 2601
18 Ga0070682_100000054 3300005337 Bacteria 112635
19 Ga0068868_100020185 3300005338 Bacteria 5003
20 Ga0070689_100009505 3300005340 Bacteria 6893
21 Ga0070661_100007861 3300005344 Bacteria 7361
22 Ga0070661_100028482 3300005344 Bacteria 4029
23 Ga0070668_100008577 3300005347 Bacteria 7592
24 Ga0070668_100058358 3300005347 Bacteria 2985
25 Ga0070669_100000647 3300005353 Bacteria 25768
26 Ga0070669_100016615 3300005353 Bacteria 5253
27 Ga0070675_100018246 3300005354 Bacteria 5585
28 Ga0070675_100020893 3300005354 Bacteria 5227
29 Ga0070675_100040258 3300005354 Bacteria 3814
30 Ga0070674_100012251 3300005356 Bacteria 5261
31 Ga0070673_100006230 3300005364 Bacteria 7739
32 Ga0070673_100049401 3300005364 Bacteria 3285
33 Ga0070688_100003367 3300005365 Bacteria 8204
34 Ga0070688_100016355 3300005365 Bacteria 4241
35 Ga0070659_100004312 3300005366 Bacteria 10156
36 Ga0070659_100009662 3300005366 Bacteria 7090
37 Ga0070667_100005970 3300005367 Bacteria 10120
38 Ga0070663_100046780 3300005455 Unclassified 3063
39 Ga0070678_100042968 3300005456 Bacteria 3217
40 Ga0068867_100042405 3300005459 Bacteria 3329
41 Ga0070698_100007736 3300005471 Bacteria 11627
42 Ga0070698_100010157 3300005471 Bacteria 10057
43 Ga0070698_100013783 3300005471 Bacteria 8553
44 Ga0070679_100010778 3300005530 Bacteria 8678
45 Ga0070679_100027923 3300005530 Bacteria 5560
46 Ga0070684_100007120 3300005535 Bacteria 8693
47 Ga0068853_100000245 3300005539 Bacteria 38110
48 Ga0068853_100019409 3300005539 Bacteria 5635
49 Ga0070686_100043525 3300005544 Bacteria 2818
50 Ga0070665_100004791 3300005548 Bacteria 14076
51 Ga0068855_100029756 3300005563 Bacteria 6530
52 Ga0070664_100007012 3300005564 Bacteria 9092
53 Ga0070664_100013016 3300005564 Bacteria 6770
54 Ga0068857_100013956 3300005577 Bacteria 6990
55 Ga0068857_100023301 3300005577 Bacteria 5449
56 Ga0068856_100054030 3300005614 Bacteria 3961
57 Ga0068852_100016123 3300005616 Bacteria 5817
58 Ga0068852_100028801 3300005616 Unclassified 4551
59 Ga0068859_100001754 3300005617 Bacteria 22081
60 Ga0068859_100003439 3300005617 Bacteria 16091
61 Ga0068859_100017301 3300005617 Bacteria 7240
62 Ga0068859_100020040 3300005617 Bacteria 6716
63 Ga0068859_100050426 3300005617 Bacteria 4181
64 Ga0068864_100001233 3300005618 Bacteria 21276
65 Ga0068858_100040459 3300005842 Bacteria 4323
66 Ga0068858_100073217 3300005842 Bacteria 3180
67 Ga0068860_100014968 3300005843 Bacteria 7582
68 Ga0068860_100021161 3300005843 Bacteria 6300
69 Ga0068862_100008912 3300005844 Bacteria 8306
70 Ga0068862_100059239 3300005844 Bacteria 3288
71 Ga0081540_1008820 3300005983 Bacteria 7003
72 Ga0081539_10000523 3300005985 Bacteria 79800
73 Ga0081539_10010548 3300005985 Bacteria 7482
74 Ga0075366_10010620 3300006195 Bacteria 5172
75 Ga0097621_100019825 3300006237 Bacteria 5171
76 Ga0068871_100014223 3300006358 Bacteria 5926
77 Ga0068871_100021972 3300006358 Bacteria 4914
78 Ga0075428_100023319 3300006844 Bacteria 6848
79 Ga0075430_100003812 3300006846 Bacteria 12690
80 Ga0075430_100022561 3300006846 Bacteria 5357
81 Ga0075431_100003484 3300006847 Bacteria 15256
82 Ga0075429_100000539 3300006880 Bacteria 28785
83 Ga0075429_100012186 3300006880 Bacteria 7452
84 Ga0097620_100001754 3300006931 Bacteria 22081
85 Ga0097620_100003439 3300006931 Bacteria 16091
86 Ga0097620_100017302 3300006931 Bacteria 7240
87 Ga0097620_100020041 3300006931 Bacteria 6716
88 Ga0097620_100050426 3300006931 Bacteria 4181
89 Ga0105240_10000635 3300009093 Bacteria 64838
90 Ga0105240_10000657 3300009093 Bacteria 63709
91 Ga0105240_10000674 3300009093 Bacteria 62689
92 Ga0111539_10003581 3300009094 Bacteria 20469
93 Ga0111539_10027105 3300009094 Bacteria 6998
94 Ga0105247_10000563 3300009101 Bacteria 30131
95 Ga0114129_10024419 3300009147 Bacteria 8565
96 Ga0105241_10002181 3300009174 Bacteria 14751
