F367131
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 257 | 155 | 257 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100058771|Ga0070698_1000587713 |
| Length | 196 |
| Sequence | MPVLSELVLRQAQDERVEGCRPDLGTHMTVVFKGRVFAVEVDKRRFPNGREHDVAIVRHAPSVVLIPIDADGRVILVKQYRAPIDRVTWELPAGSIDVGEAAEAAAARECEEEIGLVPGTIERLGSWYPTPGYCDEEMIFFKLSALHVPAPDSPHKPDEDEDIETQAVTVDDVRAMVRRRDIVDLKTAFALTLIRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 82 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 86 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 87 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 88 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 89 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 90 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 91 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 92 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 93 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 95 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 97 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 99 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 100 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 103 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 105 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 116 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 119 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 120 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 96.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10268828 | 3300005290 | Bacteria | 920 |
| 2 | Ga0065715_10034436 | 3300005293 | Bacteria | 971 |
| 3 | Ga0065715_10034554 | 3300005293 | Bacteria | 1678 |
| 4 | Ga0070690_100155939 | 3300005330 | Bacteria | 1561 |
| 5 | Ga0070690_100240351 | 3300005330 | Unclassified | 1277 |
| 6 | Ga0070666_10021853 | 3300005335 | Bacteria | 4149 |
| 7 | Ga0070666_10220718 | 3300005335 | Bacteria | 1337 |
| 8 | Ga0068868_100129392 | 3300005338 | Bacteria | 2065 |
| 9 | Ga0068868_101174046 | 3300005338 | Bacteria | 709 |
| 10 | Ga0070689_100060921 | 3300005340 | Bacteria | 2934 |
| 11 | Ga0070689_100171523 | 3300005340 | Bacteria | 1758 |
| 12 | Ga0070669_100014262 | 3300005353 | Bacteria | 5654 |
| 13 | Ga0070675_100003227 | 3300005354 | Bacteria | 12353 |
| 14 | Ga0070671_100044984 | 3300005355 | Bacteria | 3669 |
| 15 | Ga0070673_100094750 | 3300005364 | Bacteria | 2448 |
| 16 | Ga0070667_100003098 | 3300005367 | Bacteria | 14304 |
| 17 | Ga0070705_100148661 | 3300005440 | Bacteria | 1551 |
| 18 | Ga0070698_100058771 | 3300005471 | Bacteria | 3887 |
| 19 | Ga0070699_100041269 | 3300005518 | Bacteria | 3995 |
| 20 | Ga0070697_100173235 | 3300005536 | Bacteria | 1827 |
| 21 | Ga0070672_100043883 | 3300005543 | Bacteria | 3451 |
| 22 | Ga0070672_100091780 | 3300005543 | Bacteria | 2451 |
| 23 | Ga0070686_100001079 | 3300005544 | Bacteria | 15728 |
| 24 | Ga0070686_100123737 | 3300005544 | Bacteria | 1779 |
| 25 | Ga0070686_100201311 | 3300005544 | Unclassified | 1428 |
| 26 | Ga0070686_100308612 | 3300005544 | Bacteria | 1176 |
| 27 | Ga0068854_100017104 | 3300005578 | Bacteria | 4849 |
| 28 | Ga0068859_100063210 | 3300005617 | Bacteria | 3732 |
| 29 | Ga0068859_100446812 | 3300005617 | Bacteria | 1389 |
| 30 | Ga0068866_10280875 | 3300005718 | Bacteria | 1031 |
| 31 | Ga0068861_100100298 | 3300005719 | Bacteria | 2301 |
| 32 | Ga0068863_100024942 | 3300005841 | Bacteria | 5703 |
| 33 | Ga0068863_100281127 | 3300005841 | Bacteria | 1612 |
| 34 | Ga0068863_100668228 | 3300005841 | Unclassified | 1031 |
| 35 | Ga0068858_100190477 | 3300005842 | Unclassified | 1938 |
| 36 | Ga0068860_100352748 | 3300005843 | Bacteria | 1448 |
| 37 | Ga0068862_100006564 | 3300005844 | Bacteria | 9651 |
| 38 | Ga0068862_100040498 | 3300005844 | Bacteria | 3960 |
| 39 | Ga0068862_101776263 | 3300005844 | Unclassified | 626 |
| 40 | Ga0070715_10275991 | 3300006163 | Bacteria | 889 |
| 41 | Ga0070716_100825090 | 3300006173 | Bacteria | 720 |
| 42 | Ga0097621_100035615 | 3300006237 | Bacteria | 3978 |
| 43 | Ga0068871_100009645 | 3300006358 | Bacteria | 7008 |
| 44 | Ga0068871_100623798 | 3300006358 | Unclassified | 982 |
| 45 | Ga0068871_100994679 | 3300006358 | Unclassified | 781 |
| 46 | Ga0075428_100260446 | 3300006844 | Bacteria | 1867 |
| 47 | Ga0075430_100001102 | 3300006846 | Bacteria | 21482 |
| 48 | Ga0075430_100053461 | 3300006846 | Bacteria | 3401 |
| 49 | Ga0075431_100174066 | 3300006847 | Bacteria | 2211 |
| 50 | Ga0075433_10013066 | 3300006852 | Bacteria | 6735 |
| 51 | Ga0075433_10103847 | 3300006852 | Bacteria | 2517 |
| 52 | Ga0075433_10297512 | 3300006852 | Bacteria | 1429 |
| 53 | Ga0075433_11363086 | 3300006852 | Unclassified | 614 |
