F367131

General Info

Members Datasets Scaffolds Average Seq Length
257 155 257 169

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100058771|Ga0070698_1000587713
Length 196
Sequence MPVLSELVLRQAQDERVEGCRPDLGTHMTVVFKGRVFAVEVDKRRFPNGREHDVAIVRHAPSVVLIPIDADGRVILVKQYRAPIDRVTWELPAGSIDVGEAAEAAAARECEEEIGLVPGTIERLGSWYPTPGYCDEEMIFFKLSALHVPAPDSPHKPDEDEDIETQAVTVDDVRAMVRRRDIVDLKTAFALTLIRA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
87 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
88 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.5
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10268828 3300005290 Bacteria 920
2 Ga0065715_10034436 3300005293 Bacteria 971
3 Ga0065715_10034554 3300005293 Bacteria 1678
4 Ga0070690_100155939 3300005330 Bacteria 1561
5 Ga0070690_100240351 3300005330 Unclassified 1277
6 Ga0070666_10021853 3300005335 Bacteria 4149
7 Ga0070666_10220718 3300005335 Bacteria 1337
8 Ga0068868_100129392 3300005338 Bacteria 2065
9 Ga0068868_101174046 3300005338 Bacteria 709
10 Ga0070689_100060921 3300005340 Bacteria 2934
11 Ga0070689_100171523 3300005340 Bacteria 1758
12 Ga0070669_100014262 3300005353 Bacteria 5654
13 Ga0070675_100003227 3300005354 Bacteria 12353
14 Ga0070671_100044984 3300005355 Bacteria 3669
15 Ga0070673_100094750 3300005364 Bacteria 2448
16 Ga0070667_100003098 3300005367 Bacteria 14304
17 Ga0070705_100148661 3300005440 Bacteria 1551
18 Ga0070698_100058771 3300005471 Bacteria 3887
19 Ga0070699_100041269 3300005518 Bacteria 3995
20 Ga0070697_100173235 3300005536 Bacteria 1827
21 Ga0070672_100043883 3300005543 Bacteria 3451
22 Ga0070672_100091780 3300005543 Bacteria 2451
23 Ga0070686_100001079 3300005544 Bacteria 15728
24 Ga0070686_100123737 3300005544 Bacteria 1779
25 Ga0070686_100201311 3300005544 Unclassified 1428
26 Ga0070686_100308612 3300005544 Bacteria 1176
27 Ga0068854_100017104 3300005578 Bacteria 4849
28 Ga0068859_100063210 3300005617 Bacteria 3732
29 Ga0068859_100446812 3300005617 Bacteria 1389
30 Ga0068866_10280875 3300005718 Bacteria 1031
31 Ga0068861_100100298 3300005719 Bacteria 2301
32 Ga0068863_100024942 3300005841 Bacteria 5703
33 Ga0068863_100281127 3300005841 Bacteria 1612
34 Ga0068863_100668228 3300005841 Unclassified 1031
35 Ga0068858_100190477 3300005842 Unclassified 1938
36 Ga0068860_100352748 3300005843 Bacteria 1448
37 Ga0068862_100006564 3300005844 Bacteria 9651
38 Ga0068862_100040498 3300005844 Bacteria 3960
39 Ga0068862_101776263 3300005844 Unclassified 626
40 Ga0070715_10275991 3300006163 Bacteria 889
41 Ga0070716_100825090 3300006173 Bacteria 720
42 Ga0097621_100035615 3300006237 Bacteria 3978
43 Ga0068871_100009645 3300006358 Bacteria 7008
44 Ga0068871_100623798 3300006358 Unclassified 982
45 Ga0068871_100994679 3300006358 Unclassified 781
46 Ga0075428_100260446 3300006844 Bacteria 1867
47 Ga0075430_100001102 3300006846 Bacteria 21482
48 Ga0075430_100053461 3300006846 Bacteria 3401
49 Ga0075431_100174066 3300006847 Bacteria 2211
50 Ga0075433_10013066 3300006852 Bacteria 6735
51 Ga0075433_10103847 3300006852 Bacteria 2517
52 Ga0075433_10297512 3300006852 Bacteria 1429
53 Ga0075433_11363086 3300006852 Unclassified 614
54 Ga0075434_100164439 3300006871 Bacteria 2239
55 Ga0075434_100257159 3300006871 Bacteria 1765
56 Ga0075434_100345072 3300006871 Bacteria 1510
57 Ga0075434_100400393 3300006871 Bacteria 1394
58 Ga0075429_100529567 3300006880 Unclassified 1033
59 Ga0075429_100826586 3300006880 Bacteria 811
60 Ga0068865_100015668 3300006881 Bacteria 4837
61 Ga0075436_100041507 3300006914 Bacteria 3175
62 Ga0097620_100063213 3300006931 Bacteria 3732
63 Ga0097620_100446720 3300006931 Bacteria 1389
64 Ga0075435_100014246 3300007076 Bacteria 5938
65 Ga0075435_100016646 3300007076 Bacteria 5544
66 Ga0075435_100105540 3300007076 Bacteria 2339
67 Ga0075435_100505102 3300007076 Bacteria 1045