97 Ga0105241_10032432 3300009174 Bacteria 3916
98 Ga0105242_10065542 3300009176 Bacteria 2997
99 Ga0105237_10005828 3300009545 Bacteria 13821
100 Ga0105237_10014697 3300009545 Bacteria 8173
101 Ga0105238_10003055 3300009551 Bacteria 16687
102 Ga0105238_10031455 3300009551 Bacteria 5402
103 Ga0105239_10000083 3300010375 Bacteria 132046
104 Ga0105239_10000368 3300010375 Bacteria 66186
105 Ga0105239_10002459 3300010375 Bacteria 23594
106 Ga0105239_10030265 3300010375 Bacteria 5951
107 Ga0157373_10003247 3300013100 Bacteria 12289
108 Ga0157370_10012390 3300013104 Bacteria 8843
109 Ga0157369_10012168 3300013105 Bacteria 9766
110 Ga0157374_10000003 3300013296 Bacteria 854471
111 Ga0157374_10001009 3300013296 Bacteria 24398
112 Ga0157374_10016885 3300013296 Bacteria 6423
113 Ga0157374_10053999 3300013296 Bacteria 3747
114 Ga0157378_10012526 3300013297 Bacteria 7422
115 Ga0157378_10038020 3300013297 Bacteria 4265
116 Ga0163162_10000201 3300013306 Bacteria 55260
117 Ga0163162_10004330 3300013306 Bacteria 13665
118 Ga0163162_10140402 3300013306 Bacteria 2529
119 Ga0157372_10000583 3300013307 Bacteria 39824
120 Ga0157372_10015567 3300013307 Bacteria 8152
121 Ga0157372_10020929 3300013307 Bacteria 7060
122 Ga0157372_10021413 3300013307 Bacteria 6984
123 Ga0157372_10034181 3300013307 Bacteria 5588
124 Ga0157372_10051635 3300013307 Unclassified 4576
125 Ga0157375_10009185 3300013308 Bacteria 8666
126 Ga0157375_10024038 3300013308 Bacteria 5633
127 Ga0157375_10042601 3300013308 Bacteria 4395
128 Ga0163163_10000057 3300014325 Bacteria 124939
129 Ga0163163_10004186 3300014325 Bacteria 12293
130 Ga0157380_10005405 3300014326 Bacteria 8925
131 Ga0157377_10001104 3300014745 Bacteria 11407
132 Ga0157377_10005977 3300014745 Bacteria 5766
133 Ga0157376_10046167 3300014969 Bacteria 3591
134 Ga0157376_10059992 3300014969 Unclassified 3192
135 Ga0213876_10015827 3300021384 Bacteria 3991
136 Ga0207426_1000132 3300025302 Bacteria 209623
137 Ga0207682_10007427 3300025893 Bacteria 4367
138 Ga0207642_10009632 3300025899 Bacteria 3370
139 Ga0207710_10001194 3300025900 Bacteria 13167
140 Ga0207688_10026276 3300025901 Bacteria 3200
141 Ga0207680_10037474 3300025903 Bacteria 2799
142 Ga0207647_10000222 3300025904 Bacteria 46878
143 Ga0207645_10001508 3300025907 Bacteria 19057
144 Ga0207645_10006529 3300025907 Bacteria 8354
145 Ga0207643_10020288 3300025908 Bacteria 3647
146 Ga0207654_10003217 3300025911 Bacteria 8251
147 Ga0207695_10000446 3300025913 Bacteria 90493
148 Ga0207695_10001024 3300025913 Bacteria 49211
149 Ga0207695_10005590 3300025913 Bacteria 16606
150 Ga0207695_10086798 3300025913 Bacteria 3154
151 Ga0207671_10001755 3300025914 Bacteria 24384
152 Ga0207671_10009364 3300025914 Bacteria 8191
153 Ga0207657_10009387 3300025919 Bacteria 9839
154 Ga0207652_10055705 3300025921 Bacteria 3402
155 Ga0207681_10014500 3300025923 Bacteria 4899
156 Ga0207681_10022738 3300025923 Bacteria 4002
157 Ga0207650_10003475 3300025925 Bacteria 10822
158 Ga0207659_10009312 3300025926 Bacteria 6132
159 Ga0207659_10017534 3300025926 Bacteria 4678
160 Ga0207690_10025350 3300025932 Bacteria 3722
161 Ga0207706_10007644 3300025933 Bacteria 9990
162 Ga0207706_10076911 3300025933 Unclassified 2935
163 Ga0207670_10028787 3300025936 Bacteria 3532
164 Ga0207691_10044585 3300025940 Bacteria 4080
165 Ga0207691_10049325 3300025940 Bacteria 3857
166 Ga0207689_10009681 3300025942 Bacteria 8299
167 Ga0207689_10011165 3300025942 Bacteria 7707
168 Ga0207689_10012158 3300025942 Bacteria 7367
169 Ga0207661_10042158 3300025944 Bacteria 3597
170 Ga0207679_10006376 3300025945 Bacteria 7455
171 Ga0207679_10013066 3300025945 Bacteria 5435
172 Ga0207667_10007925 3300025949 Bacteria 12676
173 Ga0207667_10085801 3300025949 Bacteria 3259
174 Ga0207651_10046213 3300025960 Unclassified 2926
175 Ga0207668_10002565 3300025972 Bacteria 10618
