F366239

General Info

Members Datasets Scaffolds Average Seq Length
256 162 512 151

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100098317|Ga0068868_1000983172
Length 176
Sequence MWSARRVYRLGSGLCKQVSVRRSLLCYKPAVKREFSAGGVLVRRLKGEWVLAAIRPAGKKPGLWALPKGNIAAGEDPRETALREVHEETGAHGRLVEKLGDVRYTYTWAGERIFKIVSFFLLRYASGRLGDLPSETAHEVDEVRWLPLDEAPKLLAYGGERQMAEKALAFVRNGAV

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
94 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 11.72
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100098317 3300005338 Bacteria 2366
2 Ga0070683_100035978 3300005329 Bacteria 4529
3 Ga0070683_100095157 3300005329 Bacteria 2800
4 Ga0070683_100135069 3300005329 Bacteria 2335
5 Ga0068869_100060009 3300005334 Bacteria 2786
6 Ga0068868_101031994 3300005338 Unclassified 754
7 Ga0070661_100191418 3300005344 Unclassified 1560
8 Ga0070661_100760915 3300005344 Unclassified 793
9 Ga0070675_100776576 3300005354 Unclassified 875
10 Ga0070675_101980574 3300005354 Unclassified 537
11 Ga0070659_100238511 3300005366 Bacteria 1504
12 Ga0070709_10094177 3300005434 Bacteria 1981
13 Ga0070709_10128903 3300005434 Bacteria 1724
14 Ga0070709_10137929 3300005434 Bacteria 1672
15 Ga0070714_100235147 3300005435 Bacteria 1689
16 Ga0070714_100392388 3300005435 Bacteria 1310
17 Ga0070714_100765819 3300005435 Bacteria 934
18 Ga0070713_100043151 3300005436 Bacteria 3685
19 Ga0070713_100056853 3300005436 Bacteria 3255
20 Ga0070713_100076163 3300005436 Bacteria 2848
21 Ga0070713_100097184 3300005436 Bacteria 2544
22 Ga0070711_100142694 3300005439 Bacteria 1797
23 Ga0070711_100485657 3300005439 Bacteria 1016
24 Ga0070705_100094701 3300005440 Bacteria 1870
25 Ga0070705_100394722 3300005440 Bacteria 1023
26 Ga0070700_100243749 3300005441 Bacteria 1286
27 Ga0070708_101349399 3300005445 Bacteria 666
28 Ga0070662_100487505 3300005457 Bacteria 1027
29 Ga0068867_100498063 3300005459 Bacteria 1047
30 Ga0070706_100292644 3300005467 Bacteria 1519
31 Ga0070706_101227116 3300005467 Bacteria 689
32 Ga0070707_100023400 3300005468 Bacteria 5845
33 Ga0070707_100234119 3300005468 Bacteria 1787
34 Ga0070707_100784534 3300005468 Bacteria 916
35 Ga0070698_100024916 3300005471 Bacteria 6236
36 Ga0070699_100062423 3300005518 Bacteria 3229
37 Ga0070699_100572936 3300005518 Bacteria 1028
38 Ga0070699_100667004 3300005518 Bacteria 949
39 Ga0070684_100010746 3300005535 Bacteria 7267
40 Ga0070684_100152446 3300005535 Bacteria 2094
41 Ga0070697_100339019 3300005536 Bacteria 1297
42 Ga0068853_100177501 3300005539 Bacteria 1930
43 Ga0070704_100038219 3300005549 Bacteria 3286
44 Ga0070704_100082760 3300005549 Bacteria 2368
45 Ga0070704_100244374 3300005549 Bacteria 1470
46 Ga0070704_100452752 3300005549 Bacteria 1105
47 Ga0068855_100032956 3300005563 Bacteria 6185
48 Ga0070664_100322701 3300005564 Bacteria 1399