68 Ga0105240_10205897 3300009093 Bacteria 2303
69 Ga0105240_10781715 3300009093 Bacteria 1035
70 Ga0111539_10005304 3300009094 Bacteria 16687
71 Ga0111539_10105555 3300009094 Bacteria 3305
72 Ga0111539_10368574 3300009094 Unclassified 1672
73 Ga0111539_10654434 3300009094 Bacteria 1223
74 Ga0111539_11180494 3300009094 Unclassified 889
75 Ga0105245_10359769 3300009098 Bacteria 1444
76 Ga0105245_10883503 3300009098 Bacteria 935
77 Ga0114129_10001158 3300009147 Bacteria 34926
78 Ga0114129_10003110 3300009147 Bacteria 23277
79 Ga0114129_10358441 3300009147 Bacteria 1930
80 Ga0114129_10488404 3300009147 Bacteria 1610
81 Ga0114129_10703430 3300009147 Bacteria 1298
82 Ga0105243_11349716 3300009148 Unclassified 732
83 Ga0105241_10314505 3300009174 Bacteria 1348
84 Ga0105242_10044121 3300009176 Bacteria 3609
85 Ga0105248_10019689 3300009177 Bacteria 7470
86 Ga0105248_10024153 3300009177 Bacteria 6755
87 Ga0105248_10094645 3300009177 Bacteria 3363
88 Ga0105248_10538375 3300009177 Bacteria 1317
89 Ga0105248_11229688 3300009177 Bacteria 847
90 Ga0105238_10696014 3300009551 Bacteria 1028
91 Ga0105249_10673452 3300009553 Bacteria 1093
92 Ga0105249_11441511 3300009553 Unclassified 761
93 Ga0157374_10609994 3300013296 Unclassified 1102
94 Ga0157378_10766639 3300013297 Bacteria 988
95 Ga0163162_10182533 3300013306 Bacteria 2224
96 Ga0157375_10031891 3300013308 Bacteria 4991
97 Ga0157375_10368823 3300013308 Bacteria 1602
98 Ga0157380_12469901 3300014326 Bacteria 585
99 Ga0157377_10242871 3300014745 Unclassified 1163
100 Ga0157379_10733398 3300014968 Bacteria 929
101 Ga0157376_10128261 3300014969 Bacteria 2259
102 Ga0157376_10207735 3300014969 Unclassified 1806
103 Ga0207697_10350886 3300025315 Bacteria 655
104 Ga0207642_10214760 3300025899 Bacteria 1071
105 Ga0207680_10008328 3300025903 Bacteria 5082
106 Ga0207680_10085779 3300025903 Unclassified 1990
107 Ga0207680_10142903 3300025903 Bacteria 1588
108 Ga0207685_10071261 3300025905 Bacteria 1409
109 Ga0207693_10313933 3300025915 Unclassified 1227
110 Ga0207662_10033303 3300025918 Bacteria 3003
111 Ga0207681_10017039 3300025923 Bacteria 4558
112 Ga0207694_10296061 3300025924 Bacteria 1332
113 Ga0207659_10000159 3300025926 Bacteria 40400
114 Ga0207644_10233785 3300025931 Bacteria 1461
115 Ga0207686_10010022 3300025934 Bacteria 5155
116 Ga0207670_10236688 3300025936 Unclassified 1405
117 Ga0207704_10030532 3300025938 Bacteria 3022
118 Ga0207691_10160655 3300025940 Bacteria 1971
119 Ga0207711_10024472 3300025941 Bacteria 5060
120 Ga0207711_10097933 3300025941 Bacteria 2591
121 Ga0207711_10257389 3300025941 Bacteria 1604
122 Ga0207711_10567971 3300025941 Bacteria 1058
123 Ga0207711_10597296 3300025941 Bacteria 1030
124 Ga0207711_10923539 3300025941 Bacteria 811
125 Ga0207667_10973780 3300025949 Bacteria 837
126 Ga0207651_10156130 3300025960 Unclassified 1783
127 Ga0207712_10541344 3300025961 Bacteria 1000
128 Ga0207640_10071898 3300025981 Bacteria 2332
129 Ga0207677_10124891 3300026023 Bacteria 1943
130 Ga0207677_11483629 3300026023 Unclassified 626
131 Ga0207641_10003384 3300026088 Bacteria 14155
132 Ga0207648_11014575 3300026089 Bacteria 777
133 Ga0207683_10999819 3300026121 Unclassified 776
134 Ga0207428_10462422 3300027907 Bacteria 924
135 Ga0268266_10126823 3300028379 Bacteria 2278
136 Ga0268265_10007284 3300028380 Bacteria 7473
137 Ga0268264_10387572 3300028381 Bacteria 1340
138 Ga0268264_10715795 3300028381 Unclassified 995
139 Ga0307408_100215001 3300031548 Bacteria 1565
140 Ga0307408_100301768 3300031548 Bacteria 1342
141 Ga0373930_0040153 3300034816 Bacteria 994
142 Ga0373948_0000785 3300034817 Bacteria 4161
143 Ga0373950_0095083 3300034818 Unclassified 636
144 Ga0373958_0000186 3300034819 Bacteria 7191
145 Ga0373938_0001463 3300034957 Bacteria 3784
146 Ga0373928_0000608 3300035084 Bacteria 7034