| 54 | Ga0075434_100164439 | 3300006871 | Bacteria | 2239 |
| 55 | Ga0075434_100257159 | 3300006871 | Bacteria | 1765 |
| 56 | Ga0075434_100345072 | 3300006871 | Bacteria | 1510 |
| 57 | Ga0075434_100400393 | 3300006871 | Bacteria | 1394 |
| 58 | Ga0075429_100529567 | 3300006880 | Unclassified | 1033 |
| 59 | Ga0075429_100826586 | 3300006880 | Bacteria | 811 |
| 60 | Ga0068865_100015668 | 3300006881 | Bacteria | 4837 |
| 61 | Ga0075436_100041507 | 3300006914 | Bacteria | 3175 |
| 62 | Ga0097620_100063213 | 3300006931 | Bacteria | 3732 |
| 63 | Ga0097620_100446720 | 3300006931 | Bacteria | 1389 |
| 64 | Ga0075435_100014246 | 3300007076 | Bacteria | 5938 |
| 65 | Ga0075435_100016646 | 3300007076 | Bacteria | 5544 |
| 66 | Ga0075435_100105540 | 3300007076 | Bacteria | 2339 |
| 67 | Ga0075435_100505102 | 3300007076 | Bacteria | 1045 |
| 68 | Ga0105240_10205897 | 3300009093 | Bacteria | 2303 |
| 69 | Ga0105240_10781715 | 3300009093 | Bacteria | 1035 |
| 70 | Ga0111539_10005304 | 3300009094 | Bacteria | 16687 |
| 71 | Ga0111539_10105555 | 3300009094 | Bacteria | 3305 |
| 72 | Ga0111539_10368574 | 3300009094 | Unclassified | 1672 |
| 73 | Ga0111539_10654434 | 3300009094 | Bacteria | 1223 |
| 74 | Ga0111539_11180494 | 3300009094 | Unclassified | 889 |
| 75 | Ga0105245_10359769 | 3300009098 | Bacteria | 1444 |
| 76 | Ga0105245_10883503 | 3300009098 | Bacteria | 935 |
| 77 | Ga0114129_10001158 | 3300009147 | Bacteria | 34926 |
| 78 | Ga0114129_10003110 | 3300009147 | Bacteria | 23277 |
| 79 | Ga0114129_10358441 | 3300009147 | Bacteria | 1930 |
| 80 | Ga0114129_10488404 | 3300009147 | Bacteria | 1610 |
| 81 | Ga0114129_10703430 | 3300009147 | Bacteria | 1298 |
| 82 | Ga0105243_11349716 | 3300009148 | Unclassified | 732 |
| 83 | Ga0105241_10314505 | 3300009174 | Bacteria | 1348 |
| 84 | Ga0105242_10044121 | 3300009176 | Bacteria | 3609 |
| 85 | Ga0105248_10019689 | 3300009177 | Bacteria | 7470 |
| 86 | Ga0105248_10024153 | 3300009177 | Bacteria | 6755 |
| 87 | Ga0105248_10094645 | 3300009177 | Bacteria | 3363 |
| 88 | Ga0105248_10538375 | 3300009177 | Bacteria | 1317 |
| 89 | Ga0105248_11229688 | 3300009177 | Bacteria | 847 |
| 90 | Ga0105238_10696014 | 3300009551 | Bacteria | 1028 |
| 91 | Ga0105249_10673452 | 3300009553 | Bacteria | 1093 |
| 92 | Ga0105249_11441511 | 3300009553 | Unclassified | 761 |
| 93 | Ga0157374_10609994 | 3300013296 | Unclassified | 1102 |
| 94 | Ga0157378_10766639 | 3300013297 | Bacteria | 988 |
| 95 | Ga0163162_10182533 | 3300013306 | Bacteria | 2224 |
| 96 | Ga0157375_10031891 | 3300013308 | Bacteria | 4991 |
| 97 | Ga0157375_10368823 | 3300013308 | Bacteria | 1602 |
| 98 | Ga0157380_12469901 | 3300014326 | Bacteria | 585 |
| 99 | Ga0157377_10242871 | 3300014745 | Unclassified | 1163 |
| 100 | Ga0157379_10733398 | 3300014968 | Bacteria | 929 |
| 101 | Ga0157376_10128261 | 3300014969 | Bacteria | 2259 |
| 102 | Ga0157376_10207735 | 3300014969 | Unclassified | 1806 |
| 103 | Ga0207697_10350886 | 3300025315 | Bacteria | 655 |
| 104 | Ga0207642_10214760 | 3300025899 | Bacteria | 1071 |
| 105 | Ga0207680_10008328 | 3300025903 | Bacteria | 5082 |
| 106 | Ga0207680_10085779 | 3300025903 | Unclassified | 1990 |
| 107 | Ga0207680_10142903 | 3300025903 | Bacteria | 1588 |
| 108 | Ga0207685_10071261 | 3300025905 | Bacteria | 1409 |
| 109 | Ga0207693_10313933 | 3300025915 | Unclassified | 1227 |
| 110 | Ga0207662_10033303 | 3300025918 | Bacteria | 3003 |
| 111 | Ga0207681_10017039 | 3300025923 | Bacteria | 4558 |
| 112 | Ga0207694_10296061 | 3300025924 | Bacteria | 1332 |
| 113 | Ga0207659_10000159 | 3300025926 | Bacteria | 40400 |
| 114 | Ga0207644_10233785 | 3300025931 | Bacteria | 1461 |
| 115 | Ga0207686_10010022 | 3300025934 | Bacteria | 5155 |
| 116 | Ga0207670_10236688 | 3300025936 | Unclassified | 1405 |
| 117 | Ga0207704_10030532 | 3300025938 | Bacteria | 3022 |
| 118 | Ga0207691_10160655 | 3300025940 | Bacteria | 1971 |
| 119 | Ga0207711_10024472 | 3300025941 | Bacteria | 5060 |
| 120 | Ga0207711_10097933 | 3300025941 | Bacteria | 2591 |
| 121 | Ga0207711_10257389 | 3300025941 | Bacteria | 1604 |
| 122 | Ga0207711_10567971 | 3300025941 | Bacteria | 1058 |
| 123 | Ga0207711_10597296 | 3300025941 | Bacteria | 1030 |
| 124 | Ga0207711_10923539 | 3300025941 | Bacteria | 811 |
| 125 | Ga0207667_10973780 | 3300025949 | Bacteria | 837 |
| 126 | Ga0207651_10156130 | 3300025960 | Unclassified | 1783 |
| 127 | Ga0207712_10541344 | 3300025961 | Bacteria | 1000 |
| 128 | Ga0207640_10071898 | 3300025981 | Bacteria | 2332 |
| 129 | Ga0207677_10124891 | 3300026023 | Bacteria | 1943 |
| 130 | Ga0207677_11483629 | 3300026023 | Unclassified | 626 |
| 131 | Ga0207641_10003384 | 3300026088 | Bacteria | 14155 |
| 132 | Ga0207648_11014575 | 3300026089 | Bacteria | 777 |