176 Ga0207668_10024549 3300025972 Bacteria 3893
177 Ga0207677_10068547 3300026023 Bacteria 2490
178 Ga0207639_10024464 3300026041 Bacteria 4371
179 Ga0207639_10061937 3300026041 Unclassified 2891
180 Ga0207678_10026455 3300026067 Bacteria 5060
181 Ga0207648_10016275 3300026089 Bacteria 6803
182 Ga0207648_10047678 3300026089 Bacteria 3754
183 Ga0207648_10049943 3300026089 Bacteria 3658
184 Ga0207676_10010732 3300026095 Bacteria 6531
185 Ga0207674_10019432 3300026116 Bacteria 7357
186 Ga0207674_10032499 3300026116 Bacteria 5473
187 Ga0207675_100002256 3300026118 Bacteria 19155
188 Ga0207675_100006051 3300026118 Bacteria 11511
189 Ga0207675_100086558 3300026118 Bacteria 2942
190 Ga0207683_10000468 3300026121 Bacteria 37569
191 Ga0207698_10007893 3300026142 Bacteria 6702
192 Ga0207698_10019672 3300026142 Unclassified 4628
193 Ga0207428_10009144 3300027907 Bacteria 8902
194 Ga0268265_10023635 3300028380 Bacteria 4335
195 Ga0268264_10001681 3300028381 Bacteria 20386
196 Ga0268264_10010667 3300028381 Bacteria 7591
197 Ga0268264_10012128 3300028381 Bacteria 7095
198 Ga0307517_10037547 3300028786 Bacteria 5404
199 Ga0307515_10000001 3300028794 Bacteria 4259510
200 Ga0307515_10004411 3300028794 Bacteria 29136
201 Ga0307515_10011733 3300028794 Bacteria 16581
202 Ga0265327_10000099 3300031251 Bacteria 190474
203 Ga0307516_10001823 3300031730 Bacteria 29270
204 Ga0307410_10024792 3300031852 Bacteria 3753
205 Ga0307507_10000071 3300033179 Bacteria 158391
206 Ga0307510_10000042 3300033180 Bacteria 100951
207 Ga0436365_1889064 3300039437 Bacteria 17551
208 Ga0466972_0000016 3300044658 Bacteria 208802
209 Ga0466972_0000123 3300044658 Bacteria 65577
210 Ga0466972_0003885 3300044658 Bacteria 7445
211 Ga0466961_0019460 3300044693 Bacteria 4367
212 Ga0466959_0001524 3300045049 Bacteria 14228
213 Ga0495585_0012658 3300046492 Bacteria 4966
214 Ga0495606_0004646 3300046507 Bacteria 13579
215 Ga0495606_0014474 3300046507 Bacteria 6153
216 Ga0495630_0029876 3300046517 Bacteria 4053
217 Ga0495587_0034469 3300046536 Bacteria 3053
218 Ga0495633_0000015 3300046558 Bacteria 254484
219 Ga0495668_0000041 3300046616 Bacteria 229462
220 Ga0495668_0002730 3300046616 Bacteria 14136
221 Ga0495625_0001528 3300046660 Bacteria 27676
222 Ga0495625_0001551 3300046660 Bacteria 27391
223 Ga0495672_0012478 3300047320 Bacteria 5927
224 Ga0501300_002407 3300049523 Bacteria 2799
225 Ga0501032_0021501 3300049569 Bacteria 4483
226 Ga0501034_0000007 3300049571 Bacteria 357805
227 Ga0501034_0016834 3300049571 Bacteria 7496
228 Ga0501036_0004307 3300049572 Bacteria 11494
229 Ga0501038_0046149 3300049574 Bacteria 3778
230 Ga0501046_0033176 3300049580 Bacteria 4174
231 Ga0501047_0046730 3300049581 Bacteria 4183
232 Ga0501070_0037058 3300049586 Bacteria 4071
233 Ga0501072_0010433 3300049588 Bacteria 7080
234 Ga0501073_0000302 3300049589 Bacteria 32545
235 Ga0501201_000387 3300049651 Bacteria 4052
236 Ga0501222_002053 3300049662 Bacteria 2787
237 Ga0501235_001211 3300049669 Bacteria 5430
238 Ga0501242_000073 3300049674 Bacteria 6442
239 Ga0501252_000172 3300049682 Bacteria 4110
240 Ga0501259_000486 3300049688 Bacteria 6345
241 Ga0501080_0065998 3300049742 Bacteria 3365
242 Ga0501035_0029492 3300049822 Bacteria 5003
243 Ga0501044_0076382 3300049823 Bacteria 3400
244 Ga0501284_00017 3300050005 Bacteria 96362
245 nmdc:mga0k408_462_c1 3300050493 Bacteria 11298
246 nmdc:mga09592_1546_c1 3300050508 Bacteria 18488
247 nmdc:mga0qj67_14639_c1 3300050509 Bacteria 5931
248 nmdc:mga08y16_10001_c1 3300050511 Bacteria 9953
249 nmdc:mga08y16_36495_c1 3300050511 Bacteria 5162
250 Ga0500562_000063 3300053108 Bacteria 52346
251 Ga0500622_0000845 3300053156 Bacteria 26209
252 Ga0500611_000037 3300053727 Bacteria 72513
253 Ga0500611_000083 3300053727 Bacteria 29347
254 Ga0500645_002709 3300053730 Bacteria 7696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10027557 rootH2_100275573 709