49 Ga0068857_100052895 3300005577 Bacteria 3602
50 Ga0068857_100447282 3300005577 Bacteria 1207
51 Ga0068856_101418202 3300005614 Bacteria 709
52 Ga0070702_100012275 3300005615 Bacteria 4287
53 Ga0068862_100607720 3300005844 Bacteria 1051
54 Ga0081455_10021055 3300005937 Bacteria 6124
55 Ga0081455_10248965 3300005937 Bacteria 1301
56 Ga0070717_10042948 3300006028 Bacteria 3688
57 Ga0070717_10075393 3300006028 Bacteria 2821
58 Ga0070717_10153057 3300006028 Bacteria 1996
59 Ga0070716_100019204 3300006173 Bacteria 3570
60 Ga0070712_100061841 3300006175 Bacteria 2646
61 Ga0070712_101238011 3300006175 Unclassified 650
62 Ga0075431_100678165 3300006847 Bacteria 1009
63 Ga0075433_10150050 3300006852 Bacteria 2073
64 Ga0075433_11414528 3300006852 Bacteria 601
65 Ga0075434_100100163 3300006871 Bacteria 2903
66 Ga0075436_100099424 3300006914 Bacteria 2025
67 Ga0075435_100068872 3300007076 Bacteria 2883
68 Ga0075435_100097623 3300007076 Bacteria 2431
69 Ga0075435_100471585 3300007076 Bacteria 1084
70 Ga0111539_10871351 3300009094 Bacteria 1047
71 Ga0105245_10023440 3300009098 Bacteria 5418
72 Ga0105245_10230462 3300009098 Bacteria 1791
73 Ga0105245_11620058 3300009098 Bacteria 699
74 Ga0105243_10497649 3300009148 Bacteria 1154
75 Ga0105243_10625464 3300009148 Bacteria 1040
76 Ga0105242_10097872 3300009176 Bacteria 2481
77 Ga0105237_10836638 3300009545 Bacteria 927
78 Ga0105237_11123876 3300009545 Unclassified 792
79 Ga0105239_10107250 3300010375 Bacteria 3094
80 Ga0105239_12113756 3300010375 Bacteria 654
81 Ga0163162_10135378 3300013306 Bacteria 2574
82 Ga0157375_10309001 3300013308 Bacteria 1745
83 Ga0157375_11635584 3300013308 Bacteria 762
84 Ga0163163_10118937 3300014325 Bacteria 2675
85 Ga0157380_10258264 3300014326 Bacteria 1581
86 Ga0197907_10330737 3300020069 Bacteria 2923
87 Ga0207688_10020708 3300025901 Bacteria 3591
88 Ga0207688_10102305 3300025901 Bacteria 1656
89 Ga0207699_10025612 3300025906 Bacteria 3240
90 Ga0207699_10176972 3300025906 Bacteria 1431
91 Ga0207684_10509912 3300025910 Bacteria 1031
92 Ga0207693_10050265 3300025915 Bacteria 3274
93 Ga0207693_10192859 3300025915 Bacteria 1603
94 Ga0207693_10339843 3300025915 Bacteria 1175
95 Ga0207663_10050469 3300025916 Bacteria 2585
96 Ga0207663_10376130 3300025916 Bacteria 1081
97 Ga0207649_10381148 3300025920 Bacteria 1051
98 Ga0207646_10556789 3300025922 Bacteria 1031
99 Ga0207659_10788080 3300025926 Unclassified 816
100 Ga0207687_10011470 3300025927 Bacteria 5793
101 Ga0207687_11173302 3300025927 Bacteria 660
102 Ga0207700_10000001 3300025928 Bacteria 1122509
103 Ga0207700_10365205 3300025928 Bacteria 1259
104 Ga0207700_10684077 3300025928 Bacteria 915
105 Ga0207664_10049414 3300025929 Bacteria 3311
106 Ga0207664_10269669 3300025929 Bacteria 1491
107 Ga0207664_10320082 3300025929 Bacteria 1368
108 Ga0207664_11490193 3300025929 Bacteria 598