| 133 | Ga0207683_10999819 | 3300026121 | Unclassified | 776 |
| 134 | Ga0207428_10462422 | 3300027907 | Bacteria | 924 |
| 135 | Ga0268266_10126823 | 3300028379 | Bacteria | 2278 |
| 136 | Ga0268265_10007284 | 3300028380 | Bacteria | 7473 |
| 137 | Ga0268264_10387572 | 3300028381 | Bacteria | 1340 |
| 138 | Ga0268264_10715795 | 3300028381 | Unclassified | 995 |
| 139 | Ga0307408_100215001 | 3300031548 | Bacteria | 1565 |
| 140 | Ga0307408_100301768 | 3300031548 | Bacteria | 1342 |
| 141 | Ga0373930_0040153 | 3300034816 | Bacteria | 994 |
| 142 | Ga0373948_0000785 | 3300034817 | Bacteria | 4161 |
| 143 | Ga0373950_0095083 | 3300034818 | Unclassified | 636 |
| 144 | Ga0373958_0000186 | 3300034819 | Bacteria | 7191 |
| 145 | Ga0373938_0001463 | 3300034957 | Bacteria | 3784 |
| 146 | Ga0373928_0000608 | 3300035084 | Bacteria | 7034 |
| 147 | Ga0373928_0115090 | 3300035084 | Bacteria | 715 |
| 148 | Ga0373929_0000093 | 3300035085 | Bacteria | 14945 |
| 149 | Ga0373940_0000166 | 3300035088 | Bacteria | 8802 |
| 150 | Ga0373949_0002627 | 3300035090 | Bacteria | 4547 |
| 151 | Ga0373951_0000399 | 3300035091 | Bacteria | 12848 |
| 152 | Ga0373952_0000805 | 3300035092 | Bacteria | 5645 |
| 153 | Ga0373932_0001244 | 3300035112 | Bacteria | 7235 |
| 154 | Ga0373939_0000289 | 3300035114 | Bacteria | 13260 |
| 155 | Ga0373941_0000206 | 3300035115 | Bacteria | 11310 |
| 156 | Ga0373941_0009755 | 3300035115 | Bacteria | 2427 |
| 157 | Ga0373942_0000215 | 3300035207 | Bacteria | 15154 |
| 158 | Ga0373961_0000432 | 3300035241 | Bacteria | 17284 |
| 159 | Ga0373961_0028469 | 3300035241 | Bacteria | 1541 |
| 160 | Ga0373962_0079021 | 3300035242 | Bacteria | 995 |
| 161 | Ga0373931_0016758 | 3300035691 | Bacteria | 3612 |
| 162 | Ga0373947_0590735 | 3300035725 | Unclassified | 757 |
| 163 | Ga0373925_0733067 | 3300037068 | Unclassified | 815 |
| 164 | Ga0395901_0532898 | 3300038443 | Unclassified | 1192 |
| 165 | Ga0439435_0077278 | 3300042436 | Unclassified | 994 |
| 166 | Ga0451576_0004321 | 3300045051 | Bacteria | 18561 |
| 167 | Ga0451576_0064695 | 3300045051 | Bacteria | 3809 |
| 168 | Ga0495582_0093445 | 3300046473 | Unclassified | 1679 |
| 169 | Ga0495582_0878795 | 3300046473 | Unclassified | 518 |
| 170 | Ga0495665_0548501 | 3300046531 | Unclassified | 580 |
| 171 | Ga0495633_0052604 | 3300046558 | Bacteria | 1918 |
| 172 | Ga0495658_0330561 | 3300046683 | Unclassified | 967 |
| 173 | Ga0495669_0329878 | 3300046684 | Bacteria | 737 |
| 174 | Ga0495670_0550761 | 3300046691 | Unclassified | 628 |
| 175 | Ga0496101_0634786 | 3300048904 | Bacteria | 844 |
| 176 | Ga0496102_0175797 | 3300048905 | Unclassified | 2016 |
| 177 | Ga0496102_1151916 | 3300048905 | Bacteria | 695 |
| 178 | Ga0496105_0252222 | 3300048908 | Unclassified | 1429 |
| 179 | Ga0496106_0096085 | 3300048909 | Bacteria | 2293 |
| 180 | Ga0496106_0154438 | 3300048909 | Bacteria | 1811 |
| 181 | Ga0496107_0229605 | 3300048910 | Bacteria | 1381 |
| 182 | Ga0496108_0987044 | 3300048911 | Unclassified | 720 |
| 183 | Ga0496112_0018065 | 3300048915 | Bacteria | 6637 |
| 184 | Ga0501031_0157281 | 3300049568 | Bacteria | 1486 |
| 185 | Ga0501036_1197185 | 3300049572 | Unclassified | 619 |
| 186 | Ga0501039_0162560 | 3300049575 | Bacteria | 1755 |
| 187 | Ga0501039_0230547 | 3300049575 | Bacteria | 1456 |
| 188 | Ga0501040_0048433 | 3300049576 | Bacteria | 2904 |
| 189 | Ga0501040_0157536 | 3300049576 | Bacteria | 1604 |
| 190 | Ga0501040_0177708 | 3300049576 | Bacteria | 1508 |
| 191 | Ga0501041_0081147 | 3300049577 | Bacteria | 1997 |
| 192 | Ga0501042_0132342 | 3300049578 | Bacteria | 1798 |
| 193 | Ga0501043_0661753 | 3300049579 | Bacteria | 766 |
| 194 | Ga0501046_0629446 | 3300049580 | Unclassified | 760 |
| 195 | Ga0501048_0298905 | 3300049582 | Unclassified | 1145 |
| 196 | Ga0501068_0654796 | 3300049584 | Bacteria | 686 |
| 197 | Ga0501070_0886381 | 3300049586 | Bacteria | 697 |
| 198 | Ga0501071_0130751 | 3300049587 | Bacteria | 1865 |
| 199 | Ga0501071_0386544 | 3300049587 | Bacteria | 1068 |
| 200 | Ga0501072_0015844 | 3300049588 | Bacteria | 5778 |
| 201 | Ga0501072_0016213 | 3300049588 | Bacteria | 5716 |
| 202 | Ga0501072_0121588 | 3300049588 | Unclassified | 2080 |
| 203 | Ga0501072_0447782 | 3300049588 | Bacteria | 1023 |
| 204 | Ga0501073_0132004 | 3300049589 | Bacteria | 1731 |
| 205 | Ga0501074_0067025 | 3300049590 | Bacteria | 2582 |
| 206 | Ga0501074_0091409 | 3300049590 | Bacteria | 2180 |
| 207 | Ga0501074_0147089 | 3300049590 | Bacteria | 1685 |
| 208 | Ga0501075_0398766 | 3300049591 | Bacteria | 1049 |
| 209 | Ga0501076_0025791 | 3300049592 | Bacteria | 4551 |
| 210 | Ga0501076_0116731 | 3300049592 | Bacteria | 2160 |
| 211 | Ga0501076_0495112 | 3300049592 | Bacteria | 1007 |