2 3300013306 Ga0163162_10004330 Ga0163162_100043308 720
3 3300014745 Ga0157377_10005977 Ga0157377_100059775 720
4 3300025907 Ga0207645_10006529 Ga0207645_100065295 720
5 3300025940 Ga0207691_10044585 Ga0207691_100445854 728
6 3300013307 Ga0157372_10000583 Ga0157372_100005837 730
7 3300044693 Ga0466961_0019460 Ga0466961_0019460_2028_4280 731
8 3300045049 Ga0466959_0001524 Ga0466959_0001524_3366_5618 731
9 3300005364 Ga0070673_100049401 Ga0070673_1000494012 732
10 3300005544 Ga0070686_100043525 Ga0070686_1000435252 732
11 3300013296 Ga0157374_10016885 Ga0157374_100168854 732
12 3300013308 Ga0157375_10024038 Ga0157375_100240385 732
13 3300025903 Ga0207680_10037474 Ga0207680_100374742 732
14 3300005329 Ga0070683_100000717 Ga0070683_10000071716 734
15 3300005338 Ga0068868_100020185 Ga0068868_1000201852 734
16 3300005340 Ga0070689_100009505 Ga0070689_1000095052 734
17 3300005344 Ga0070661_100028482 Ga0070661_1000284821 734
18 3300005365 Ga0070688_100016355 Ga0070688_1000163551 734
19 3300005535 Ga0070684_100007120 Ga0070684_1000071205 734
20 3300005564 Ga0070664_100013016 Ga0070664_1000130164 734
21 3300005577 Ga0068857_100013956 Ga0068857_1000139566 734
22 3300005618 Ga0068864_100001233 Ga0068864_10000123314 734
23 3300005842 Ga0068858_100073217 Ga0068858_1000732172 734
24 3300013296 Ga0157374_10001009 Ga0157374_100010095 734
25 3300013308 Ga0157375_10009185 Ga0157375_100091857 734
26 3300014325 Ga0163163_10000057 Ga0163163_1000005797 734
27 3300025933 Ga0207706_10007644 Ga0207706_100076445 734
28 3300025936 Ga0207670_10028787 Ga0207670_100287872 734
29 3300025942 Ga0207689_10009681 Ga0207689_100096814 734
30 3300025945 Ga0207679_10006376 Ga0207679_100063764 734
31 3300026023 Ga0207677_10068547 Ga0207677_100685471 734
32 3300026067 Ga0207678_10026455 Ga0207678_100264554 734
33 3300026116 Ga0207674_10019432 Ga0207674_100194323 734
34 3300046536 Ga0495587_0034469 Ga0495587_0034469_450_2906 734
35 3300046517 Ga0495630_0029876 Ga0495630_0029876_327_2783 736
36 3300005563 Ga0068855_100029756 Ga0068855_1000297566 740
37 3300005983 Ga0081540_1008820 Ga0081540_10088208 740
38 3300009551 Ga0105238_10031455 Ga0105238_100314552 740
39 3300010375 Ga0105239_10000083 Ga0105239_1000008328 740
40 3300013296 Ga0157374_10000003 Ga0157374_10000003488 740
41 3300014969 Ga0157376_10059992 Ga0157376_100599921 740
42 3300025949 Ga0207667_10007925 Ga0207667_100079259 740
43 3300031852 Ga0307410_10024792 Ga0307410_100247923 740
44 3300046660 Ga0495625_0001528 Ga0495625_0001528_15058_17496 747
45 3300013307 Ga0157372_10015567 Ga0157372_100155672 752
46 3300005530 Ga0070679_100010778 Ga0070679_1000107786 753
47 3300025913 Ga0207695_10086798 Ga0207695_100867981 753
48 3300025921 Ga0207652_10055705 Ga0207652_100557052 753
49 3300003323 rootH1_10003347 rootH1_1000334716 754
50 3300046507 Ga0495606_0004646 Ga0495606_0004646_7352_9748 754
51 3300046507 Ga0495606_0014474 Ga0495606_0014474_796_3255 754
52 3300006195 Ga0075366_10010620 Ga0075366_100106206 757
53 3300046616 Ga0495668_0000041 Ga0495668_0000041_213405_215798 757
54 3300050493 nmdc:mga0k408_462_c1 nmdc:mga0k408_462_c1_1601_4039 757
55 3300005617 Ga0068859_100020040 Ga0068859_1000200406 758
56 3300006931 Ga0097620_100020041 Ga0097620_1000200416 758
57 3300025908 Ga0207643_10020288 Ga0207643_100202882 758
58 3300028380 Ga0268265_10023635 Ga0268265_100236354 758
59 3300006844 Ga0075428_100023319 Ga0075428_1000233194 759
60 3300006846 Ga0075430_100003812 Ga0075430_1000038124 759
61 3300006847 Ga0075431_100003484 Ga0075431_10000348413 759
62 3300010375 Ga0105239_10000368 Ga0105239_1000036822 759
63 3300044658 Ga0466972_0000123 Ga0466972_0000123_17274_19691 759
64 3300050509 nmdc:mga0qj67_14639_c1 nmdc:mga0qj67_14639_c1_441_2903 759
65 3300006880 Ga0075429_100000539 Ga0075429_10000053924 760
