F366178

General Info

Members Datasets Scaffolds Average Seq Length
256 158 254 404

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10016506|Ga0065712_100165062
Length 443
Sequence MRQSPVHVLTSYICDFGRCRGEFVQRIFWFTLLRSLTESAELTVKMAKKRIVLGVTGGIAAYKSAEFVRLLVKDGIGVQVVMTQAACGFITPATMQALSGKPVFTDMWDPRVADSMAHIELSRGADAIVVAPATADFLAKLATGFADDLLSTLCVARDCPLIVAPAMNRQMWDNKATQRNIAQLKRDGVAILGPASGDQACGEVGMGRMLEAQQLFDDVRALLGPKALTGKRVVITAGPTFEAIDPVRGITNRSSGKMGYALAQAALDANADVTLISGPVTLDPPAGARLERVESAEQMFDAVKKHIKTDIFIAVAAVADYRVEKAQTQKIKRTDANLTLQLVPNPDILAWVAALPDAPFCVGFAAESQNLQEFADVKRRKKKVPLMVANLAQSAIGADDNEITLLDDSGTRTLPRASKASLARELIDHIAKLYAQRGINEKK

Samples

Sample ID Description Type Environment
1 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 1.95
Rhizosphere 92.19
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10005014 3300003316 Bacteria 7169
2 Ga0055535_1000107 3300003761 Bacteria 89840
3 Ga0055529_1000111 3300003763 Bacteria 118734
4 Ga0065712_10016506 3300005290 Bacteria 1727
5 Ga0070670_100007656 3300005331 Bacteria 9178
6 Ga0070670_100023848 3300005331 Bacteria 5264
7 Ga0070666_10106649 3300005335 Bacteria 1935
8 Ga0070680_100173042 3300005336 Bacteria 1817
9 Ga0068868_100004436 3300005338 Bacteria 9841
10 Ga0068868_100019803 3300005338 Bacteria 5048
11 Ga0070660_100123512 3300005339 Bacteria 2067
12 Ga0070689_100112043 3300005340 Bacteria 2171
13 Ga0070661_100032915 3300005344 Bacteria 3754
14 Ga0070661_100037316 3300005344 Bacteria 3534
15 Ga0070661_100098759 3300005344 Bacteria 2169
16 Ga0070668_100000411 3300005347 Bacteria 28460
17 Ga0070668_100257719 3300005347 Bacteria 1450
18 Ga0070669_100007708 3300005353 Bacteria 7696
19 Ga0070675_100015141 3300005354 Bacteria 6090
20 Ga0070675_100021029 3300005354 Bacteria 5210
21 Ga0070675_100085181 3300005354 Bacteria 2640
22 Ga0070675_100316079 3300005354 Bacteria 1379
23 Ga0070671_100075497 3300005355 Bacteria 2816
24 Ga0070671_100120182 3300005355 Bacteria 2210
25 Ga0070674_100008421 3300005356 Bacteria 6142
26 Ga0070674_100067029 3300005356 Bacteria 2524
27 Ga0070674_100197631 3300005356 Bacteria 1551
28 Ga0070673_100008853 3300005364 Bacteria 6723
29 Ga0070673_100045634 3300005364 Bacteria 3399
30 Ga0070659_100012804 3300005366 Bacteria 6228
31 Ga0070659_100036105 3300005366 Bacteria 3851
32 Ga0070667_100000463 3300005367 Bacteria 41711
33 Ga0070667_100199330 3300005367 Bacteria 1776
34 Ga0070708_100000191 3300005445 Bacteria 44404
35 Ga0070663_100039064 3300005455 Bacteria 3315
36 Ga0070678_100019701 3300005456 Bacteria 4407
37 Ga0070678_100041146 3300005456 Bacteria 3274
38 Ga0070678_100191594 3300005456 Bacteria 1681
39 Ga0070662_100028743 3300005457 Bacteria 3872
40 Ga0070662_100119803 3300005457 Bacteria 2016
41 Ga0070681_10004183 3300005458 Bacteria 13665
42 Ga0068867_100000932 3300005459 Bacteria 19916
43 Ga0070679_100059381 3300005530 Bacteria 3812
44 Ga0070679_100093201 3300005530 Bacteria 2999
45 Ga0070684_100039305 3300005535 Bacteria 4068
46 Ga0068853_100050087 3300005539 Bacteria 3592
47 Ga0070672_100021020 3300005543 Bacteria 4771
48 Ga0070672_100027912 3300005543 Bacteria 4216
49 Ga0070672_100051737 3300005543 Bacteria 3205
50 Ga0070672_100054395 3300005543 Bacteria 3133
51 Ga0070665_100003327 3300005548 Bacteria 17218
52 Ga0070665_100069559 3300005548 Bacteria 3528
53 Ga0068855_100005475 3300005563 Bacteria 15492
54 Ga0068855_100056082 3300005563 Bacteria 4624
55 Ga0070664_100012293 3300005564 Bacteria 6956
56 Ga0070664_100026075 3300005564 Bacteria 4846
57 Ga0070664_100046799 3300005564 Bacteria 3655
58 Ga0070664_100147499 3300005564 Bacteria 2075
59 Ga0068857_100025924 3300005577 Bacteria 5164
60 Ga0068856_100167400 3300005614 Bacteria 2209
61 Ga0068852_100002785 3300005616 Bacteria 12109
62 Ga0068852_100070944 3300005616 Bacteria 3058
63 Ga0068852_100090668 3300005616 Bacteria 2734
64 Ga0068864_100000470 3300005618 Bacteria 34909
65 Ga0068864_100055665 3300005618 Bacteria 3416
66 Ga0068861_100200870 3300005719 Bacteria 1673
67 Ga0068851_10041346 3300005834 Bacteria 2317
68 Ga0068870_10107170 3300005840 Bacteria 1589
69 Ga0068863_100003312 3300005841 Bacteria 15900
70 Ga0068863_100005782 3300005841 Bacteria 12121
71 Ga0068863_100018683 3300005841 Bacteria 6633
72 Ga0068863_100246097 3300005841 Bacteria 1726
73 Ga0068858_100009778 3300005842 Bacteria 9130
74 Ga0068858_100043072 3300005842 Bacteria 4186