| 212 | Ga0501076_1172832 | 3300049592 | Bacteria | 632 |
| 213 | Ga0501077_0187860 | 3300049593 | Unclassified | 1313 |
| 214 | Ga0501077_0212220 | 3300049593 | Bacteria | 1230 |
| 215 | Ga0501079_0029841 | 3300049741 | Bacteria | 4189 |
| 216 | Ga0501079_0766069 | 3300049741 | Unclassified | 760 |
| 217 | Ga0501079_0955953 | 3300049741 | Unclassified | 675 |
| 218 | Ga0501080_0446295 | 3300049742 | Bacteria | 1160 |
| 219 | Ga0501080_0763658 | 3300049742 | Bacteria | 850 |
| 220 | Ga0501081_0121064 | 3300049743 | Bacteria | 1864 |
| 221 | Ga0501081_0144655 | 3300049743 | Bacteria | 1705 |
| 222 | Ga0501045_0039098 | 3300049824 | Bacteria | 3452 |
| 223 | Ga0501045_0048958 | 3300049824 | Bacteria | 3081 |
| 224 | nmdc:mga05p37_10350_c1 | 3300050507 | Bacteria | 11073 |
| 225 | nmdc:mga05p37_11826_c1 | 3300050507 | Bacteria | 10403 |
| 226 | nmdc:mga05p37_124986_c1 | 3300050507 | Bacteria | 3159 |
| 227 | nmdc:mga05p37_30035_c1 | 3300050507 | Bacteria | 6633 |
| 228 | nmdc:mga05p37_495456_c1 | 3300050507 | Unclassified | 1404 |
| 229 | nmdc:mga05p37_506410_c1 | 3300050507 | Bacteria | 1384 |
| 230 | nmdc:mga05p37_57250_c1 | 3300050507 | Unclassified | 4801 |
| 231 | nmdc:mga05p37_720190_c1 | 3300050507 | Bacteria | 1105 |
| 232 | nmdc:mga0qj67_61066_c1 | 3300050509 | Bacteria | 2992 |
| 233 | nmdc:mga0qj67_6296_c1 | 3300050509 | Bacteria | 8711 |
| 234 | nmdc:mga06r32_160297_c1 | 3300050510 | Bacteria | 2232 |
| 235 | nmdc:mga08y16_1288527_c1 | 3300050511 | Unclassified | 698 |
| 236 | nmdc:mga08y16_194873_c1 | 3300050511 | Bacteria | 2101 |
| 237 | nmdc:mga0n895_14738_c1 | 3300050512 | Bacteria | 7109 |
| 238 | nmdc:mga0n895_270017_c1 | 3300050512 | Bacteria | 1725 |
| 239 | nmdc:mga0n895_45030_c1 | 3300050512 | Bacteria | 4304 |
| 240 | nmdc:mga0n895_45150_c1 | 3300050512 | Bacteria | 4299 |
| 241 | nmdc:mga0n895_634705_c1 | 3300050512 | Bacteria | 1068 |
| 242 | nmdc:mga0rr50_132017_c1 | 3300050513 | Bacteria | 2001 |
| 243 | nmdc:mga0rr50_483071_c1 | 3300050513 | Bacteria | 1052 |
| 244 | nmdc:mga0rr50_57820_c1 | 3300050513 | Bacteria | 2903 |
| 245 | nmdc:mga08x19_960495_c1 | 3300050514 | Unclassified | 607 |
| 246 | nmdc:mga0a205_129715_c1 | 3300050515 | Bacteria | 2422 |
| 247 | nmdc:mga0a205_308693_c1 | 3300050515 | Bacteria | 1454 |
| 248 | nmdc:mga0a205_36554_c1 | 3300050515 | Bacteria | 4719 |
| 249 | nmdc:mga0a205_647970_c1 | 3300050515 | Bacteria | 908 |
| 250 | nmdc:mga0a205_999053_c1 | 3300050515 | Unclassified | 684 |
| 251 | Ga0495619_0123360 | 3300053085 | Bacteria | 1777 |
| 252 | Ga0501084_0024988 | 3300054114 | Bacteria | 4985 |
| 253 | Ga0501082_0025216 | 3300060353 | Bacteria | 5124 |
| 254 | Ga0501082_0059352 | 3300060353 | Bacteria | 3297 |
| 255 | Ga0501082_0067932 | 3300060353 | Bacteria | 3070 |
| 256 | Ga0530510_0182770 | 3300061734 | Bacteria | 1555 |
| 257 | Ga0530510_0640311 | 3300061734 | Bacteria | 809 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0955953 | Ga0501079_0955953_23_466 | 147 |
| 2 | 3300050511 | nmdc:mga08y16_1288527_c1 | nmdc:mga08y16_1288527_c1_231_674 | 147 |
| 3 | 3300050514 | nmdc:mga08x19_960495_c1 | nmdc:mga08x19_960495_c1_75_518 | 147 |
| 4 | 3300046684 | Ga0495669_0329878 | Ga0495669_0329878_56_547 | 154 |
| 5 | 3300046473 | Ga0495582_0878795 | Ga0495582_0878795_22_501 | 157 |
| 6 | 3300049587 | Ga0501071_0386544 | Ga0501071_0386544_107_580 | 157 |
| 7 | 3300006358 | Ga0068871_100009645 | Ga0068871_1000096455 | 159 |
| 8 | 3300005335 | Ga0070666_10220718 | Ga0070666_102207182 | 160 |
| 9 | 3300005338 | Ga0068868_100129392 | Ga0068868_1001293923 | 160 |
| 10 | 3300005544 | Ga0070686_100123737 | Ga0070686_1001237373 | 160 |
| 11 | 3300005718 | Ga0068866_10280875 | Ga0068866_102808752 | 160 |
| 12 | 3300005843 | Ga0068860_100352748 | Ga0068860_1003527482 | 160 |
| 13 | 3300006237 | Ga0097621_100035615 | Ga0097621_1000356155 | 160 |
| 14 | 3300006881 | Ga0068865_100015668 | Ga0068865_1000156685 | 160 |
| 15 | 3300009098 | Ga0105245_10883503 | Ga0105245_108835032 | 160 |
| 16 | 3300009176 | Ga0105242_10044121 | Ga0105242_100441212 | 160 |
| 17 | 3300014969 | Ga0157376_10128261 | Ga0157376_101282613 | 160 |
| 18 | 3300025899 | Ga0207642_10214760 | Ga0207642_102147602 | 160 |
| 19 | 3300025903 | Ga0207680_10142903 | Ga0207680_101429032 | 160 |
| 20 | 3300025934 | Ga0207686_10010022 | Ga0207686_100100222 | 160 |
| 21 | 3300025938 | Ga0207704_10030532 | Ga0207704_100305324 | 160 |
| 22 | 3300026023 | Ga0207677_10124891 | Ga0207677_101248913 | 160 |
| 23 | 3300026089 | Ga0207648_11014575 | Ga0207648_110145752 | 160 |
| 24 | 3300028381 | Ga0268264_10387572 | Ga0268264_103875722 | 160 |
| 25 | 3300049741 | Ga0501079_0766069 | Ga0501079_0766069_109_630 | 160 |
| 26 | 3300050512 | nmdc:mga0n895_45150_c1 | nmdc:mga0n895_45150_c1_2612_3124 | 162 |