109 Ga0207644_10241726 3300025931 Bacteria 1438
110 Ga0207690_10228063 3300025932 Bacteria 1428
111 Ga0207706_10313386 3300025933 Bacteria 1366
112 Ga0207686_10212143 3300025934 Bacteria 1393
113 Ga0207709_10029386 3300025935 Bacteria 3188
114 Ga0207709_10135843 3300025935 Bacteria 1683
115 Ga0207665_10030176 3300025939 Bacteria 3584
116 Ga0207665_10064208 3300025939 Bacteria 2495
117 Ga0207665_10067890 3300025939 Bacteria 2429
118 Ga0207689_10097722 3300025942 Bacteria 2412
119 Ga0207661_10018244 3300025944 Bacteria 5211
120 Ga0207661_10019125 3300025944 Bacteria 5100
121 Ga0207679_10210264 3300025945 Bacteria 1631
122 Ga0207712_10044115 3300025961 Bacteria 3080
123 Ga0207668_10165478 3300025972 Bacteria 1728
124 Ga0207640_10221847 3300025981 Bacteria 1448
125 Ga0207640_10332265 3300025981 Bacteria 1214
126 Ga0207648_10300788 3300026089 Bacteria 1439
127 Ga0207674_10008326 3300026116 Bacteria 11996
128 Ga0207674_10281508 3300026116 Bacteria 1611
129 Ga0207675_100017381 3300026118 Bacteria 6714
130 Ga0207675_100208652 3300026118 Bacteria 1878
131 Ga0268265_10213031 3300028380 Bacteria 1685
132 Ga0265319_1062545 3300028563 Bacteria 1205
133 Ga0265322_10043078 3300028654 Bacteria 1285
134 Ga0265316_10090925 3300031344 Bacteria 2329
135 Ga0307408_100990897 3300031548 Bacteria 774
136 Ga0307411_10333666 3300032005 Bacteria 1230
137 Ga0316583_10080909 3300032133 Bacteria 1135
138 Ga0373931_1181294 3300035691 Unclassified 523
139 Ga0395899_0006793 3300037312 Bacteria 8867
140 Ga0395899_0022566 3300037312 Bacteria 4769
141 Ga0395899_0354746 3300037312 Bacteria 980
142 Ga0395900_0023217 3300037418 Bacteria 6349
143 Ga0395900_0028418 3300037418 Bacteria 5727
144 Ga0395900_0064945 3300037418 Bacteria 3749
145 Ga0395900_0094601 3300037418 Bacteria 3069
146 Ga0395900_0416075 3300037418 Bacteria 1306
147 Ga0395900_0754267 3300037418 Bacteria 903
148 Ga0395898_0010359 3300037466 Bacteria 9750
149 Ga0395898_0026311 3300037466 Bacteria 5857
150 Ga0395898_0079935 3300037466 Bacteria 3153
151 Ga0395898_0741070 3300037466 Bacteria 924
152 Ga0395905_0158840 3300037471 Bacteria 2125
153 Ga0395905_0226825 3300037471 Bacteria 1747
154 Ga0395905_0317680 3300037471 Bacteria 1447
155 Ga0395901_0007398 3300038443 Bacteria 11079
156 Ga0395901_0035594 3300038443 Bacteria 5144
157 Ga0395901_0136461 3300038443 Bacteria 2578
158 Ga0395901_0140844 3300038443 Bacteria 2535
159 Ga0436360_0634747 3300039438 Bacteria 1685
160 Ga0451793_0647640 3300041452 Bacteria 1621
161 Ga0451800_0931018 3300041459 Bacteria 1382
162 Ga0451802_2097481 3300041460 Bacteria 888
163 Ga0451806_055893 3300041462 Bacteria 663
164 Ga0451804_1030547 3300041463 Bacteria 794
165 Ga0451841_0677501 3300041498 Bacteria 588
166 Ga0451853_0062829 3300041512 Bacteria 5595
167 Ga0466972_0456732 3300044658 Unclassified 600
168 Ga0466961_0564473 3300044693 Bacteria 685