75 Ga0068858_100107627 3300005842 Bacteria 2603
76 Ga0068860_100263255 3300005843 Bacteria 1681
77 Ga0068862_100022654 3300005844 Bacteria 5256
78 Ga0075366_10001921 3300006195 Bacteria 10509
79 Ga0097621_100012889 3300006237 Bacteria 6213
80 Ga0097621_100116745 3300006237 Bacteria 2260
81 Ga0075370_10005490 3300006353 Bacteria 6312
82 Ga0068871_100008710 3300006358 Bacteria 7297
83 Ga0068865_100199356 3300006881 Bacteria 1553
84 Ga0105240_10104955 3300009093 Bacteria 3431
85 Ga0105240_10253378 3300009093 Bacteria 2034
86 Ga0105245_10015255 3300009098 Bacteria 6694
87 Ga0105245_10113076 3300009098 Bacteria 2528
88 Ga0105243_10271573 3300009148 Bacteria 1523
89 Ga0105242_10056763 3300009176 Bacteria 3204
90 Ga0105248_10014263 3300009177 Bacteria 8748
91 Ga0105238_10023869 3300009551 Bacteria 6233
92 Ga0157373_10032290 3300013100 Bacteria 3768
93 Ga0157371_10148763 3300013102 Bacteria 1670
94 Ga0157370_10005790 3300013104 Bacteria 13810
95 Ga0157370_10042641 3300013104 Bacteria 4371
96 Ga0157370_10144027 3300013104 Bacteria 2220
97 Ga0157369_10032539 3300013105 Bacteria 5734
98 Ga0157369_10159388 3300013105 Bacteria 2382
99 Ga0157378_10004527 3300013297 Bacteria 12196
100 Ga0157378_10041642 3300013297 Bacteria 4075
101 Ga0157378_10145370 3300013297 Bacteria 2205
102 Ga0163162_10053419 3300013306 Bacteria 4061
103 Ga0163162_10061801 3300013306 Bacteria 3784
104 Ga0157372_10040065 3300013307 Bacteria 5173
105 Ga0157372_10227419 3300013307 Bacteria 2162
106 Ga0157375_10028957 3300013308 Bacteria 5202
107 Ga0163163_10030695 3300014325 Bacteria 5181
108 Ga0163163_10057199 3300014325 Bacteria 3855
109 Ga0157380_10040621 3300014326 Bacteria 3625
110 Ga0157379_10092575 3300014968 Bacteria 2712
111 Ga0157376_10002171 3300014969 Bacteria 13216
112 Ga0163161_10028980 3300017792 Bacteria 3934
113 Ga0163161_10224656 3300017792 Bacteria 1455
114 Ga0213872_10001253 3300021361 Bacteria 17099
115 Ga0213872_10001765 3300021361 Bacteria 13544
116 Ga0213872_10003865 3300021361 Bacteria 8137
117 Ga0213872_10041283 3300021361 Bacteria 2105
118 Ga0209258_100267 3300025242 Bacteria 89896
119 Ga0209455_1000158 3300025272 Bacteria 118973
120 Ga0207697_10017070 3300025315 Bacteria 2985
121 Ga0207697_10037077 3300025315 Bacteria 1997
122 Ga0207682_10016966 3300025893 Bacteria 2843
123 Ga0207682_10032270 3300025893 Bacteria 2105
124 Ga0207680_10003848 3300025903 Bacteria 7066
125 Ga0207645_10043368 3300025907 Bacteria 2879
126 Ga0207643_10108653 3300025908 Bacteria 1632
127 Ga0207643_10116445 3300025908 Bacteria 1579
128 Ga0207707_10009777 3300025912 Bacteria 8319
129 Ga0207707_10043047 3300025912 Bacteria 3940
130 Ga0207695_10067703 3300025913 Bacteria 3661
131 Ga0207660_10141409 3300025917 Bacteria 1840
132 Ga0207662_10002504 3300025918 Bacteria 9235
133 Ga0207649_10070173 3300025920 Bacteria 2234
134 Ga0207649_10138757 3300025920 Bacteria 1661
135 Ga0207649_10203047 3300025920 Bacteria 1401
136 Ga0207652_10070784 3300025921 Bacteria 3029
137 Ga0207681_10014662 3300025923 Bacteria 4878
138 Ga0207694_10216300 3300025924 Bacteria 1562
139 Ga0207650_10001554 3300025925 Bacteria 16450
140 Ga0207650_10040024 3300025925 Bacteria 3428
141 Ga0207659_10005249 3300025926 Bacteria 7843
142 Ga0207659_10269280 3300025926 Bacteria 1389
143 Ga0207700_10122493 3300025928 Bacteria 2111
144 Ga0207644_10014320 3300025931 Bacteria 5305
145 Ga0207644_10022737 3300025931 Bacteria 4286
146 Ga0207690_10017546 3300025932 Bacteria 4373
147 Ga0207706_10000040 3300025933 Bacteria 132285
148 Ga0207706_10055564 3300025933 Bacteria 3491
149 Ga0207706_10262486 3300025933 Bacteria 1508
150 Ga0207670_10090018 3300025936 Bacteria 2167
151 Ga0207669_10012607 3300025937 Bacteria 4163
152 Ga0207691_10001663 3300025940 Bacteria 21997
153 Ga0207691_10061252 3300025940 Bacteria 3418
154 Ga0207691_10148300 3300025940 Bacteria 2064
155 Ga0207711_10111266 3300025941 Bacteria 2436
156 Ga0207689_10046178 3300025942 Bacteria 3600
157 Ga0207661_10010949 3300025944 Bacteria 6549
158 Ga0207679_10000906 3300025945 Bacteria 18937
159 Ga0207679_10001222 3300025945 Bacteria 16342
160 Ga0207679_10176017 3300025945 Bacteria 1766
161 Ga0207667_10001525 3300025949 Bacteria 29102
162 Ga0207667_10207849 3300025949 Bacteria 2007
163 Ga0207667_10394382 3300025949 Bacteria 1409
164 Ga0207651_10007162 3300025960 Bacteria 5927