66 3300050508 nmdc:mga09592_1546_c1 nmdc:mga09592_1546_c1_9600_12065 760
67 3300005471 Ga0070698_100007736 Ga0070698_10000773610 761
68 3300005471 Ga0070698_100010157 Ga0070698_1000101577 761
69 3300026118 Ga0207675_100002256 Ga0207675_10000225613 761
70 3300046558 Ga0495633_0000015 Ga0495633_0000015_6411_8804 762
71 3300005471 Ga0070698_100013783 Ga0070698_1000137836 764
72 3300009147 Ga0114129_10024419 Ga0114129_100244194 764
73 3300028794 Ga0307515_10011733 Ga0307515_100117338 765
74 3300046492 Ga0495585_0012658 Ga0495585_0012658_1894_4332 766
75 3300046660 Ga0495625_0001551 Ga0495625_0001551_15578_18016 766
76 3300049571 Ga0501034_0016834 Ga0501034_0016834_4768_7230 767
77 3300005347 Ga0070668_100008577 Ga0070668_1000085774 768
78 3300005353 Ga0070669_100000647 Ga0070669_1000006478 768
79 3300005364 Ga0070673_100006230 Ga0070673_1000062304 768
80 3300005365 Ga0070688_100003367 Ga0070688_1000033675 768
81 3300005844 Ga0068862_100008912 Ga0068862_1000089127 768
82 3300009094 Ga0111539_10003581 Ga0111539_100035814 768
83 3300013308 Ga0157375_10042601 Ga0157375_100426012 768
84 3300014326 Ga0157380_10005405 Ga0157380_100054056 768
85 3300014745 Ga0157377_10001104 Ga0157377_100011047 768
86 3300025923 Ga0207681_10014500 Ga0207681_100145004 768
87 3300025926 Ga0207659_10009312 Ga0207659_100093123 768
88 3300025972 Ga0207668_10002565 Ga0207668_100025655 768
89 3300026089 Ga0207648_10049943 Ga0207648_100499431 768
90 3300027907 Ga0207428_10009144 Ga0207428_100091441 768
91 3300050511 nmdc:mga08y16_10001_c1 nmdc:mga08y16_10001_c1_7329_9788 768
92 3300053108 Ga0500562_000063 Ga0500562_000063_13645_16062 768
93 3300005617 Ga0068859_100001754 Ga0068859_1000017544 769
94 3300006931 Ga0097620_100001754 Ga0097620_10000175414 769
95 3300049588 Ga0501072_0010433 Ga0501072_0010433_3022_5484 769
96 3300003354 JGI25160J50197_1001007 JGI25160J50197_10010075 770
97 3300005843 Ga0068860_100014968 Ga0068860_1000149683 770
98 3300013104 Ga0157370_10012390 Ga0157370_100123904 770
99 3300025302 Ga0207426_1000132 Ga0207426_100013286 770
100 3300028381 Ga0268264_10010667 Ga0268264_100106673 770
101 3300028794 Ga0307515_10004411 Ga0307515_100044118 771
102 3300033179 Ga0307507_10000071 Ga0307507_1000007151 772
103 3300014969 Ga0157376_10046167 Ga0157376_100461673 773
104 3300005617 Ga0068859_100050426 Ga0068859_1000504262 774
105 3300006931 Ga0097620_100050426 Ga0097620_1000504262 774
106 3300044658 Ga0466972_0000016 Ga0466972_0000016_43709_46174 774
107 3300003322 rootL2_10059606 rootL2_100596061 777
108 3300005366 Ga0070659_100004312 Ga0070659_1000043123 777
109 3300005616 Ga0068852_100028801 Ga0068852_1000288015 777
110 3300013307 Ga0157372_10051635 Ga0157372_100516353 777
111 3300025904 Ga0207647_10000222 Ga0207647_1000022243 777
112 3300025932 Ga0207690_10025350 Ga0207690_100253502 777
113 3300026142 Ga0207698_10019672 Ga0207698_100196722 777
114 3300050005 Ga0501284_00017 Ga0501284_00017_47668_50118 777
115 3300005985 Ga0081539_10010548 Ga0081539_100105482 779
116 3300006846 Ga0075430_100022561 Ga0075430_1000225614 780
117 3300028786 Ga0307517_10037547 Ga0307517_100375472 780
118 3300053730 Ga0500645_002709 Ga0500645_002709_3114_5681 782
119 3300005347 Ga0070668_100058358 Ga0070668_1000583582 783
120 3300053156 Ga0500622_0000845 Ga0500622_0000845_12962_15466 783
121 3300005356 Ga0070674_100012251 Ga0070674_1000122511 784
122 3300025949 Ga0207667_10085801 Ga0207667_100858011 785
123 3300026118 Ga0207675_100006051 Ga0207675_1000060519 785
124 3300028794 Ga0307515_10000001 Ga0307515_10000001884 785
125 3300031730 Ga0307516_10001823 Ga0307516_100018236 785
126 3300053727 Ga0500611_000037 Ga0500611_000037_6382_8859 785
127 3300005327 Ga0070658_10025987 Ga0070658_100259873 786
128 3300005329 Ga0070683_100022282 Ga0070683_1000222825 786
129 3300005335 Ga0070666_10021618 Ga0070666_100216183 786