169 Ga0466963_0010963 3300044694 Bacteria 5509
170 Ga0466964_0327789 3300044706 Bacteria 780
171 Ga0466960_0065598 3300044901 Bacteria 1793
172 Ga0466960_0252144 3300044901 Bacteria 981
173 Ga0466958_0018889 3300045836 Bacteria 4006
174 Ga0466967_0032749 3300045976 Bacteria 4393
175 Ga0466967_0060058 3300045976 Bacteria 3367
176 Ga0466967_0319981 3300045976 Bacteria 1496
177 Ga0466967_0379383 3300045976 Bacteria 1372
178 Ga0466967_0423141 3300045976 Bacteria 1298
179 Ga0466967_2047497 3300045976 Bacteria 569
180 Ga0495590_0055454 3300046457 Bacteria 1385
181 Ga0495584_0020255 3300046491 Bacteria 3380
182 Ga0495585_0287207 3300046492 Unclassified 812
183 Ga0495596_0101423 3300046500 Bacteria 1117
184 Ga0495607_0231767 3300046501 Bacteria 898
185 Ga0495616_0039167 3300046513 Bacteria 2429
186 Ga0495628_0220232 3300046516 Bacteria 1425
187 Ga0495631_0039893 3300046518 Bacteria 2081
188 Ga0495631_0124288 3300046518 Bacteria 1109
189 Ga0495644_0045205 3300046523 Bacteria 1656
190 Ga0495644_0076063 3300046523 Bacteria 1265
191 Ga0495663_0016532 3300046525 Bacteria 2085
192 Ga0495642_0044806 3300046528 Bacteria 1806
193 Ga0495598_0041959 3300046537 Bacteria 1341
194 Ga0495656_0492276 3300046615 Bacteria 649
195 Ga0495668_0046654 3300046616 Bacteria 2407
196 Ga0495659_0232876 3300046664 Bacteria 763
197 Ga0495671_0028069 3300046692 Bacteria 2902
198 Ga0495589_0200128 3300046794 Bacteria 943
199 Ga0495660_0092519 3300046810 Bacteria 1569
200 Ga0495636_0105196 3300047318 Bacteria 1237
201 Ga0495674_0266723 3300047319 Bacteria 1406
202 Ga0495683_0076028 3300047323 Bacteria 1644
203 Ga0495677_0032628 3300047445 Bacteria 1897
204 Ga0495602_0325683 3300048088 Bacteria 1116
205 Ga0495626_0048673 3300048091 Bacteria 1966
206 Ga0496100_0602315 3300048903 Bacteria 853
207 Ga0496101_0341502 3300048904 Bacteria 1176
208 Ga0496101_1438050 3300048904 Bacteria 537
209 Ga0496102_0255141 3300048905 Bacteria 1653
210 Ga0496102_0425460 3300048905 Bacteria 1247
211 Ga0496103_0389100 3300048906 Unclassified 896
212 Ga0496104_0191210 3300048907 Bacteria 1958
213 Ga0496105_0171787 3300048908 Bacteria 1777
214 Ga0496106_0191934 3300048909 Bacteria 1624
215 Ga0496108_0074780 3300048911 Bacteria 2861
216 Ga0496108_0113003 3300048911 Bacteria 2324
217 Ga0496108_0706795 3300048911 Bacteria 874
218 Ga0496109_0054245 3300048912 Bacteria 3656
219 Ga0496109_0081466 3300048912 Bacteria 2982
220 Ga0496109_0108092 3300048912 Bacteria 2585
221 Ga0496110_0045256 3300048913 Bacteria 3846
222 Ga0496110_0164171 3300048913 Bacteria 2013
223 Ga0496110_0184962 3300048913 Bacteria 1892
224 Ga0496110_0393406 3300048913 Bacteria 1263
225 Ga0496111_0058762 3300048914 Bacteria 2784
226 Ga0496111_0116434 3300048914 Bacteria 1971
227 Ga0496111_0155635 3300048914 Bacteria 1696
228 Ga0496112_0139479 3300048915 Bacteria 2394
229 Ga0496113_0051861 3300048916 Bacteria 3062