165 Ga0207651_10010483 3300025960 Bacteria 5139
166 Ga0207668_10002933 3300025972 Bacteria 10010
167 Ga0207668_10025697 3300025972 Bacteria 3814
168 Ga0207658_10066367 3300025986 Bacteria 2714
169 Ga0207677_10024780 3300026023 Bacteria 3733
170 Ga0207703_10116630 3300026035 Bacteria 2286
171 Ga0207639_10086100 3300026041 Bacteria 2501
172 Ga0207678_10090851 3300026067 Bacteria 2610
173 Ga0207708_10089765 3300026075 Bacteria 2369
174 Ga0207641_10001090 3300026088 Bacteria 27309
175 Ga0207641_10011755 3300026088 Bacteria 7190
176 Ga0207641_10024278 3300026088 Bacteria 4997
177 Ga0207648_10000512 3300026089 Bacteria 43350
178 Ga0207648_10077036 3300026089 Bacteria 2907
179 Ga0207676_10002120 3300026095 Bacteria 14370
180 Ga0207676_10002385 3300026095 Bacteria 13410
181 Ga0207676_10026026 3300026095 Bacteria 4346
182 Ga0207676_10040743 3300026095 Bacteria 3561
183 Ga0207674_10003155 3300026116 Bacteria 20315
184 Ga0207674_10081670 3300026116 Bacteria 3234
185 Ga0207675_100034206 3300026118 Bacteria 4737
186 Ga0207675_100328003 3300026118 Bacteria 1495
187 Ga0207683_10000019 3300026121 Bacteria 119524
188 Ga0207683_10003565 3300026121 Bacteria 13573
189 Ga0207683_10008343 3300026121 Bacteria 8861
190 Ga0207683_10011473 3300026121 Bacteria 7562
191 Ga0207683_10092515 3300026121 Bacteria 2694
192 Ga0207698_10010035 3300026142 Bacteria 6064
193 Ga0268266_10003010 3300028379 Bacteria 17318
194 Ga0268265_10027736 3300028380 Bacteria 4046
195 Ga0268265_10114711 3300028380 Bacteria 2207
196 Ga0268264_10054722 3300028381 Bacteria 3333
197 Ga0268264_10208759 3300028381 Bacteria 1791
198 Ga0307515_10000093 3300028794 Bacteria 212053
199 Ga0307515_10073756 3300028794 Bacteria 4579
200 Ga0307515_10242476 3300028794 Bacteria 1570
201 Ga0265338_10001217 3300028800 Bacteria 42536
202 Ga0265338_10178599 3300028800 Bacteria 1621
203 Ga0265330_10019142 3300031235 Bacteria 3140
204 Ga0265332_10004178 3300031238 Bacteria 6848
205 Ga0265328_10000007 3300031239 Bacteria 224310
206 Ga0265328_10004697 3300031239 Bacteria 5903
207 Ga0265340_10026905 3300031247 Bacteria 2904
208 Ga0265331_10001179 3300031250 Bacteria 19910
209 Ga0265331_10019065 3300031250 Bacteria 3546
210 Ga0265316_10139178 3300031344 Bacteria 1824
211 Ga0265314_10000660 3300031711 Bacteria 42242
212 Ga0307516_10003211 3300031730 Bacteria 21220
213 Ga0307413_10074261 3300031824 Bacteria 2153
214 Ga0307410_10134771 3300031852 Bacteria 1819
215 Ga0400490_05991 3300038726 Bacteria 1568
216 Ga0436361_0183078 3300039447 Bacteria 10188
217 Ga0436361_0313546 3300039447 Bacteria 35556
218 Ga0436361_0500164 3300039447 Bacteria 28968
219 Ga0436361_0632282 3300039447 Bacteria 3698
220 Ga0436361_0833848 3300039447 Bacteria 20064
221 Ga0451577_0001784 3300042876 Bacteria 27608
222 Ga0451577_0003831 3300042876 Bacteria 16362
223 Ga0451577_0013756 3300042876 Bacteria 7562
224 Ga0451576_0017156 3300045051 Bacteria 7964
225 Ga0451576_0046314 3300045051 Bacteria 4580
226 Ga0495650_0004936 3300046471 Bacteria 8909
227 Ga0495642_0081163 3300046528 Bacteria 1366
228 Ga0495658_0014941 3300046683 Bacteria 3978
229 Ga0496106_0010685 3300048909 Bacteria 6785
230 Ga0496107_0022136 3300048910 Bacteria 4491
231 Ga0496108_0442435 3300048911 Bacteria 1135
232 Ga0496109_0112384 3300048912 Bacteria 2533
233 Ga0496114_0067401 3300048917 Bacteria 3003
234 Ga0495678_015836 3300049459 Bacteria 3461
235 Ga0501032_0016600 3300049569 Bacteria 5177
236 Ga0501033_0059064 3300049570 Bacteria 2832
237 Ga0501034_0032770 3300049571 Bacteria 5276
238 Ga0501034_0039708 3300049571 Bacteria 4767
239 Ga0501034_0189870 3300049571 Bacteria 2017
240 Ga0501038_0039263 3300049574 Bacteria 4141
241 Ga0501039_0040073 3300049575 Bacteria 3616
242 Ga0501043_0300608 3300049579 Bacteria 1226
243 Ga0501047_0074875 3300049581 Bacteria 3259
244 Ga0501067_0008233 3300049583 Bacteria 5789
245 Ga0501070_0010311 3300049586 Bacteria 7898
246 Ga0501072_0016231 3300049588 Bacteria 5712
247 Ga0501073_0034104 3300049589 Bacteria 3623
248 Ga0501074_0160179 3300049590 Bacteria 1607
249 Ga0501035_0010423 3300049822 Bacteria 8615
250 Ga0501035_0034278 3300049822 Bacteria 4614
251 Ga0501035_0215282 3300049822 Bacteria 1642
252 nmdc:mga0k408_2673_c1 3300050493 Bacteria 9451
253 nmdc:mga07m45_650_c1 3300050496 Bacteria 14760
254 Ga0590071_001980 3300059421 Bacteria 5239