147 Ga0373928_0115090 3300035084 Bacteria 715
148 Ga0373929_0000093 3300035085 Bacteria 14945
149 Ga0373940_0000166 3300035088 Bacteria 8802
150 Ga0373949_0002627 3300035090 Bacteria 4547
151 Ga0373951_0000399 3300035091 Bacteria 12848
152 Ga0373952_0000805 3300035092 Bacteria 5645
153 Ga0373932_0001244 3300035112 Bacteria 7235
154 Ga0373939_0000289 3300035114 Bacteria 13260
155 Ga0373941_0000206 3300035115 Bacteria 11310
156 Ga0373941_0009755 3300035115 Bacteria 2427
157 Ga0373942_0000215 3300035207 Bacteria 15154
158 Ga0373961_0000432 3300035241 Bacteria 17284
159 Ga0373961_0028469 3300035241 Bacteria 1541
160 Ga0373962_0079021 3300035242 Bacteria 995
161 Ga0373931_0016758 3300035691 Bacteria 3612
162 Ga0373947_0590735 3300035725 Unclassified 757
163 Ga0373925_0733067 3300037068 Unclassified 815
164 Ga0395901_0532898 3300038443 Unclassified 1192
165 Ga0439435_0077278 3300042436 Unclassified 994
166 Ga0451576_0004321 3300045051 Bacteria 18561
167 Ga0451576_0064695 3300045051 Bacteria 3809
168 Ga0495582_0093445 3300046473 Unclassified 1679
169 Ga0495582_0878795 3300046473 Unclassified 518
170 Ga0495665_0548501 3300046531 Unclassified 580
171 Ga0495633_0052604 3300046558 Bacteria 1918
172 Ga0495658_0330561 3300046683 Unclassified 967
173 Ga0495669_0329878 3300046684 Bacteria 737
174 Ga0495670_0550761 3300046691 Unclassified 628
175 Ga0496101_0634786 3300048904 Bacteria 844
176 Ga0496102_0175797 3300048905 Unclassified 2016
177 Ga0496102_1151916 3300048905 Bacteria 695
178 Ga0496105_0252222 3300048908 Unclassified 1429
179 Ga0496106_0096085 3300048909 Bacteria 2293
180 Ga0496106_0154438 3300048909 Bacteria 1811
181 Ga0496107_0229605 3300048910 Bacteria 1381
182 Ga0496108_0987044 3300048911 Unclassified 720
183 Ga0496112_0018065 3300048915 Bacteria 6637
184 Ga0501031_0157281 3300049568 Bacteria 1486
185 Ga0501036_1197185 3300049572 Unclassified 619
186 Ga0501039_0162560 3300049575 Bacteria 1755
187 Ga0501039_0230547 3300049575 Bacteria 1456
188 Ga0501040_0048433 3300049576 Bacteria 2904
189 Ga0501040_0157536 3300049576 Bacteria 1604
190 Ga0501040_0177708 3300049576 Bacteria 1508
191 Ga0501041_0081147 3300049577 Bacteria 1997
192 Ga0501042_0132342 3300049578 Bacteria 1798
193 Ga0501043_0661753 3300049579 Bacteria 766
194 Ga0501046_0629446 3300049580 Unclassified 760
195 Ga0501048_0298905 3300049582 Unclassified 1145
196 Ga0501068_0654796 3300049584 Bacteria 686
197 Ga0501070_0886381 3300049586 Bacteria 697
198 Ga0501071_0130751 3300049587 Bacteria 1865
199 Ga0501071_0386544 3300049587 Bacteria 1068
200 Ga0501072_0015844 3300049588 Bacteria 5778
201 Ga0501072_0016213 3300049588 Bacteria 5716
202 Ga0501072_0121588 3300049588 Unclassified 2080
203 Ga0501072_0447782 3300049588 Bacteria 1023
204 Ga0501073_0132004 3300049589 Bacteria 1731
205 Ga0501074_0067025 3300049590 Bacteria 2582
206 Ga0501074_0091409 3300049590 Bacteria 2180
207 Ga0501074_0147089 3300049590 Bacteria 1685
208 Ga0501075_0398766 3300049591 Bacteria 1049
209 Ga0501076_0025791 3300049592 Bacteria 4551
210 Ga0501076_0116731 3300049592 Bacteria 2160
211 Ga0501076_0495112 3300049592 Bacteria 1007
212 Ga0501076_1172832 3300049592 Bacteria 632
213 Ga0501077_0187860 3300049593 Unclassified 1313
214 Ga0501077_0212220 3300049593 Bacteria 1230
215 Ga0501079_0029841 3300049741 Bacteria 4189
216 Ga0501079_0766069 3300049741 Unclassified 760
217 Ga0501079_0955953 3300049741 Unclassified 675
218 Ga0501080_0446295 3300049742 Bacteria 1160
219 Ga0501080_0763658 3300049742 Bacteria 850
220 Ga0501081_0121064 3300049743 Bacteria 1864
221 Ga0501081_0144655 3300049743 Bacteria 1705
222 Ga0501045_0039098 3300049824 Bacteria 3452
223 Ga0501045_0048958 3300049824 Bacteria 3081
224 nmdc:mga05p37_10350_c1 3300050507 Bacteria 11073
225 nmdc:mga05p37_11826_c1 3300050507 Bacteria 10403