130 3300005344 Ga0070661_100007861 Ga0070661_1000078615 786
131 3300005354 Ga0070675_100018246 Ga0070675_1000182463 786
132 3300005366 Ga0070659_100009662 Ga0070659_1000096624 786
133 3300005456 Ga0070678_100042968 Ga0070678_1000429681 786
134 3300005564 Ga0070664_100007012 Ga0070664_1000070125 786
135 3300005577 Ga0068857_100023301 Ga0068857_1000233012 786
136 3300005614 Ga0068856_100054030 Ga0068856_1000540301 786
137 3300005616 Ga0068852_100016123 Ga0068852_1000161231 786
138 3300006237 Ga0097621_100019825 Ga0097621_1000198256 786
139 3300006358 Ga0068871_100021972 Ga0068871_1000219722 786
140 3300013100 Ga0157373_10003247 Ga0157373_100032473 786
141 3300013105 Ga0157369_10012168 Ga0157369_100121683 786
142 3300013297 Ga0157378_10038020 Ga0157378_100380202 786
143 3300013307 Ga0157372_10021413 Ga0157372_100214132 786
144 3300025919 Ga0207657_10009387 Ga0207657_100093875 786
145 3300025933 Ga0207706_10076911 Ga0207706_100769111 786
146 3300025944 Ga0207661_10042158 Ga0207661_100421582 786
147 3300025945 Ga0207679_10013066 Ga0207679_100130663 786
148 3300025960 Ga0207651_10046213 Ga0207651_100462131 786
149 3300026041 Ga0207639_10061937 Ga0207639_100619371 786
150 3300026116 Ga0207674_10032499 Ga0207674_100324995 786
151 3300026142 Ga0207698_10007893 Ga0207698_100078931 786
152 3300031251 Ga0265327_10000099 Ga0265327_1000009958 786
153 3300025972 Ga0207668_10024549 Ga0207668_100245491 787
154 3300005331 Ga0070670_100039643 Ga0070670_1000396431 788
155 3300005353 Ga0070669_100016615 Ga0070669_1000166155 788
156 3300005617 Ga0068859_100003439 Ga0068859_1000034396 788
157 3300005844 Ga0068862_100059239 Ga0068862_1000592392 788
158 3300006931 Ga0097620_100003439 Ga0097620_1000034396 788
159 3300009101 Ga0105247_10000563 Ga0105247_1000056319 788
160 3300014325 Ga0163163_10004186 Ga0163163_100041865 788
161 3300025900 Ga0207710_10001194 Ga0207710_1000119410 788
162 3300025923 Ga0207681_10022738 Ga0207681_100227383 788
163 3300025925 Ga0207650_10003475 Ga0207650_100034755 788
164 3300026095 Ga0207676_10010732 Ga0207676_100107325 788
165 3300026118 Ga0207675_100086558 Ga0207675_1000865582 788
166 3300028381 Ga0268264_10012128 Ga0268264_100121282 788
167 3300028794 Ga0307515_10000001 Ga0307515_100000013642 788
168 3300053727 Ga0500611_000083 Ga0500611_000083_19794_22205 789
169 3300005842 Ga0068858_100040459 Ga0068858_1000404593 790
170 3300025901 Ga0207688_10026276 Ga0207688_100262761 790
171 3300044658 Ga0466972_0003885 Ga0466972_0003885_816_3266 790
172 3300013307 Ga0157372_10034181 Ga0157372_100341812 791
173 3300003320 rootH2_10085969 rootH2_100859692 792
174 3300021384 Ga0213876_10015827 Ga0213876_100158271 792
175 3300039437 Ga0436365_1889064 Ga0436365_1889064_1039_3498 792
176 3300049571 Ga0501034_0000007 Ga0501034_0000007_102430_104877 792
177 3300005459 Ga0068867_100042405 Ga0068867_1000424052 794
178 3300010375 Ga0105239_10030265 Ga0105239_100302653 795
179 3300013296 Ga0157374_10053999 Ga0157374_100539993 795
180 3300013306 Ga0163162_10140402 Ga0163162_101404021 795
181 3300003320 rootH2_10083512 rootH2_100835123 796
182 3300003323 rootH1_10032948 rootH1_100329483 796
183 iso_pu_bacteria 2818991444 2819586302 797
184 3300005539 Ga0068853_100000245 Ga0068853_1000002453 798
185 3300009093 Ga0105240_10000635 Ga0105240_1000063532 798
186 3300009093 Ga0105240_10000657 Ga0105240_1000065730 798
187 3300025913 Ga0207695_10000446 Ga0207695_1000044622 798
188 3300025913 Ga0207695_10001024 Ga0207695_1000102421 798
189 3300026041 Ga0207639_10024464 Ga0207639_100244642 798
190 3300049523 Ga0501300_002407 Ga0501300_002407_277_2721 798
191 3300049651 Ga0501201_000387 Ga0501201_000387_1092_3536 798
192 3300049662 Ga0501222_002053 Ga0501222_002053_44_2488 798
193 3300049669 Ga0501235_001211 Ga0501235_001211_2349_4793 798