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0081163 Ga0495642_0081163_17_1081 346
2 3300049579 Ga0501043_0300608 Ga0501043_0300608_18_1067 346
3 3300026067 Ga0207678_10090851 Ga0207678_100908511 358
4 3300048911 Ga0496108_0442435 Ga0496108_0442435_37_1125 359
5 3300025921 Ga0207652_10070784 Ga0207652_100707843 372
6 3300026116 Ga0207674_10081670 Ga0207674_100816704 372
7 3300005347 Ga0070668_100257719 Ga0070668_1002577192 375
8 3300005543 Ga0070672_100021020 Ga0070672_1000210202 375
9 3300005616 Ga0068852_100090668 Ga0068852_1000906682 375
10 3300013306 Ga0163162_10061801 Ga0163162_100618012 375
11 3300013308 Ga0157375_10028957 Ga0157375_100289573 375
12 3300025931 Ga0207644_10014320 Ga0207644_100143204 375
13 3300005336 Ga0070680_100173042 Ga0070680_1001730421 376
14 3300005344 Ga0070661_100037316 Ga0070661_1000373162 376
15 3300005530 Ga0070679_100059381 Ga0070679_1000593812 376
16 3300013100 Ga0157373_10032290 Ga0157373_100322901 376
17 3300013104 Ga0157370_10042641 Ga0157370_100426411 376
18 3300013307 Ga0157372_10040065 Ga0157372_100400652 376
19 3300025912 Ga0207707_10043047 Ga0207707_100430472 376
20 3300025917 Ga0207660_10141409 Ga0207660_101414092 376
21 3300013297 Ga0157378_10041642 Ga0157378_100416423 380
22 3300009093 Ga0105240_10253378 Ga0105240_102533782 383
23 3300026121 Ga0207683_10000019 Ga0207683_100000192 383
24 3300013105 Ga0157369_10032539 Ga0157369_100325395 387
25 3300028380 Ga0268265_10027736 Ga0268265_100277363 388
26 3300005335 Ga0070666_10106649 Ga0070666_101066492 389
27 3300005338 Ga0068868_100019803 Ga0068868_1000198034 389
28 3300005340 Ga0070689_100112043 Ga0070689_1001120431 389
29 3300005347 Ga0070668_100000411 Ga0070668_10000041118 389
30 3300005353 Ga0070669_100007708 Ga0070669_1000077086 389
31 3300005354 Ga0070675_100021029 Ga0070675_1000210292 389
32 3300005356 Ga0070674_100008421 Ga0070674_1000084216 389
33 3300005364 Ga0070673_100008853 Ga0070673_1000088536 389
34 3300005367 Ga0070667_100000463 Ga0070667_10000046323 389
35 3300005456 Ga0070678_100041146 Ga0070678_1000411463 389
36 3300005459 Ga0068867_100000932 Ga0068867_1000009326 389
37 3300005548 Ga0070665_100003327 Ga0070665_1000033272 389
38 3300005618 Ga0068864_100055665 Ga0068864_1000556654 389
39 3300005840 Ga0068870_10107170 Ga0068870_101071701 389
40 3300005841 Ga0068863_100003312 Ga0068863_10000331212 389
41 3300005842 Ga0068858_100009778 Ga0068858_1000097785 389
42 3300006237 Ga0097621_100012889 Ga0097621_1000128896 389
43 3300006358 Ga0068871_100008710 Ga0068871_1000087106 389
44 3300009177 Ga0105248_10014263 Ga0105248_100142632 389
45 3300013297 Ga0157378_10145370 Ga0157378_101453701 389
46 3300013306 Ga0163162_10053419 Ga0163162_100534193 389
47 3300014968 Ga0157379_10092575 Ga0157379_100925754 389
48 3300014969 Ga0157376_10002171 Ga0157376_100021715 389
49 3300025315 Ga0207697_10017070 Ga0207697_100170702 389
50 3300025903 Ga0207680_10003848 Ga0207680_100038485 389
51 3300025908 Ga0207643_10108653 Ga0207643_101086532 389
52 3300025923 Ga0207681_10014662 Ga0207681_100146625 389
53 3300025925 Ga0207650_10040024 Ga0207650_100400242 389
54 3300025926 Ga0207659_10005249 Ga0207659_100052497 389
55 3300025931 Ga0207644_10022737 Ga0207644_100227373 389
56 3300025936 Ga0207670_10090018 Ga0207670_100900182 389
57 3300025937 Ga0207669_10012607 Ga0207669_100126073 389
58 3300025940 Ga0207691_10001663 Ga0207691_100016636 389
59 3300025941 Ga0207711_10111266 Ga0207711_101112662 389
60 3300025960 Ga0207651_10007162 Ga0207651_100071622 389
61 3300025972 Ga0207668_10002933 Ga0207668_100029335 389
62 3300026023 Ga0207677_10024780 Ga0207677_100247805 389
63 3300026088 Ga0207641_10001090 Ga0207641_1000109018 389
64 3300026089 Ga0207648_10000512 Ga0207648_1000051224 389
65 3300026095 Ga0207676_10040743 Ga0207676_100407434 389
66 3300026121 Ga0207683_10003565 Ga0207683_100035655 389
67 3300028379 Ga0268266_10003010 Ga0268266_100030109 389
68 3300031250 Ga0265331_10019065 Ga0265331_100190652 389
69 3300038726 Ga0400490_05991 Ga0400490_05991_283_1458 389
70 3300039447 Ga0436361_0183078 Ga0436361_0183078_682_1854 389
71 iso_pu_bacteria 8048746797 8048748393 389
72 3300009098 Ga0105245_10113076 Ga0105245_101130764 390
73 3300009148 Ga0105243_10271573 Ga0105243_102715732 390
74 3300009176 Ga0105242_10056763 Ga0105242_100567632 390
75 3300042876 Ga0451577_0001784 Ga0451577_0001784_22588_23790 390
76 iso_pu_bacteria 2998344455 2998346414 390
77 3300005355 Ga0070671_100120182 Ga0070671_1001201823 391
78 3300013104 Ga0157370_10144027 Ga0157370_101440274 391
79 3300017792 Ga0163161_10028980 Ga0163161_100289804 391
80 3300025933 Ga0207706_10055564 Ga0207706_100555642 391
81 3300026035 Ga0207703_10116630 Ga0207703_101166304 391
82 3300026089 Ga0207648_10077036 Ga0207648_100770363 391
83 3300028381 Ga0268264_10208759 Ga0268264_102087591 391
84 3300028794 Ga0307515_10242476 Ga0307515_102424761 391
85 3300031239 Ga0265328_10000007 Ga0265328_1000000764 391
86 3300005445 Ga0070708_100000191 Ga0070708_1000001916 392
87 3300005564 Ga0070664_100046799 Ga0070664_1000467995 392
88 3300006195 Ga0075366_10001921 Ga0075366_100019216 392
89 3300006353 Ga0075370_10005490 Ga0075370_100054902 392
90 3300021361 Ga0213872_10041283 Ga0213872_100412832 392
91 3300025945 Ga0207679_10001222 Ga0207679_100012229 392
92 3300025986 Ga0207658_10066367 Ga0207658_100663672 392
93 3300031730 Ga0307516_10003211 Ga0307516_1000321110 392
94 3300031824 Ga0307413_10074261 Ga0307413_100742612 392
95 3300039447 Ga0436361_0833848 Ga0436361_0833848_11251_12429 392
96 3300042876 Ga0451577_0013756 Ga0451577_0013756_1602_2804 392
97 3300045051 Ga0451576_0017156 Ga0451576_0017156_4289_5491 392
98 3300050493 nmdc:mga0k408_2673_c1 nmdc:mga0k408_2673_c1_5264_6499 392
99 3300050496 nmdc:mga07m45_650_c1 nmdc:mga07m45_650_c1_5461_6696 392
100 3300059421 Ga0590071_001980 Ga0590071_001980_3156_4376 392
101 3300003761 Ga0055535_1000107 Ga0055535_100010745 393
102 3300003763 Ga0055529_1000111 Ga0055529_100011132 393
103 3300005841 Ga0068863_100018683 Ga0068863_1000186833 393
104 3300025242 Ga0209258_100267 Ga0209258_10026745 393
105 3300025272 Ga0209455_1000158 Ga0209455_100015863 393
106 3300026088 Ga0207641_10024278 Ga0207641_100242785 393
107 3300028794 Ga0307515_10000093 Ga0307515_1000009352 393
108 3300049571 Ga0501034_0189870 Ga0501034_0189870_364_1572 393
109 3300049583 Ga0501067_0008233 Ga0501067_0008233_2278_3486 393
110 3300049586 Ga0501070_0010311 Ga0501070_0010311_6225_7433 393
111 3300049588 Ga0501072_0016231 Ga0501072_0016231_280_1488 393
112 3300049589 Ga0501073_0034104 Ga0501073_0034104_26_1234 393
113 3300049590 Ga0501074_0160179 Ga0501074_0160179_384_1592 393
114 3300049822 Ga0501035_0215282 Ga0501035_0215282_230_1438 393
115 3300005456 Ga0070678_100019701 Ga0070678_1000197016 394
116 3300005543 Ga0070672_100027912 Ga0070672_1000279122 394
117 3300005564 Ga0070664_100026075 Ga0070664_1000260755 394
118 3300005842 Ga0068858_100043072 Ga0068858_1000430722 394
119 3300005843 Ga0068860_100263255 Ga0068860_1002632552 394
120 3300005844 Ga0068862_100022654 Ga0068862_1000226543 394
121 3300006881 Ga0068865_100199356 Ga0068865_1001993561 394
122 3300013297 Ga0157378_10004527 Ga0157378_100045277 394
123 3300014326 Ga0157380_10040621 Ga0157380_100406213 394
124 3300025924 Ga0207694_10216300 Ga0207694_102163001 394
125 3300025940 Ga0207691_10148300 Ga0207691_101483002 394
126 3300025944 Ga0207661_10010949 Ga0207661_100109497 394
127 3300025945 Ga0207679_10000906 Ga0207679_1000090613 394
128 3300025949 Ga0207667_10394382 Ga0207667_103943821 394
129 3300026116 Ga0207674_10003155 Ga0207674_1000315524 394
130 3300026121 Ga0207683_10008343 Ga0207683_100083432 394
131 3300028381 Ga0268264_10054722 Ga0268264_100547223 394
132 3300048912 Ga0496109_0112384 Ga0496109_0112384_1252_2487 394
133 3300048917 Ga0496114_0067401 Ga0496114_0067401_1439_2674 394
134 3300005331 Ga0070670_100007656 Ga0070670_1000076567 395
135 3300005457 Ga0070662_100119803 Ga0070662_1001198031 395
136 3300005548 Ga0070665_100069559 Ga0070665_1000695592 395
137 3300005564 Ga0070664_100147499 Ga0070664_1001474992 395
138 3300005616 Ga0068852_100070944 Ga0068852_1000709442 395
139 3300005618 Ga0068864_100000470 Ga0068864_10000047017 395
140 3300005719 Ga0068861_100200870 Ga0068861_1002008702 395
141 3300005841 Ga0068863_100005782 Ga0068863_10000578212 395
142 3300009098 Ga0105245_10015255 Ga0105245_100152553 395
143 3300014325 Ga0163163_10057199 Ga0163163_100571993 395
144 3300025893 Ga0207682_10016966 Ga0207682_100169663 395
145 3300025918 Ga0207662_10002504 Ga0207662_100025047 395
146 3300025920 Ga0207649_10070173 Ga0207649_100701733 395
147 3300025925 Ga0207650_10001554 Ga0207650_1000155411 395
148 3300025928 Ga0207700_10122493 Ga0207700_101224931 395
149 3300025933 Ga0207706_10262486 Ga0207706_102624862 395
150 3300025942 Ga0207689_10046178 Ga0207689_100461785 395
151 3300025945 Ga0207679_10176017 Ga0207679_101760171 395
152 3300025972 Ga0207668_10025697 Ga0207668_100256972 395
153 3300026088 Ga0207641_10011755 Ga0207641_100117553 395
154 3300026095 Ga0207676_10002120 Ga0207676_100021203 395
155 3300026095 Ga0207676_10002385 Ga0207676_100023851 395
156 3300026118 Ga0207675_100034206 Ga0207675_1000342064 395
157 3300026121 Ga0207683_10092515 Ga0207683_100925153 395
158 3300028380 Ga0268265_10114711 Ga0268265_101147112 395
159 3300028800 Ga0265338_10178599 Ga0265338_101785991 395
160 3300031235 Ga0265330_10019142 Ga0265330_100191424 395
161 3300031238 Ga0265332_10004178 Ga0265332_100041787 395
162 3300031239 Ga0265328_10004697 Ga0265328_100046976 395
163 3300031250 Ga0265331_10001179 Ga0265331_100011792 395
164 3300031344 Ga0265316_10139178 Ga0265316_101391782 395
165 3300031711 Ga0265314_10000660 Ga0265314_1000066047 395
166 3300049459 Ga0495678_015836 Ga0495678_015836_709_1914 395
167 3300005290 Ga0065712_10016506 Ga0065712_100165062 396
168 3300005338 Ga0068868_100004436 Ga0068868_1000044365 396
169 3300005354 Ga0070675_100015141 Ga0070675_1000151417 396
170 3300005356 Ga0070674_100067029 Ga0070674_1000670292 396
171 3300005364 Ga0070673_100045634 Ga0070673_1000456342 396
172 3300005543 Ga0070672_100054395 Ga0070672_1000543954 396
173 3300005614 Ga0068856_100167400 Ga0068856_1001674002 396
174 3300005616 Ga0068852_100002785 Ga0068852_1000027854 396
175 3300005834 Ga0068851_10041346 Ga0068851_100413461 396
176 3300006237 Ga0097621_100116745 Ga0097621_1001167452 396
177 3300025960 Ga0207651_10010483 Ga0207651_100104835 396
178 3300026095 Ga0207676_10026026 Ga0207676_100260262 396
179 3300026142 Ga0207698_10010035 Ga0207698_100100353 396
180 3300028794 Ga0307515_10073756 Ga0307515_100737565 396
181 3300042876 Ga0451577_0003831 Ga0451577_0003831_6237_7463 396
182 3300046471 Ga0495650_0004936 Ga0495650_0004936_980_2212 396
183 3300046683 Ga0495658_0014941 Ga0495658_0014941_2038_3261 396
184 3300049569 Ga0501032_0016600 Ga0501032_0016600_3624_4829 396
185 3300049570 Ga0501033_0059064 Ga0501033_0059064_1580_2785 396
186 3300049571 Ga0501034_0032770 Ga0501034_0032770_3723_4928 396
187 3300049574 Ga0501038_0039263 Ga0501038_0039263_296_1501 396
188 3300049575 Ga0501039_0040073 Ga0501039_0040073_1353_2558 396
189 3300049822 Ga0501035_0010423 Ga0501035_0010423_5541_6746 396
190 3300049822 Ga0501035_0034278 Ga0501035_0034278_1603_2808 396
191 3300003316 rootH1_10005014 rootH1_100050145 397
192 3300005331 Ga0070670_100023848 Ga0070670_1000238482 397
193 3300005339 Ga0070660_100123512 Ga0070660_1001235122 397
194 3300005344 Ga0070661_100032915 Ga0070661_1000329151 397
195 3300005344 Ga0070661_100098759 Ga0070661_1000987592 397
196 3300005354 Ga0070675_100085181 Ga0070675_1000851812 397
197 3300005354 Ga0070675_100316079 Ga0070675_1003160791 397
198 3300005355 Ga0070671_100075497 Ga0070671_1000754973 397
199 3300005356 Ga0070674_100197631 Ga0070674_1001976311 397
200 3300005366 Ga0070659_100012804 Ga0070659_1000128043 397
201 3300005366 Ga0070659_100036105 Ga0070659_1000361052 397
202 3300005367 Ga0070667_100199330 Ga0070667_1001993302 397
203 3300005455 Ga0070663_100039064 Ga0070663_1000390644 397
204 3300005456 Ga0070678_100191594 Ga0070678_1001915942 397
205 3300005457 Ga0070662_100028743 Ga0070662_1000287434 397
206 3300005458 Ga0070681_10004183 Ga0070681_1000418314 397
207 3300005530 Ga0070679_100093201 Ga0070679_1000932013 397
208 3300005535 Ga0070684_100039305 Ga0070684_1000393052 397
209 3300005539 Ga0068853_100050087 Ga0068853_1000500871 397
210 3300005543 Ga0070672_100051737 Ga0070672_1000517372 397
211 3300005563 Ga0068855_100005475 Ga0068855_10000547511 397
212 3300005563 Ga0068855_100056082 Ga0068855_1000560825 397
213 3300005564 Ga0070664_100012293 Ga0070664_1000122936 397
214 3300005577 Ga0068857_100025924 Ga0068857_1000259244 397
215 3300005841 Ga0068863_100246097 Ga0068863_1002460972 397
216 3300005842 Ga0068858_100107627 Ga0068858_1001076272 397
217 3300009093 Ga0105240_10104955 Ga0105240_101049552 397
218 3300009551 Ga0105238_10023869 Ga0105238_100238695 397
219 3300013102 Ga0157371_10148763 Ga0157371_101487632 397
220 3300013104 Ga0157370_10005790 Ga0157370_1000579010 397
221 3300013105 Ga0157369_10159388 Ga0157369_101593883 397
222 3300013307 Ga0157372_10227419 Ga0157372_102274191 397
223 3300014325 Ga0163163_10030695 Ga0163163_100306952 397
224 3300017792 Ga0163161_10224656 Ga0163161_102246561 397
225 3300021361 Ga0213872_10001253 Ga0213872_1000125317 397
226 3300021361 Ga0213872_10001765 Ga0213872_100017652 397
227 3300021361 Ga0213872_10003865 Ga0213872_100038657 397
228 3300025315 Ga0207697_10037077 Ga0207697_100370772 397
229 3300025893 Ga0207682_10032270 Ga0207682_100322702 397
230 3300025907 Ga0207645_10043368 Ga0207645_100433682 397
231 3300025908 Ga0207643_10116445 Ga0207643_101164451 397
232 3300025912 Ga0207707_10009777 Ga0207707_100097778 397
233 3300025913 Ga0207695_10067703 Ga0207695_100677033 397
234 3300025920 Ga0207649_10138757 Ga0207649_101387572 397
235 3300025920 Ga0207649_10203047 Ga0207649_102030471 397
236 3300025926 Ga0207659_10269280 Ga0207659_102692801 397
237 3300025932 Ga0207690_10017546 Ga0207690_100175465 397
238 3300025933 Ga0207706_10000040 Ga0207706_10000040109 397
239 3300025940 Ga0207691_10061252 Ga0207691_100612522 397
240 3300025949 Ga0207667_10001525 Ga0207667_1000152510 397
241 3300025949 Ga0207667_10207849 Ga0207667_102078492 397
242 3300026041 Ga0207639_10086100 Ga0207639_100861002 397
243 3300026075 Ga0207708_10089765 Ga0207708_100897653 397
244 3300026118 Ga0207675_100328003 Ga0207675_1003280031 397
245 3300026121 Ga0207683_10011473 Ga0207683_100114734 397
246 3300028800 Ga0265338_10001217 Ga0265338_1000121722 397
247 3300031247 Ga0265340_10026905 Ga0265340_100269053 397
248 3300031852 Ga0307410_10134771 Ga0307410_101347712 397
249 3300039447 Ga0436361_0313546 Ga0436361_0313546_28715_29962 397
250 3300039447 Ga0436361_0500164 Ga0436361_0500164_1695_2942 397
251 3300039447 Ga0436361_0632282 Ga0436361_0632282_807_2054 397
252 3300045051 Ga0451576_0046314 Ga0451576_0046314_459_1709 397
253 3300048909 Ga0496106_0010685 Ga0496106_0010685_2545_3792 397
254 3300048910 Ga0496107_0022136 Ga0496107_0022136_232_1479 397
255 3300049571 Ga0501034_0039708 Ga0501034_0039708_2204_3412 397
256 3300049581 Ga0501047_0074875 Ga0501047_0074875_1988_3205 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04127

DFP

DNA / pantothenate metabolism flavoprotein

228

406

0.95

PF02441

Flavoprotein

Flavoprotein

49

223

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u7u-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.969 184 395
1u7w-assembly1.cif.gz_B phosphopantothenoylcysteine synthetase from e. coli, ctp-complex 0.967 184 397
1u7w-assembly1.cif.gz_A phosphopantothenoylcysteine synthetase from e. coli, ctp-complex 0.9609 184 395
1u7w-assembly2.cif.gz_C-2 phosphopantothenoylcysteine synthetase from e. coli, ctp-complex 0.9565 184 393
1u80-assembly1.cif.gz_B phosphopantothenoylcysteine synthetase from e. coli, cmp complex 0.9525 184 397
ID Description Score Start End Superfamily
af_Q2G268_1_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9827 5 180 3.40.50.1950
af_P0ABQ0_1_184_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9682 1 181 3.40.50.1950
1u7wB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CoaB-like 0.967 184 397 3.40.50.10300
af_Q2G268_186_399_3.40.50.10300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CoaB-like 0.9662 184 391 3.40.50.10300
af_P9WNZ1_7_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9625 4 178 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A2W5FXM7-F1-model_v4 deleted 0.9989 5 123
AF-A0A3C1MT56-F1-model_v4 Phosphopantothenate synthase 0.9955 317 397 GO:0003824
GO:0015937
AF-A0A7C3SGT7-F1-model_v4 Bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase (EC 4.1.1.36, EC 6.3.2.5) 0.9933 79 176 GO:0004632
GO:0004633
GO:0010181
GO:0015937
GO:0071513
AF-A0A4Q5PFZ4-F1-model_v4 Phosphopantothenate synthase 0.9931 5 174 GO:0004633
GO:0010181
GO:0015937
GO:0071513
AF-A0A2H9M9Q5-F1-model_v4 Phosphopantothenate synthase 0.9927 186 393 GO:0003824
GO:0015937

Feature Viewer

pLDDT pTM Quality
93.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map