226 nmdc:mga05p37_124986_c1 3300050507 Bacteria 3159
227 nmdc:mga05p37_30035_c1 3300050507 Bacteria 6633
228 nmdc:mga05p37_495456_c1 3300050507 Unclassified 1404
229 nmdc:mga05p37_506410_c1 3300050507 Bacteria 1384
230 nmdc:mga05p37_57250_c1 3300050507 Unclassified 4801
231 nmdc:mga05p37_720190_c1 3300050507 Bacteria 1105
232 nmdc:mga0qj67_61066_c1 3300050509 Bacteria 2992
233 nmdc:mga0qj67_6296_c1 3300050509 Bacteria 8711
234 nmdc:mga06r32_160297_c1 3300050510 Bacteria 2232
235 nmdc:mga08y16_1288527_c1 3300050511 Unclassified 698
236 nmdc:mga08y16_194873_c1 3300050511 Bacteria 2101
237 nmdc:mga0n895_14738_c1 3300050512 Bacteria 7109
238 nmdc:mga0n895_270017_c1 3300050512 Bacteria 1725
239 nmdc:mga0n895_45030_c1 3300050512 Bacteria 4304
240 nmdc:mga0n895_45150_c1 3300050512 Bacteria 4299
241 nmdc:mga0n895_634705_c1 3300050512 Bacteria 1068
242 nmdc:mga0rr50_132017_c1 3300050513 Bacteria 2001
243 nmdc:mga0rr50_483071_c1 3300050513 Bacteria 1052
244 nmdc:mga0rr50_57820_c1 3300050513 Bacteria 2903
245 nmdc:mga08x19_960495_c1 3300050514 Unclassified 607
246 nmdc:mga0a205_129715_c1 3300050515 Bacteria 2422
247 nmdc:mga0a205_308693_c1 3300050515 Bacteria 1454
248 nmdc:mga0a205_36554_c1 3300050515 Bacteria 4719
249 nmdc:mga0a205_647970_c1 3300050515 Bacteria 908
250 nmdc:mga0a205_999053_c1 3300050515 Unclassified 684
251 Ga0495619_0123360 3300053085 Bacteria 1777
252 Ga0501084_0024988 3300054114 Bacteria 4985
253 Ga0501082_0025216 3300060353 Bacteria 5124
254 Ga0501082_0059352 3300060353 Bacteria 3297
255 Ga0501082_0067932 3300060353 Bacteria 3070
256 Ga0530510_0182770 3300061734 Bacteria 1555
257 Ga0530510_0640311 3300061734 Bacteria 809

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0955953 Ga0501079_0955953_23_466 147
2 3300050511 nmdc:mga08y16_1288527_c1 nmdc:mga08y16_1288527_c1_231_674 147
3 3300050514 nmdc:mga08x19_960495_c1 nmdc:mga08x19_960495_c1_75_518 147
4 3300046684 Ga0495669_0329878 Ga0495669_0329878_56_547 154
5 3300046473 Ga0495582_0878795 Ga0495582_0878795_22_501 157
6 3300049587 Ga0501071_0386544 Ga0501071_0386544_107_580 157
7 3300006358 Ga0068871_100009645 Ga0068871_1000096455 159
8 3300005335 Ga0070666_10220718 Ga0070666_102207182 160
9 3300005338 Ga0068868_100129392 Ga0068868_1001293923 160
10 3300005544 Ga0070686_100123737 Ga0070686_1001237373 160
11 3300005718 Ga0068866_10280875 Ga0068866_102808752 160
12 3300005843 Ga0068860_100352748 Ga0068860_1003527482 160
13 3300006237 Ga0097621_100035615 Ga0097621_1000356155 160
14 3300006881 Ga0068865_100015668 Ga0068865_1000156685 160
15 3300009098 Ga0105245_10883503 Ga0105245_108835032 160
16 3300009176 Ga0105242_10044121 Ga0105242_100441212 160
17 3300014969 Ga0157376_10128261 Ga0157376_101282613 160
18 3300025899 Ga0207642_10214760 Ga0207642_102147602 160
19 3300025903 Ga0207680_10142903 Ga0207680_101429032 160
20 3300025934 Ga0207686_10010022 Ga0207686_100100222 160
21 3300025938 Ga0207704_10030532 Ga0207704_100305324 160
22 3300026023 Ga0207677_10124891 Ga0207677_101248913 160
23 3300026089 Ga0207648_11014575 Ga0207648_110145752 160
24 3300028381 Ga0268264_10387572 Ga0268264_103875722 160
25 3300049741 Ga0501079_0766069 Ga0501079_0766069_109_630 160
26 3300050512 nmdc:mga0n895_45150_c1 nmdc:mga0n895_45150_c1_2612_3124 162
27 3300050515 nmdc:mga0a205_36554_c1 nmdc:mga0a205_36554_c1_3348_3860 162
28 3300005293 Ga0065715_10034554 Ga0065715_100345542 165
29 3300005330 Ga0070690_100155939 Ga0070690_1001559392 165
30 3300005330 Ga0070690_100240351 Ga0070690_1002403512 165
31 3300005335 Ga0070666_10021853 Ga0070666_100218532 165
32 3300005338 Ga0068868_101174046 Ga0068868_1011740461 165
33 3300005340 Ga0070689_100171523 Ga0070689_1001715232 165
34 3300005353 Ga0070669_100014262 Ga0070669_1000142625 165
35 3300005354 Ga0070675_100003227 Ga0070675_1000032272 165
36 3300005355 Ga0070671_100044984 Ga0070671_1000449843 165