194 3300049674 Ga0501242_000073 Ga0501242_000073_2230_4674 798
195 3300049682 Ga0501252_000172 Ga0501252_000172_1397_3841 798
196 3300049688 Ga0501259_000486 Ga0501259_000486_3668_6112 798
197 3300006880 Ga0075429_100012186 Ga0075429_1000121862 799
198 iso_pu_bacteria 2929154850 2929158735 799
199 3300005354 Ga0070675_100020893 Ga0070675_1000208932 800
200 3300005455 Ga0070663_100046780 Ga0070663_1000467802 800
201 3300009094 Ga0111539_10027105 Ga0111539_100271054 800
202 3300025926 Ga0207659_10017534 Ga0207659_100175342 800
203 3300047320 Ga0495672_0012478 Ga0495672_0012478_1951_4410 800
204 3300050511 nmdc:mga08y16_36495_c1 nmdc:mga08y16_36495_c1_1468_3957 800
205 3300005336 Ga0070680_100085861 Ga0070680_1000858611 801
206 3300005530 Ga0070679_100027923 Ga0070679_1000279232 801
207 3300005843 Ga0068860_100021161 Ga0068860_1000211612 801
208 3300013306 Ga0163162_10000201 Ga0163162_1000020133 801
209 3300028381 Ga0268264_10001681 Ga0268264_100016812 801
210 3300005337 Ga0070682_100000054 Ga0070682_1000000545 802
211 3300009545 Ga0105237_10014697 Ga0105237_100146973 802
212 3300013307 Ga0157372_10020929 Ga0157372_100209292 802
213 3300025914 Ga0207671_10009364 Ga0207671_100093643 802
214 3300033180 Ga0307510_10000042 Ga0307510_1000004238 802
215 3300046616 Ga0495668_0002730 Ga0495668_0002730_803_3265 802
216 3300049569 Ga0501032_0021501 Ga0501032_0021501_1420_3891 802
217 3300049572 Ga0501036_0004307 Ga0501036_0004307_7693_10164 802
218 3300049574 Ga0501038_0046149 Ga0501038_0046149_690_3152 802
219 3300049580 Ga0501046_0033176 Ga0501046_0033176_1397_3868 802
220 3300049581 Ga0501047_0046730 Ga0501047_0046730_256_2718 802
221 3300049586 Ga0501070_0037058 Ga0501070_0037058_1564_4035 802
222 3300049589 Ga0501073_0000302 Ga0501073_0000302_15740_18211 802
223 3300049742 Ga0501080_0065998 Ga0501080_0065998_588_3059 802
224 3300049822 Ga0501035_0029492 Ga0501035_0029492_632_3103 802
225 3300049823 Ga0501044_0076382 Ga0501044_0076382_899_3370 802
226 3300003320 rootH2_10027987 rootH2_100279872 803
227 3300005333 Ga0070677_10004086 Ga0070677_100040861 803
228 3300005334 Ga0068869_100012061 Ga0068869_1000120615 803
229 3300005354 Ga0070675_100040258 Ga0070675_1000402583 803
230 3300005367 Ga0070667_100005970 Ga0070667_1000059705 803
231 3300005539 Ga0068853_100019409 Ga0068853_1000194092 803
232 3300005548 Ga0070665_100004791 Ga0070665_1000047918 803
233 3300005617 Ga0068859_100017301 Ga0068859_1000173017 803
234 3300006358 Ga0068871_100014223 Ga0068871_1000142231 803
235 3300006931 Ga0097620_100017302 Ga0097620_1000173022 803
236 3300009093 Ga0105240_10000674 Ga0105240_1000067434 803
237 3300009174 Ga0105241_10002181 Ga0105241_100021816 803
238 3300009174 Ga0105241_10032432 Ga0105241_100324324 803
239 3300009176 Ga0105242_10065542 Ga0105242_100655421 803
240 3300009545 Ga0105237_10005828 Ga0105237_100058286 803
241 3300009551 Ga0105238_10003055 Ga0105238_100030554 803
242 3300010375 Ga0105239_10002459 Ga0105239_1000245923 803
243 3300013297 Ga0157378_10012526 Ga0157378_100125264 803
244 3300025893 Ga0207682_10007427 Ga0207682_100074271 803
245 3300025899 Ga0207642_10009632 Ga0207642_100096322 803
246 3300025907 Ga0207645_10001508 Ga0207645_100015086 803
247 3300025911 Ga0207654_10003217 Ga0207654_100032172 803
248 3300025913 Ga0207695_10005590 Ga0207695_100055909 803
249 3300025914 Ga0207671_10001755 Ga0207671_1000175517 803
250 3300025940 Ga0207691_10049325 Ga0207691_100493251 803
251 3300025942 Ga0207689_10011165 Ga0207689_100111657 803
252 3300025942 Ga0207689_10012158 Ga0207689_100121582 803
253 3300026089 Ga0207648_10016275 Ga0207648_100162754 803
254 3300026089 Ga0207648_10047678 Ga0207648_100476783 803
255 3300026121 Ga0207683_10000468 Ga0207683_100004689 803
256 3300003203 JGI25406J46586_10000732 JGI25406J46586_100007329 804
257 3300005985 Ga0081539_10000523 Ga0081539_1000052341 804