| 27 | 3300050515 | nmdc:mga0a205_36554_c1 | nmdc:mga0a205_36554_c1_3348_3860 | 162 |
| 28 | 3300005293 | Ga0065715_10034554 | Ga0065715_100345542 | 165 |
| 29 | 3300005330 | Ga0070690_100155939 | Ga0070690_1001559392 | 165 |
| 30 | 3300005330 | Ga0070690_100240351 | Ga0070690_1002403512 | 165 |
| 31 | 3300005335 | Ga0070666_10021853 | Ga0070666_100218532 | 165 |
| 32 | 3300005338 | Ga0068868_101174046 | Ga0068868_1011740461 | 165 |
| 33 | 3300005340 | Ga0070689_100171523 | Ga0070689_1001715232 | 165 |
| 34 | 3300005353 | Ga0070669_100014262 | Ga0070669_1000142625 | 165 |
| 35 | 3300005354 | Ga0070675_100003227 | Ga0070675_1000032272 | 165 |
| 36 | 3300005355 | Ga0070671_100044984 | Ga0070671_1000449843 | 165 |
| 37 | 3300005364 | Ga0070673_100094750 | Ga0070673_1000947503 | 165 |
| 38 | 3300005367 | Ga0070667_100003098 | Ga0070667_1000030987 | 165 |
| 39 | 3300005440 | Ga0070705_100148661 | Ga0070705_1001486612 | 165 |
| 40 | 3300005518 | Ga0070699_100041269 | Ga0070699_1000412693 | 165 |
| 41 | 3300005536 | Ga0070697_100173235 | Ga0070697_1001732352 | 165 |
| 42 | 3300005543 | Ga0070672_100043883 | Ga0070672_1000438832 | 165 |
| 43 | 3300005543 | Ga0070672_100091780 | Ga0070672_1000917803 | 165 |
| 44 | 3300005544 | Ga0070686_100001079 | Ga0070686_1000010795 | 165 |
| 45 | 3300005544 | Ga0070686_100308612 | Ga0070686_1003086121 | 165 |
| 46 | 3300005578 | Ga0068854_100017104 | Ga0068854_1000171044 | 165 |
| 47 | 3300005617 | Ga0068859_100446812 | Ga0068859_1004468123 | 165 |
| 48 | 3300005719 | Ga0068861_100100298 | Ga0068861_1001002982 | 165 |
| 49 | 3300005841 | Ga0068863_100668228 | Ga0068863_1006682282 | 165 |
| 50 | 3300005842 | Ga0068858_100190477 | Ga0068858_1001904772 | 165 |
| 51 | 3300005844 | Ga0068862_100006564 | Ga0068862_1000065649 | 165 |
| 52 | 3300005844 | Ga0068862_101776263 | Ga0068862_1017762631 | 165 |
| 53 | 3300006163 | Ga0070715_10275991 | Ga0070715_102759912 | 165 |
| 54 | 3300006358 | Ga0068871_100623798 | Ga0068871_1006237982 | 165 |
| 55 | 3300006844 | Ga0075428_100260446 | Ga0075428_1002604462 | 165 |
| 56 | 3300006852 | Ga0075433_10013066 | Ga0075433_100130663 | 165 |
| 57 | 3300006852 | Ga0075433_10103847 | Ga0075433_101038473 | 165 |
| 58 | 3300006852 | Ga0075433_11363086 | Ga0075433_113630861 | 165 |
| 59 | 3300006871 | Ga0075434_100164439 | Ga0075434_1001644393 | 165 |
| 60 | 3300006871 | Ga0075434_100257159 | Ga0075434_1002571592 | 165 |
| 61 | 3300006871 | Ga0075434_100345072 | Ga0075434_1003450722 | 165 |
| 62 | 3300006871 | Ga0075434_100400393 | Ga0075434_1004003932 | 165 |
| 63 | 3300006880 | Ga0075429_100529567 | Ga0075429_1005295672 | 165 |
| 64 | 3300006931 | Ga0097620_100446720 | Ga0097620_1004467203 | 165 |
| 65 | 3300007076 | Ga0075435_100016646 | Ga0075435_1000166462 | 165 |
| 66 | 3300007076 | Ga0075435_100505102 | Ga0075435_1005051022 | 165 |
| 67 | 3300009093 | Ga0105240_10205897 | Ga0105240_102058973 | 165 |
| 68 | 3300009093 | Ga0105240_10781715 | Ga0105240_107817152 | 165 |
| 69 | 3300009094 | Ga0111539_10005304 | Ga0111539_1000530410 | 165 |
| 70 | 3300009094 | Ga0111539_10368574 | Ga0111539_103685741 | 165 |
| 71 | 3300009098 | Ga0105245_10359769 | Ga0105245_103597692 | 165 |
| 72 | 3300009147 | Ga0114129_10001158 | Ga0114129_1000115811 | 165 |
| 73 | 3300009147 | Ga0114129_10003110 | Ga0114129_100031103 | 165 |
| 74 | 3300009147 | Ga0114129_10488404 | Ga0114129_104884042 | 165 |
| 75 | 3300009174 | Ga0105241_10314505 | Ga0105241_103145052 | 165 |
| 76 | 3300009177 | Ga0105248_10019689 | Ga0105248_100196898 | 165 |
| 77 | 3300009177 | Ga0105248_10094645 | Ga0105248_100946452 | 165 |
| 78 | 3300009177 | Ga0105248_10538375 | Ga0105248_105383752 | 165 |
| 79 | 3300009177 | Ga0105248_11229688 | Ga0105248_112296881 | 165 |
| 80 | 3300009551 | Ga0105238_10696014 | Ga0105238_106960142 | 165 |
| 81 | 3300013296 | Ga0157374_10609994 | Ga0157374_106099942 | 165 |
| 82 | 3300013297 | Ga0157378_10766639 | Ga0157378_107666391 | 165 |
| 83 | 3300013308 | Ga0157375_10368823 | Ga0157375_103688232 | 165 |
| 84 | 3300014326 | Ga0157380_12469901 | Ga0157380_124699011 | 165 |
| 85 | 3300014745 | Ga0157377_10242871 | Ga0157377_102428711 | 165 |
| 86 | 3300014968 | Ga0157379_10733398 | Ga0157379_107333982 | 165 |
| 87 | 3300025315 | Ga0207697_10350886 | Ga0207697_103508861 | 165 |
| 88 | 3300025903 | Ga0207680_10008328 | Ga0207680_100083285 | 165 |
| 89 | 3300025905 | Ga0207685_10071261 | Ga0207685_100712612 | 165 |
| 90 | 3300025918 | Ga0207662_10033303 | Ga0207662_100333034 | 165 |
| 91 | 3300025923 | Ga0207681_10017039 | Ga0207681_100170395 | 165 |
| 92 | 3300025924 | Ga0207694_10296061 | Ga0207694_102960612 | 165 |
| 93 | 3300025926 | Ga0207659_10000159 | Ga0207659_100001593 | 165 |