37 3300005364 Ga0070673_100094750 Ga0070673_1000947503 165
38 3300005367 Ga0070667_100003098 Ga0070667_1000030987 165
39 3300005440 Ga0070705_100148661 Ga0070705_1001486612 165
40 3300005518 Ga0070699_100041269 Ga0070699_1000412693 165
41 3300005536 Ga0070697_100173235 Ga0070697_1001732352 165
42 3300005543 Ga0070672_100043883 Ga0070672_1000438832 165
43 3300005543 Ga0070672_100091780 Ga0070672_1000917803 165
44 3300005544 Ga0070686_100001079 Ga0070686_1000010795 165
45 3300005544 Ga0070686_100308612 Ga0070686_1003086121 165
46 3300005578 Ga0068854_100017104 Ga0068854_1000171044 165
47 3300005617 Ga0068859_100446812 Ga0068859_1004468123 165
48 3300005719 Ga0068861_100100298 Ga0068861_1001002982 165
49 3300005841 Ga0068863_100668228 Ga0068863_1006682282 165
50 3300005842 Ga0068858_100190477 Ga0068858_1001904772 165
51 3300005844 Ga0068862_100006564 Ga0068862_1000065649 165
52 3300005844 Ga0068862_101776263 Ga0068862_1017762631 165
53 3300006163 Ga0070715_10275991 Ga0070715_102759912 165
54 3300006358 Ga0068871_100623798 Ga0068871_1006237982 165
55 3300006844 Ga0075428_100260446 Ga0075428_1002604462 165
56 3300006852 Ga0075433_10013066 Ga0075433_100130663 165
57 3300006852 Ga0075433_10103847 Ga0075433_101038473 165
58 3300006852 Ga0075433_11363086 Ga0075433_113630861 165
59 3300006871 Ga0075434_100164439 Ga0075434_1001644393 165
60 3300006871 Ga0075434_100257159 Ga0075434_1002571592 165
61 3300006871 Ga0075434_100345072 Ga0075434_1003450722 165
62 3300006871 Ga0075434_100400393 Ga0075434_1004003932 165
63 3300006880 Ga0075429_100529567 Ga0075429_1005295672 165
64 3300006931 Ga0097620_100446720 Ga0097620_1004467203 165
65 3300007076 Ga0075435_100016646 Ga0075435_1000166462 165
66 3300007076 Ga0075435_100505102 Ga0075435_1005051022 165
67 3300009093 Ga0105240_10205897 Ga0105240_102058973 165
68 3300009093 Ga0105240_10781715 Ga0105240_107817152 165
69 3300009094 Ga0111539_10005304 Ga0111539_1000530410 165
70 3300009094 Ga0111539_10368574 Ga0111539_103685741 165
71 3300009098 Ga0105245_10359769 Ga0105245_103597692 165
72 3300009147 Ga0114129_10001158 Ga0114129_1000115811 165
73 3300009147 Ga0114129_10003110 Ga0114129_100031103 165
74 3300009147 Ga0114129_10488404 Ga0114129_104884042 165
75 3300009174 Ga0105241_10314505 Ga0105241_103145052 165
76 3300009177 Ga0105248_10019689 Ga0105248_100196898 165
77 3300009177 Ga0105248_10094645 Ga0105248_100946452 165
78 3300009177 Ga0105248_10538375 Ga0105248_105383752 165
79 3300009177 Ga0105248_11229688 Ga0105248_112296881 165
80 3300009551 Ga0105238_10696014 Ga0105238_106960142 165
81 3300013296 Ga0157374_10609994 Ga0157374_106099942 165
82 3300013297 Ga0157378_10766639 Ga0157378_107666391 165
83 3300013308 Ga0157375_10368823 Ga0157375_103688232 165
84 3300014326 Ga0157380_12469901 Ga0157380_124699011 165
85 3300014745 Ga0157377_10242871 Ga0157377_102428711 165
86 3300014968 Ga0157379_10733398 Ga0157379_107333982 165
87 3300025315 Ga0207697_10350886 Ga0207697_103508861 165
88 3300025903 Ga0207680_10008328 Ga0207680_100083285 165
89 3300025905 Ga0207685_10071261 Ga0207685_100712612 165
90 3300025918 Ga0207662_10033303 Ga0207662_100333034 165
91 3300025923 Ga0207681_10017039 Ga0207681_100170395 165
92 3300025924 Ga0207694_10296061 Ga0207694_102960612 165
93 3300025926 Ga0207659_10000159 Ga0207659_100001593 165
94 3300025931 Ga0207644_10233785 Ga0207644_102337852 165
95 3300025936 Ga0207670_10236688 Ga0207670_102366882 165
96 3300025940 Ga0207691_10160655 Ga0207691_101606551 165
97 3300025941 Ga0207711_10097933 Ga0207711_100979332 165
98 3300025941 Ga0207711_10257389 Ga0207711_102573892 165
99 3300025941 Ga0207711_10567971 Ga0207711_105679711 165
100 3300025941 Ga0207711_10597296 Ga0207711_105972962 165
101 3300025941 Ga0207711_10923539 Ga0207711_109235391 165
102 3300025949 Ga0207667_10973780 Ga0207667_109737802 165