230 Ga0496113_1482369 3300048916 Unclassified 524
231 Ga0501032_0534238 3300049569 Unclassified 748
232 Ga0501040_1052263 3300049576 Unclassified 590
233 Ga0501042_0073938 3300049578 Bacteria 2438
234 Ga0501048_0346437 3300049582 Bacteria 1059
235 Ga0501071_0765849 3300049587 Bacteria 744
236 Ga0501072_0640905 3300049588 Bacteria 837
237 Ga0501074_0481389 3300049590 Bacteria 880
238 Ga0501074_1201115 3300049590 Bacteria 532
239 Ga0501076_1594725 3300049592 Bacteria 536
240 Ga0501081_0205830 3300049743 Bacteria 1428
241 Ga0501081_1016740 3300049743 Bacteria 626
242 Ga0501035_1284204 3300049822 Bacteria 565
243 Ga0501045_0665401 3300049824 Bacteria 769
244 nmdc:mga0yw44_792575_c1 3300050492 Bacteria 643
245 nmdc:mga05p37_544181_c1 3300050507 Bacteria 1323
246 nmdc:mga0qj67_108511_c1 3300050509 Bacteria 2240
247 nmdc:mga06r32_345904_c1 3300050510 Bacteria 1471
248 nmdc:mga08y16_370757_c1 3300050511 Bacteria 1469
249 nmdc:mga0n895_125445_c1 3300050512 Bacteria 2591
250 nmdc:mga0n895_244645_c1 3300050512 Bacteria 1821
251 nmdc:mga0n895_568738_c1 3300050512 Bacteria 1138
252 nmdc:mga0rr50_18347_c1 3300050513 Bacteria 4698
253 nmdc:mga08x19_91153_c1 3300050514 Bacteria 2012
254 nmdc:mga0a205_131782_c1 3300050515 Bacteria 2400
255 Ga0495595_0070578 3300053084 Bacteria 1650
256 Ga0501084_0071740 3300054114 Bacteria 2900
257 Ga0068868_100098317
258 Ga0070683_100035978
259 Ga0070683_100095157
260 Ga0070683_100135069
261 Ga0068869_100060009
262 Ga0068868_101031994
263 Ga0070661_100191418
264 Ga0070661_100760915
265 Ga0070675_100776576
266 Ga0070675_101980574
267 Ga0070659_100238511
268 Ga0070709_10094177
269 Ga0070709_10128903
270 Ga0070709_10137929
271 Ga0070714_100235147
272 Ga0070714_100392388
273 Ga0070714_100765819
274 Ga0070713_100043151
275 Ga0070713_100056853
276 Ga0070713_100076163
277 Ga0070713_100097184
278 Ga0070711_100142694
279 Ga0070711_100485657
280 Ga0070705_100094701
281 Ga0070705_100394722
282 Ga0070700_100243749
283 Ga0070708_101349399
284 Ga0070662_100487505
285 Ga0068867_100498063
286 Ga0070706_100292644
287 Ga0070706_101227116
288 Ga0070707_100023400
289 Ga0070707_100234119
290 Ga0070707_100784534
291 Ga0070698_100024916
292 Ga0070699_100062423
293 Ga0070699_100572936
294 Ga0070699_100667004
295 Ga0070684_100010746
296 Ga0070684_100152446
297 Ga0070697_100339019
298 Ga0068853_100177501
299 Ga0070704_100038219
300 Ga0070704_100082760
301 Ga0070704_100244374
302 Ga0070704_100452752
303 Ga0068855_100032956
304 Ga0070664_100322701
305 Ga0068857_100052895
306 Ga0068857_100447282
307 Ga0068856_101418202
308 Ga0070702_100012275
309 Ga0068862_100607720
310 Ga0081455_10021055
311 Ga0081455_10248965
312 Ga0070717_10042948
313 Ga0070717_10075393
314 Ga0070717_10153057
315 Ga0070716_100019204
316 Ga0070712_100061841
317 Ga0070712_101238011
318 Ga0075431_100678165
319 Ga0075433_10150050