| 94 | 3300025931 | Ga0207644_10233785 | Ga0207644_102337852 | 165 |
| 95 | 3300025936 | Ga0207670_10236688 | Ga0207670_102366882 | 165 |
| 96 | 3300025940 | Ga0207691_10160655 | Ga0207691_101606551 | 165 |
| 97 | 3300025941 | Ga0207711_10097933 | Ga0207711_100979332 | 165 |
| 98 | 3300025941 | Ga0207711_10257389 | Ga0207711_102573892 | 165 |
| 99 | 3300025941 | Ga0207711_10567971 | Ga0207711_105679711 | 165 |
| 100 | 3300025941 | Ga0207711_10597296 | Ga0207711_105972962 | 165 |
| 101 | 3300025941 | Ga0207711_10923539 | Ga0207711_109235391 | 165 |
| 102 | 3300025949 | Ga0207667_10973780 | Ga0207667_109737802 | 165 |
| 103 | 3300025960 | Ga0207651_10156130 | Ga0207651_101561302 | 165 |
| 104 | 3300025981 | Ga0207640_10071898 | Ga0207640_100718982 | 165 |
| 105 | 3300026023 | Ga0207677_11483629 | Ga0207677_114836292 | 165 |
| 106 | 3300026121 | Ga0207683_10999819 | Ga0207683_109998191 | 165 |
| 107 | 3300027907 | Ga0207428_10462422 | Ga0207428_104624222 | 165 |
| 108 | 3300028379 | Ga0268266_10126823 | Ga0268266_101268232 | 165 |
| 109 | 3300028380 | Ga0268265_10007284 | Ga0268265_100072843 | 165 |
| 110 | 3300034816 | Ga0373930_0040153 | Ga0373930_0040153_274_783 | 165 |
| 111 | 3300034817 | Ga0373948_0000785 | Ga0373948_0000785_1802_2311 | 165 |
| 112 | 3300034818 | Ga0373950_0095083 | Ga0373950_0095083_12_521 | 165 |
| 113 | 3300034819 | Ga0373958_0000186 | Ga0373958_0000186_456_965 | 165 |
| 114 | 3300034957 | Ga0373938_0001463 | Ga0373938_0001463_262_771 | 165 |
| 115 | 3300035084 | Ga0373928_0000608 | Ga0373928_0000608_4622_5131 | 165 |
| 116 | 3300035085 | Ga0373929_0000093 | Ga0373929_0000093_8999_9508 | 165 |
| 117 | 3300035088 | Ga0373940_0000166 | Ga0373940_0000166_5556_6065 | 165 |
| 118 | 3300035090 | Ga0373949_0002627 | Ga0373949_0002627_2490_2999 | 165 |
| 119 | 3300035091 | Ga0373951_0000399 | Ga0373951_0000399_10159_10668 | 165 |
| 120 | 3300035092 | Ga0373952_0000805 | Ga0373952_0000805_3835_4344 | 165 |
| 121 | 3300035112 | Ga0373932_0001244 | Ga0373932_0001244_2044_2553 | 165 |
| 122 | 3300035114 | Ga0373939_0000289 | Ga0373939_0000289_5415_5924 | 165 |
| 123 | 3300035115 | Ga0373941_0000206 | Ga0373941_0000206_9982_10491 | 165 |
| 124 | 3300035207 | Ga0373942_0000215 | Ga0373942_0000215_3489_3998 | 165 |
| 125 | 3300035241 | Ga0373961_0000432 | Ga0373961_0000432_10549_11058 | 165 |
| 126 | 3300035242 | Ga0373962_0079021 | Ga0373962_0079021_317_826 | 165 |
| 127 | 3300035691 | Ga0373931_0016758 | Ga0373931_0016758_2425_2934 | 165 |
| 128 | 3300035725 | Ga0373947_0590735 | Ga0373947_0590735_59_562 | 165 |
| 129 | 3300037068 | Ga0373925_0733067 | Ga0373925_0733067_147_650 | 165 |
| 130 | 3300038443 | Ga0395901_0532898 | Ga0395901_0532898_82_585 | 165 |
| 131 | 3300042436 | Ga0439435_0077278 | Ga0439435_0077278_190_687 | 165 |
| 132 | 3300045051 | Ga0451576_0004321 | Ga0451576_0004321_1664_2173 | 165 |
| 133 | 3300045051 | Ga0451576_0064695 | Ga0451576_0064695_2023_2526 | 165 |
| 134 | 3300046473 | Ga0495582_0093445 | Ga0495582_0093445_983_1486 | 165 |
| 135 | 3300046558 | Ga0495633_0052604 | Ga0495633_0052604_1273_1779 | 165 |
| 136 | 3300046683 | Ga0495658_0330561 | Ga0495658_0330561_321_824 | 165 |
| 137 | 3300046691 | Ga0495670_0550761 | Ga0495670_0550761_104_610 | 165 |
| 138 | 3300048904 | Ga0496101_0634786 | Ga0496101_0634786_232_741 | 165 |
| 139 | 3300048905 | Ga0496102_0175797 | Ga0496102_0175797_1493_2002 | 165 |
| 140 | 3300048905 | Ga0496102_1151916 | Ga0496102_1151916_68_571 | 165 |
| 141 | 3300048908 | Ga0496105_0252222 | Ga0496105_0252222_616_1119 | 165 |
| 142 | 3300048909 | Ga0496106_0096085 | Ga0496106_0096085_1496_2005 | 165 |
| 143 | 3300048910 | Ga0496107_0229605 | Ga0496107_0229605_49_558 | 165 |
| 144 | 3300048915 | Ga0496112_0018065 | Ga0496112_0018065_1844_2347 | 165 |
| 145 | 3300049575 | Ga0501039_0162560 | Ga0501039_0162560_452_964 | 165 |
| 146 | 3300049576 | Ga0501040_0177708 | Ga0501040_0177708_868_1380 | 165 |
| 147 | 3300049578 | Ga0501042_0132342 | Ga0501042_0132342_1167_1679 | 165 |
| 148 | 3300049579 | Ga0501043_0661753 | Ga0501043_0661753_202_714 | 165 |
| 149 | 3300049588 | Ga0501072_0016213 | Ga0501072_0016213_3756_4268 | 165 |
| 150 | 3300049590 | Ga0501074_0147089 | Ga0501074_0147089_144_656 | 165 |
| 151 | 3300049743 | Ga0501081_0144655 | Ga0501081_0144655_428_940 | 165 |
| 152 | 3300050507 | nmdc:mga05p37_11826_c1 | nmdc:mga05p37_11826_c1_703_1206 | 165 |
| 153 | 3300050507 | nmdc:mga05p37_124986_c1 | nmdc:mga05p37_124986_c1_1158_1661 | 165 |
| 154 | 3300050507 | nmdc:mga05p37_30035_c1 | nmdc:mga05p37_30035_c1_5417_5920 | 165 |
| 155 | 3300050507 | nmdc:mga05p37_495456_c1 | nmdc:mga05p37_495456_c1_401_913 | 165 |
| 156 | 3300050507 | nmdc:mga05p37_57250_c1 | nmdc:mga05p37_57250_c1_3322_3825 | 165 |