103 3300025960 Ga0207651_10156130 Ga0207651_101561302 165
104 3300025981 Ga0207640_10071898 Ga0207640_100718982 165
105 3300026023 Ga0207677_11483629 Ga0207677_114836292 165
106 3300026121 Ga0207683_10999819 Ga0207683_109998191 165
107 3300027907 Ga0207428_10462422 Ga0207428_104624222 165
108 3300028379 Ga0268266_10126823 Ga0268266_101268232 165
109 3300028380 Ga0268265_10007284 Ga0268265_100072843 165
110 3300034816 Ga0373930_0040153 Ga0373930_0040153_274_783 165
111 3300034817 Ga0373948_0000785 Ga0373948_0000785_1802_2311 165
112 3300034818 Ga0373950_0095083 Ga0373950_0095083_12_521 165
113 3300034819 Ga0373958_0000186 Ga0373958_0000186_456_965 165
114 3300034957 Ga0373938_0001463 Ga0373938_0001463_262_771 165
115 3300035084 Ga0373928_0000608 Ga0373928_0000608_4622_5131 165
116 3300035085 Ga0373929_0000093 Ga0373929_0000093_8999_9508 165
117 3300035088 Ga0373940_0000166 Ga0373940_0000166_5556_6065 165
118 3300035090 Ga0373949_0002627 Ga0373949_0002627_2490_2999 165
119 3300035091 Ga0373951_0000399 Ga0373951_0000399_10159_10668 165
120 3300035092 Ga0373952_0000805 Ga0373952_0000805_3835_4344 165
121 3300035112 Ga0373932_0001244 Ga0373932_0001244_2044_2553 165
122 3300035114 Ga0373939_0000289 Ga0373939_0000289_5415_5924 165
123 3300035115 Ga0373941_0000206 Ga0373941_0000206_9982_10491 165
124 3300035207 Ga0373942_0000215 Ga0373942_0000215_3489_3998 165
125 3300035241 Ga0373961_0000432 Ga0373961_0000432_10549_11058 165
126 3300035242 Ga0373962_0079021 Ga0373962_0079021_317_826 165
127 3300035691 Ga0373931_0016758 Ga0373931_0016758_2425_2934 165
128 3300035725 Ga0373947_0590735 Ga0373947_0590735_59_562 165
129 3300037068 Ga0373925_0733067 Ga0373925_0733067_147_650 165
130 3300038443 Ga0395901_0532898 Ga0395901_0532898_82_585 165
131 3300042436 Ga0439435_0077278 Ga0439435_0077278_190_687 165
132 3300045051 Ga0451576_0004321 Ga0451576_0004321_1664_2173 165
133 3300045051 Ga0451576_0064695 Ga0451576_0064695_2023_2526 165
134 3300046473 Ga0495582_0093445 Ga0495582_0093445_983_1486 165
135 3300046558 Ga0495633_0052604 Ga0495633_0052604_1273_1779 165
136 3300046683 Ga0495658_0330561 Ga0495658_0330561_321_824 165
137 3300046691 Ga0495670_0550761 Ga0495670_0550761_104_610 165
138 3300048904 Ga0496101_0634786 Ga0496101_0634786_232_741 165
139 3300048905 Ga0496102_0175797 Ga0496102_0175797_1493_2002 165
140 3300048905 Ga0496102_1151916 Ga0496102_1151916_68_571 165
141 3300048908 Ga0496105_0252222 Ga0496105_0252222_616_1119 165
142 3300048909 Ga0496106_0096085 Ga0496106_0096085_1496_2005 165
143 3300048910 Ga0496107_0229605 Ga0496107_0229605_49_558 165
144 3300048915 Ga0496112_0018065 Ga0496112_0018065_1844_2347 165
145 3300049575 Ga0501039_0162560 Ga0501039_0162560_452_964 165
146 3300049576 Ga0501040_0177708 Ga0501040_0177708_868_1380 165
147 3300049578 Ga0501042_0132342 Ga0501042_0132342_1167_1679 165
148 3300049579 Ga0501043_0661753 Ga0501043_0661753_202_714 165
149 3300049588 Ga0501072_0016213 Ga0501072_0016213_3756_4268 165
150 3300049590 Ga0501074_0147089 Ga0501074_0147089_144_656 165
151 3300049743 Ga0501081_0144655 Ga0501081_0144655_428_940 165
152 3300050507 nmdc:mga05p37_11826_c1 nmdc:mga05p37_11826_c1_703_1206 165
153 3300050507 nmdc:mga05p37_124986_c1 nmdc:mga05p37_124986_c1_1158_1661 165
154 3300050507 nmdc:mga05p37_30035_c1 nmdc:mga05p37_30035_c1_5417_5920 165
155 3300050507 nmdc:mga05p37_495456_c1 nmdc:mga05p37_495456_c1_401_913 165
156 3300050507 nmdc:mga05p37_57250_c1 nmdc:mga05p37_57250_c1_3322_3825 165
157 3300050511 nmdc:mga08y16_194873_c1 nmdc:mga08y16_194873_c1_1444_1947 165
158 3300050512 nmdc:mga0n895_14738_c1 nmdc:mga0n895_14738_c1_1215_1718 165
159 3300050512 nmdc:mga0n895_270017_c1 nmdc:mga0n895_270017_c1_919_1428 165
160 3300050512 nmdc:mga0n895_45030_c1 nmdc:mga0n895_45030_c1_684_1187 165