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14905

OMP_b-brl_3

Outer membrane protein beta-barrel family

419

833

0.9

PF07715

Plug

TonB-dependent Receptor Plug Domain

171

268

0.89

PF17802

SpaA

Prealbumin-like fold domain

69

124

0.88

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

70

152

0.87

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

348

763

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8912 21 101
6fwv-assembly2.cif.gz_B the bacillus anthracis tie protein 0.7914 21 104
3e8v-assembly1.cif.gz_A crystal structure of a possible transglutaminase-family protein proteolytic fragment from bacteroides fragilis 0.7865 21 98
3is1-assembly1.cif.gz_X crystal structure of functional region of uafa from staphylococcus saprophyticus in c2 form at 2.45 angstrom resolution 0.7789 21 104
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.7755 21 89
ID Description Score Start End Superfamily
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8925 21 101 2.60.40.10
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8523 22 104 2.60.40.1120
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8443 21 112 2.60.40.1120
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8421 22 106 2.60.40.1120
af_P91359_377_465_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8352 21 108 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A3C0UM90-F1-model_v4 TonB-dependent receptor 0.9364 14 766 GO:0009279
AF-A0A3C0UM90-F1-model_v4 TonB-dependent receptor 0.9127 14 766 GO:0009279
AF-A0A4R4PWR3-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9115 21 106 GO:0004180
AF-A0A355UVY8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.8934 21 106
AF-A0A418QLQ8-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8889 620 786

Feature Viewer

pLDDT pTM Quality
77.69 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map