320 Ga0075433_11414528
321 Ga0075434_100100163
322 Ga0075436_100099424
323 Ga0075435_100068872
324 Ga0075435_100097623
325 Ga0075435_100471585
326 Ga0111539_10871351
327 Ga0105245_10023440
328 Ga0105245_10230462
329 Ga0105245_11620058
330 Ga0105243_10497649
331 Ga0105243_10625464
332 Ga0105242_10097872
333 Ga0105237_10836638
334 Ga0105237_11123876
335 Ga0105239_10107250
336 Ga0105239_12113756
337 Ga0163162_10135378
338 Ga0157375_10309001
339 Ga0157375_11635584
340 Ga0163163_10118937
341 Ga0157380_10258264
342 Ga0197907_10330737
343 Ga0207688_10020708
344 Ga0207688_10102305
345 Ga0207699_10025612
346 Ga0207699_10176972
347 Ga0207684_10509912
348 Ga0207693_10050265
349 Ga0207693_10192859
350 Ga0207693_10339843
351 Ga0207663_10050469
352 Ga0207663_10376130
353 Ga0207649_10381148
354 Ga0207646_10556789
355 Ga0207659_10788080
356 Ga0207687_10011470
357 Ga0207687_11173302
358 Ga0207700_10000001
359 Ga0207700_10365205
360 Ga0207700_10684077
361 Ga0207664_10049414
362 Ga0207664_10269669
363 Ga0207664_10320082
364 Ga0207664_11490193
365 Ga0207644_10241726
366 Ga0207690_10228063
367 Ga0207706_10313386
368 Ga0207686_10212143
369 Ga0207709_10029386
370 Ga0207709_10135843
371 Ga0207665_10030176
372 Ga0207665_10064208
373 Ga0207665_10067890
374 Ga0207689_10097722
375 Ga0207661_10018244
376 Ga0207661_10019125
377 Ga0207679_10210264
378 Ga0207712_10044115
379 Ga0207668_10165478
380 Ga0207640_10221847
381 Ga0207640_10332265
382 Ga0207648_10300788
383 Ga0207674_10008326
384 Ga0207674_10281508
385 Ga0207675_100017381
386 Ga0207675_100208652
387 Ga0268265_10213031
388 Ga0265319_1062545
389 Ga0265322_10043078
390 Ga0265316_10090925
391 Ga0307408_100990897
392 Ga0307411_10333666
393 Ga0316583_10080909
394 Ga0373931_1181294
395 Ga0395899_0006793
396 Ga0395899_0022566
397 Ga0395899_0354746
398 Ga0395900_0023217
399 Ga0395900_0028418
400 Ga0395900_0064945
401 Ga0395900_0094601
402 Ga0395900_0416075
403 Ga0395900_0754267
404 Ga0395898_0010359
405 Ga0395898_0026311
406 Ga0395898_0079935
407 Ga0395898_0741070
408 Ga0395905_0158840
409 Ga0395905_0226825
410 Ga0395905_0317680
411 Ga0395901_0007398
412 Ga0395901_0035594
413 Ga0395901_0136461
414 Ga0395901_0140844
415 Ga0436360_0634747
416 Ga0451793_0647640
417 Ga0451800_0931018
418 Ga0451802_2097481
419 Ga0451806_055893
420 Ga0451804_1030547
421 Ga0451841_0677501
422 Ga0451853_0062829
423 Ga0466972_0456732
424 Ga0466961_0564473
425 Ga0466963_0010963
426 Ga0466964_0327789
427 Ga0466960_0065598
428 Ga0466960_0252144
429 Ga0466958_0018889
430 Ga0466967_0032749
431 Ga0466967_0060058
432 Ga0466967_0319981
433 Ga0466967_0379383
434 Ga0466967_0423141
435 Ga0466967_2047497
436 Ga0495590_0055454
437 Ga0495584_0020255
438 Ga0495585_0287207
439 Ga0495596_0101423
440 Ga0495607_0231767
441 Ga0495616_0039167
442 Ga0495628_0220232
443 Ga0495631_0039893
444 Ga0495631_0124288
445 Ga0495644_0045205