| 157 | 3300050511 | nmdc:mga08y16_194873_c1 | nmdc:mga08y16_194873_c1_1444_1947 | 165 |
| 158 | 3300050512 | nmdc:mga0n895_14738_c1 | nmdc:mga0n895_14738_c1_1215_1718 | 165 |
| 159 | 3300050512 | nmdc:mga0n895_270017_c1 | nmdc:mga0n895_270017_c1_919_1428 | 165 |
| 160 | 3300050512 | nmdc:mga0n895_45030_c1 | nmdc:mga0n895_45030_c1_684_1187 | 165 |
| 161 | 3300050512 | nmdc:mga0n895_634705_c1 | nmdc:mga0n895_634705_c1_147_650 | 165 |
| 162 | 3300050513 | nmdc:mga0rr50_132017_c1 | nmdc:mga0rr50_132017_c1_308_820 | 165 |
| 163 | 3300050513 | nmdc:mga0rr50_483071_c1 | nmdc:mga0rr50_483071_c1_150_653 | 165 |
| 164 | 3300050513 | nmdc:mga0rr50_57820_c1 | nmdc:mga0rr50_57820_c1_2151_2654 | 165 |
| 165 | 3300050515 | nmdc:mga0a205_129715_c1 | nmdc:mga0a205_129715_c1_917_1420 | 165 |
| 166 | 3300053085 | Ga0495619_0123360 | Ga0495619_0123360_952_1455 | 165 |
| 167 | 3300054114 | Ga0501084_0024988 | Ga0501084_0024988_571_1083 | 165 |
| 168 | 3300061734 | Ga0530510_0640311 | Ga0530510_0640311_264_761 | 165 |
| 169 | 3300005841 | Ga0068863_100024942 | Ga0068863_1000249421 | 167 |
| 170 | 3300006914 | Ga0075436_100041507 | Ga0075436_1000415074 | 167 |
| 171 | 3300007076 | Ga0075435_100014246 | Ga0075435_1000142463 | 167 |
| 172 | 3300007076 | Ga0075435_100105540 | Ga0075435_1001055402 | 167 |
| 173 | 3300009094 | Ga0111539_10654434 | Ga0111539_106544342 | 167 |
| 174 | 3300009147 | Ga0114129_10358441 | Ga0114129_103584412 | 167 |
| 175 | 3300026088 | Ga0207641_10003384 | Ga0207641_100033849 | 167 |
| 176 | 3300035084 | Ga0373928_0115090 | Ga0373928_0115090_83_592 | 167 |
| 177 | 3300035115 | Ga0373941_0009755 | Ga0373941_0009755_517_1026 | 167 |
| 178 | 3300035241 | Ga0373961_0028469 | Ga0373961_0028469_714_1223 | 167 |
| 179 | 3300049584 | Ga0501068_0654796 | Ga0501068_0654796_109_636 | 167 |
| 180 | 3300050515 | nmdc:mga0a205_999053_c1 | nmdc:mga0a205_999053_c1_135_653 | 167 |
| 181 | 3300048909 | Ga0496106_0154438 | Ga0496106_0154438_1259_1786 | 170 |
| 182 | 3300006173 | Ga0070716_100825090 | Ga0070716_1008250902 | 172 |
| 183 | 3300005844 | Ga0068862_100040498 | Ga0068862_1000404981 | 173 |
| 184 | 3300006846 | Ga0075430_100001102 | Ga0075430_1000011025 | 173 |
| 185 | 3300006847 | Ga0075431_100174066 | Ga0075431_1001740662 | 173 |
| 186 | 3300006880 | Ga0075429_100826586 | Ga0075429_1008265861 | 173 |
| 187 | 3300009094 | Ga0111539_10105555 | Ga0111539_101055552 | 173 |
| 188 | 3300009147 | Ga0114129_10703430 | Ga0114129_107034302 | 173 |
| 189 | 3300009148 | Ga0105243_11349716 | Ga0105243_113497162 | 173 |
| 190 | 3300009553 | Ga0105249_10673452 | Ga0105249_106734522 | 173 |
| 191 | 3300009553 | Ga0105249_11441511 | Ga0105249_114415112 | 173 |
| 192 | 3300025915 | Ga0207693_10313933 | Ga0207693_103139332 | 173 |
| 193 | 3300025961 | Ga0207712_10541344 | Ga0207712_105413441 | 173 |
| 194 | 3300031548 | Ga0307408_100301768 | Ga0307408_1003017682 | 173 |
| 195 | 3300049572 | Ga0501036_1197185 | Ga0501036_1197185_79_600 | 173 |
| 196 | 3300049575 | Ga0501039_0230547 | Ga0501039_0230547_732_1253 | 173 |
| 197 | 3300049576 | Ga0501040_0048433 | Ga0501040_0048433_1717_2238 | 173 |
| 198 | 3300049576 | Ga0501040_0157536 | Ga0501040_0157536_1034_1555 | 173 |
| 199 | 3300049577 | Ga0501041_0081147 | Ga0501041_0081147_523_1044 | 173 |
| 200 | 3300049580 | Ga0501046_0629446 | Ga0501046_0629446_162_683 | 173 |
| 201 | 3300049582 | Ga0501048_0298905 | Ga0501048_0298905_609_1130 | 173 |
| 202 | 3300049586 | Ga0501070_0886381 | Ga0501070_0886381_145_666 | 173 |
| 203 | 3300049588 | Ga0501072_0015844 | Ga0501072_0015844_1448_1969 | 173 |
| 204 | 3300049588 | Ga0501072_0121588 | Ga0501072_0121588_861_1382 | 173 |
| 205 | 3300049588 | Ga0501072_0447782 | Ga0501072_0447782_103_630 | 173 |
| 206 | 3300049590 | Ga0501074_0091409 | Ga0501074_0091409_892_1413 | 173 |
| 207 | 3300049592 | Ga0501076_0025791 | Ga0501076_0025791_2719_3240 | 173 |
| 208 | 3300049593 | Ga0501077_0187860 | Ga0501077_0187860_702_1223 | 173 |
| 209 | 3300049742 | Ga0501080_0763658 | Ga0501080_0763658_296_817 | 173 |
| 210 | 3300049743 | Ga0501081_0121064 | Ga0501081_0121064_546_1067 | 173 |
| 211 | 3300049824 | Ga0501045_0039098 | Ga0501045_0039098_723_1244 | 173 |
| 212 | 3300049824 | Ga0501045_0048958 | Ga0501045_0048958_2510_3031 | 173 |
| 213 | 3300050507 | nmdc:mga05p37_10350_c1 | nmdc:mga05p37_10350_c1_10509_11030 | 173 |
| 214 | 3300050507 | nmdc:mga05p37_506410_c1 | nmdc:mga05p37_506410_c1_807_1328 | 173 |
| 215 | 3300050507 | nmdc:mga05p37_720190_c1 | nmdc:mga05p37_720190_c1_24_545 | 173 |
| 216 | 3300050509 | nmdc:mga0qj67_6296_c1 | nmdc:mga0qj67_6296_c1_2602_3123 | 173 |
| 217 | 3300050510 | nmdc:mga06r32_160297_c1 | nmdc:mga06r32_160297_c1_1632_2153 | 173 |