161 3300050512 nmdc:mga0n895_634705_c1 nmdc:mga0n895_634705_c1_147_650 165
162 3300050513 nmdc:mga0rr50_132017_c1 nmdc:mga0rr50_132017_c1_308_820 165
163 3300050513 nmdc:mga0rr50_483071_c1 nmdc:mga0rr50_483071_c1_150_653 165
164 3300050513 nmdc:mga0rr50_57820_c1 nmdc:mga0rr50_57820_c1_2151_2654 165
165 3300050515 nmdc:mga0a205_129715_c1 nmdc:mga0a205_129715_c1_917_1420 165
166 3300053085 Ga0495619_0123360 Ga0495619_0123360_952_1455 165
167 3300054114 Ga0501084_0024988 Ga0501084_0024988_571_1083 165
168 3300061734 Ga0530510_0640311 Ga0530510_0640311_264_761 165
169 3300005841 Ga0068863_100024942 Ga0068863_1000249421 167
170 3300006914 Ga0075436_100041507 Ga0075436_1000415074 167
171 3300007076 Ga0075435_100014246 Ga0075435_1000142463 167
172 3300007076 Ga0075435_100105540 Ga0075435_1001055402 167
173 3300009094 Ga0111539_10654434 Ga0111539_106544342 167
174 3300009147 Ga0114129_10358441 Ga0114129_103584412 167
175 3300026088 Ga0207641_10003384 Ga0207641_100033849 167
176 3300035084 Ga0373928_0115090 Ga0373928_0115090_83_592 167
177 3300035115 Ga0373941_0009755 Ga0373941_0009755_517_1026 167
178 3300035241 Ga0373961_0028469 Ga0373961_0028469_714_1223 167
179 3300049584 Ga0501068_0654796 Ga0501068_0654796_109_636 167
180 3300050515 nmdc:mga0a205_999053_c1 nmdc:mga0a205_999053_c1_135_653 167
181 3300048909 Ga0496106_0154438 Ga0496106_0154438_1259_1786 170
182 3300006173 Ga0070716_100825090 Ga0070716_1008250902 172
183 3300005844 Ga0068862_100040498 Ga0068862_1000404981 173
184 3300006846 Ga0075430_100001102 Ga0075430_1000011025 173
185 3300006847 Ga0075431_100174066 Ga0075431_1001740662 173
186 3300006880 Ga0075429_100826586 Ga0075429_1008265861 173
187 3300009094 Ga0111539_10105555 Ga0111539_101055552 173
188 3300009147 Ga0114129_10703430 Ga0114129_107034302 173
189 3300009148 Ga0105243_11349716 Ga0105243_113497162 173
190 3300009553 Ga0105249_10673452 Ga0105249_106734522 173
191 3300009553 Ga0105249_11441511 Ga0105249_114415112 173
192 3300025915 Ga0207693_10313933 Ga0207693_103139332 173
193 3300025961 Ga0207712_10541344 Ga0207712_105413441 173
194 3300031548 Ga0307408_100301768 Ga0307408_1003017682 173
195 3300049572 Ga0501036_1197185 Ga0501036_1197185_79_600 173
196 3300049575 Ga0501039_0230547 Ga0501039_0230547_732_1253 173
197 3300049576 Ga0501040_0048433 Ga0501040_0048433_1717_2238 173
198 3300049576 Ga0501040_0157536 Ga0501040_0157536_1034_1555 173
199 3300049577 Ga0501041_0081147 Ga0501041_0081147_523_1044 173
200 3300049580 Ga0501046_0629446 Ga0501046_0629446_162_683 173
201 3300049582 Ga0501048_0298905 Ga0501048_0298905_609_1130 173
202 3300049586 Ga0501070_0886381 Ga0501070_0886381_145_666 173
203 3300049588 Ga0501072_0015844 Ga0501072_0015844_1448_1969 173
204 3300049588 Ga0501072_0121588 Ga0501072_0121588_861_1382 173
205 3300049588 Ga0501072_0447782 Ga0501072_0447782_103_630 173
206 3300049590 Ga0501074_0091409 Ga0501074_0091409_892_1413 173
207 3300049592 Ga0501076_0025791 Ga0501076_0025791_2719_3240 173
208 3300049593 Ga0501077_0187860 Ga0501077_0187860_702_1223 173
209 3300049742 Ga0501080_0763658 Ga0501080_0763658_296_817 173
210 3300049743 Ga0501081_0121064 Ga0501081_0121064_546_1067 173
211 3300049824 Ga0501045_0039098 Ga0501045_0039098_723_1244 173
212 3300049824 Ga0501045_0048958 Ga0501045_0048958_2510_3031 173
213 3300050507 nmdc:mga05p37_10350_c1 nmdc:mga05p37_10350_c1_10509_11030 173
214 3300050507 nmdc:mga05p37_506410_c1 nmdc:mga05p37_506410_c1_807_1328 173
215 3300050507 nmdc:mga05p37_720190_c1 nmdc:mga05p37_720190_c1_24_545 173
216 3300050509 nmdc:mga0qj67_6296_c1 nmdc:mga0qj67_6296_c1_2602_3123 173
217 3300050510 nmdc:mga06r32_160297_c1 nmdc:mga06r32_160297_c1_1632_2153 173
218 3300050515 nmdc:mga0a205_308693_c1 nmdc:mga0a205_308693_c1_162_683 173
219 3300060353 Ga0501082_0025216 Ga0501082_0025216_2710_3231 173
220 3300060353 Ga0501082_0059352 Ga0501082_0059352_2178_2699 173
221 3300061734 Ga0530510_0182770 Ga0530510_0182770_412_933 173
222 3300005340 Ga0070689_100060921 Ga0070689_1000609212 174
223 3300005544 Ga0070686_100201311 Ga0070686_1002013112 174
224 3300005617 Ga0068859_100063210 Ga0068859_1000632103 174
225 3300005841 Ga0068863_100281127 Ga0068863_1002811272 174
226 3300006358 Ga0068871_100994679 Ga0068871_1009946791 174
227 3300006852 Ga0075433_10297512 Ga0075433_102975122 174
228 3300006931 Ga0097620_100063213 Ga0097620_1000632134 174
229 3300009094 Ga0111539_11180494 Ga0111539_111804941 174
230 3300009177 Ga0105248_10024153 Ga0105248_100241534 174
231 3300013306 Ga0163162_10182533 Ga0163162_101825333 174
232 3300013308 Ga0157375_10031891 Ga0157375_100318913 174
233 3300014969 Ga0157376_10207735 Ga0157376_102077353 174
234 3300025903 Ga0207680_10085779 Ga0207680_100857792 174
235 3300025941 Ga0207711_10024472 Ga0207711_100244722 174
236 3300028381 Ga0268264_10715795 Ga0268264_107157952 174
237 3300048911 Ga0496108_0987044 Ga0496108_0987044_89_628 174
238 3300049587 Ga0501071_0130751 Ga0501071_0130751_103_627 174
239 3300049592 Ga0501076_0495112 Ga0501076_0495112_401_925 174
240 3300050515 nmdc:mga0a205_647970_c1 nmdc:mga0a205_647970_c1_155_679 174
241 3300005290 Ga0065712_10268828 Ga0065712_102688281 175
242 3300005293 Ga0065715_10034436 Ga0065715_100344362 175
243 3300005471 Ga0070698_100058771 Ga0070698_1000587713 175
244 3300006846 Ga0075430_100053461 Ga0075430_1000534612 175
245 3300031548 Ga0307408_100215001 Ga0307408_1002150012 175
246 3300046531 Ga0495665_0548501 Ga0495665_0548501_31_567 175
247 3300049568 Ga0501031_0157281 Ga0501031_0157281_349_888 175
248 3300049589 Ga0501073_0132004 Ga0501073_0132004_843_1370 175
249 3300049590 Ga0501074_0067025 Ga0501074_0067025_1299_1826 175
250 3300049591 Ga0501075_0398766 Ga0501075_0398766_97_633 175
251 3300049592 Ga0501076_0116731 Ga0501076_0116731_897_1424 175
252 3300049592 Ga0501076_1172832 Ga0501076_1172832_68_607 175
253 3300049593 Ga0501077_0212220 Ga0501077_0212220_498_1034 175
254 3300049741 Ga0501079_0029841 Ga0501079_0029841_3215_3742 175
255 3300049742 Ga0501080_0446295 Ga0501080_0446295_438_965 175
256 3300050509 nmdc:mga0qj67_61066_c1 nmdc:mga0qj67_61066_c1_127_657 175
257 3300060353 Ga0501082_0067932 Ga0501082_0067932_2303_2830 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

58

186

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9274 6 173
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9248 4 173
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9025 7 174
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9025 7 174
6zgn-assembly1.cif.gz_A crystal structure of virb8-like orfg central domain of streptococcus thermophilus icest3; a putative assembly factor of a gram positive conjugative type iv secretion system. 0.8975 6 40
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9248 4 173 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9125 3 173 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8847 4 173 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8801 7 174 3.90.79.10
3o69B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8659 6 173 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A3C0QDW6-F1-model_v4 NUDIX hydrolase 0.9656 6 130 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A2W5XA52-F1-model_v4 ADP-ribose pyrophosphatase 0.9646 6 174 GO:0006753
GO:0016787
GO:0019693
AF-A0A3N5ZHX6-F1-model_v4 NUDIX hydrolase 0.9645 6 175 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A523Y0W8-F1-model_v4 NUDIX hydrolase 0.9629 6 174 GO:0006753
GO:0016787
GO:0019693
AF-A0A523TUP5-F1-model_v4 NUDIX hydrolase 0.9618 6 174 GO:0006753
GO:0016787
GO:0019693

Feature Viewer

pLDDT pTM Quality
94.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map