446 Ga0495644_0076063
447 Ga0495663_0016532
448 Ga0495642_0044806
449 Ga0495598_0041959
450 Ga0495656_0492276
451 Ga0495668_0046654
452 Ga0495659_0232876
453 Ga0495671_0028069
454 Ga0495589_0200128
455 Ga0495660_0092519
456 Ga0495636_0105196
457 Ga0495674_0266723
458 Ga0495683_0076028
459 Ga0495677_0032628
460 Ga0495602_0325683
461 Ga0495626_0048673
462 Ga0496100_0602315
463 Ga0496101_0341502
464 Ga0496101_1438050
465 Ga0496102_0255141
466 Ga0496102_0425460
467 Ga0496103_0389100
468 Ga0496104_0191210
469 Ga0496105_0171787
470 Ga0496106_0191934
471 Ga0496108_0074780
472 Ga0496108_0113003
473 Ga0496108_0706795
474 Ga0496109_0054245
475 Ga0496109_0081466
476 Ga0496109_0108092
477 Ga0496110_0045256
478 Ga0496110_0164171
479 Ga0496110_0184962
480 Ga0496110_0393406
481 Ga0496111_0058762
482 Ga0496111_0116434
483 Ga0496111_0155635
484 Ga0496112_0139479
485 Ga0496113_0051861
486 Ga0496113_1482369
487 Ga0501032_0534238
488 Ga0501040_1052263
489 Ga0501042_0073938
490 Ga0501048_0346437
491 Ga0501071_0765849
492 Ga0501072_0640905
493 Ga0501074_0481389
494 Ga0501074_1201115
495 Ga0501076_1594725
496 Ga0501081_0205830
497 Ga0501081_1016740
498 Ga0501035_1284204
499 Ga0501045_0665401
500 nmdc:mga0yw44_792575_c1
501 nmdc:mga05p37_544181_c1
502 nmdc:mga0qj67_108511_c1
503 nmdc:mga06r32_345904_c1
504 nmdc:mga08y16_370757_c1
505 nmdc:mga0n895_125445_c1
506 nmdc:mga0n895_244645_c1
507 nmdc:mga0n895_568738_c1
508 nmdc:mga0rr50_18347_c1
509 nmdc:mga08x19_91153_c1
510 nmdc:mga0a205_131782_c1
511 Ga0495595_0070578
512 Ga0501084_0071740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

32

167

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9199 1 145
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9133 1 145
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.8687 4 141
3bh7-assembly1.cif.gz_A crystal structure of the rp2-arl3 complex bound to gdp-alf4 0.865 70 91
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.8646 3 138
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.924 5 141 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9101 5 141 3.90.79.10
af_Q9TZE3_159_337_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8945 71 89 3.40.50.300
af_Q55G92_32_335_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8808 70 87 3.40.50.300
af_Q54U83_212_345_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8747 5 140 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A538J6U8-F1-model_v4 NUDIX domain-containing protein 0.9929 1 144 GO:0016787
AF-A0A6I3BPS9-F1-model_v4 NUDIX domain-containing protein 0.9859 1 143 GO:0016787
AF-A0A538M1J0-F1-model_v4 NUDIX domain-containing protein 0.9747 1 144 GO:0016787
AF-A0A538M1J0-F1-model_v4 NUDIX domain-containing protein 0.9681 1 144 GO:0016787
AF-A0A7W1BQD9-F1-model_v4 NUDIX domain-containing protein 0.967 15 145 GO:0004081
GO:0006167
GO:0006754

Map