| 218 | 3300050515 | nmdc:mga0a205_308693_c1 | nmdc:mga0a205_308693_c1_162_683 | 173 |
| 219 | 3300060353 | Ga0501082_0025216 | Ga0501082_0025216_2710_3231 | 173 |
| 220 | 3300060353 | Ga0501082_0059352 | Ga0501082_0059352_2178_2699 | 173 |
| 221 | 3300061734 | Ga0530510_0182770 | Ga0530510_0182770_412_933 | 173 |
| 222 | 3300005340 | Ga0070689_100060921 | Ga0070689_1000609212 | 174 |
| 223 | 3300005544 | Ga0070686_100201311 | Ga0070686_1002013112 | 174 |
| 224 | 3300005617 | Ga0068859_100063210 | Ga0068859_1000632103 | 174 |
| 225 | 3300005841 | Ga0068863_100281127 | Ga0068863_1002811272 | 174 |
| 226 | 3300006358 | Ga0068871_100994679 | Ga0068871_1009946791 | 174 |
| 227 | 3300006852 | Ga0075433_10297512 | Ga0075433_102975122 | 174 |
| 228 | 3300006931 | Ga0097620_100063213 | Ga0097620_1000632134 | 174 |
| 229 | 3300009094 | Ga0111539_11180494 | Ga0111539_111804941 | 174 |
| 230 | 3300009177 | Ga0105248_10024153 | Ga0105248_100241534 | 174 |
| 231 | 3300013306 | Ga0163162_10182533 | Ga0163162_101825333 | 174 |
| 232 | 3300013308 | Ga0157375_10031891 | Ga0157375_100318913 | 174 |
| 233 | 3300014969 | Ga0157376_10207735 | Ga0157376_102077353 | 174 |
| 234 | 3300025903 | Ga0207680_10085779 | Ga0207680_100857792 | 174 |
| 235 | 3300025941 | Ga0207711_10024472 | Ga0207711_100244722 | 174 |
| 236 | 3300028381 | Ga0268264_10715795 | Ga0268264_107157952 | 174 |
| 237 | 3300048911 | Ga0496108_0987044 | Ga0496108_0987044_89_628 | 174 |
| 238 | 3300049587 | Ga0501071_0130751 | Ga0501071_0130751_103_627 | 174 |
| 239 | 3300049592 | Ga0501076_0495112 | Ga0501076_0495112_401_925 | 174 |
| 240 | 3300050515 | nmdc:mga0a205_647970_c1 | nmdc:mga0a205_647970_c1_155_679 | 174 |
| 241 | 3300005290 | Ga0065712_10268828 | Ga0065712_102688281 | 175 |
| 242 | 3300005293 | Ga0065715_10034436 | Ga0065715_100344362 | 175 |
| 243 | 3300005471 | Ga0070698_100058771 | Ga0070698_1000587713 | 175 |
| 244 | 3300006846 | Ga0075430_100053461 | Ga0075430_1000534612 | 175 |
| 245 | 3300031548 | Ga0307408_100215001 | Ga0307408_1002150012 | 175 |
| 246 | 3300046531 | Ga0495665_0548501 | Ga0495665_0548501_31_567 | 175 |
| 247 | 3300049568 | Ga0501031_0157281 | Ga0501031_0157281_349_888 | 175 |
| 248 | 3300049589 | Ga0501073_0132004 | Ga0501073_0132004_843_1370 | 175 |
| 249 | 3300049590 | Ga0501074_0067025 | Ga0501074_0067025_1299_1826 | 175 |
| 250 | 3300049591 | Ga0501075_0398766 | Ga0501075_0398766_97_633 | 175 |
| 251 | 3300049592 | Ga0501076_0116731 | Ga0501076_0116731_897_1424 | 175 |
| 252 | 3300049592 | Ga0501076_1172832 | Ga0501076_1172832_68_607 | 175 |
| 253 | 3300049593 | Ga0501077_0212220 | Ga0501077_0212220_498_1034 | 175 |
| 254 | 3300049741 | Ga0501079_0029841 | Ga0501079_0029841_3215_3742 | 175 |
| 255 | 3300049742 | Ga0501080_0446295 | Ga0501080_0446295_438_965 | 175 |
| 256 | 3300050509 | nmdc:mga0qj67_61066_c1 | nmdc:mga0qj67_61066_c1_127_657 | 175 |
| 257 | 3300060353 | Ga0501082_0067932 | Ga0501082_0067932_2303_2830 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5c7q-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.9274 | 6 | 173 |
| 5c8l-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.9248 | 4 | 173 |
| 5i8u-assembly4.cif.gz_E | crystal structure of the rv1700 (mt adprase) e142q mutant | 0.9025 | 7 | 174 |
| 1mk1-assembly1.cif.gz_A | structure of the mt-adprase in complex with adpr, a nudix enzyme | 0.9025 | 7 | 174 |
| 6zgn-assembly1.cif.gz_A | crystal structure of virb8-like orfg central domain of streptococcus thermophilus icest3; a putative assembly factor of a gram positive conjugative type iv secretion system. | 0.8975 | 6 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5c8lB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9248 | 4 | 173 | 3.90.79.10 |
| af_Q2FY72_1_175_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9125 | 3 | 173 | 3.90.79.10 |
| 5c8lB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8847 | 4 | 173 | 3.90.79.10 |
| 5i8uB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8801 | 7 | 174 | 3.90.79.10 |
| 3o69B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8659 | 6 | 173 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0QDW6-F1-model_v4 | NUDIX hydrolase | 0.9656 | 6 | 130 |
GO:0005829
GO:0006753 GO:0016462 GO:0019693 |
| AF-A0A2W5XA52-F1-model_v4 | ADP-ribose pyrophosphatase | 0.9646 | 6 | 174 |
GO:0006753
GO:0016787 GO:0019693 |
| AF-A0A3N5ZHX6-F1-model_v4 | NUDIX hydrolase | 0.9645 | 6 | 175 |
GO:0005829
GO:0006753 GO:0016787 GO:0019693 |
| AF-A0A523Y0W8-F1-model_v4 | NUDIX hydrolase | 0.9629 | 6 | 174 |
GO:0006753
GO:0016787 GO:0019693 |
| AF-A0A523TUP5-F1-model_v4 | NUDIX hydrolase | 0.9618 | 6 | 174 |
GO:0006753
GO:0016787 GO:0019693 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar