F366178
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 158 | 254 | 404 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10016506|Ga0065712_100165062 |
| Length | 443 |
| Sequence | MRQSPVHVLTSYICDFGRCRGEFVQRIFWFTLLRSLTESAELTVKMAKKRIVLGVTGGIAAYKSAEFVRLLVKDGIGVQVVMTQAACGFITPATMQALSGKPVFTDMWDPRVADSMAHIELSRGADAIVVAPATADFLAKLATGFADDLLSTLCVARDCPLIVAPAMNRQMWDNKATQRNIAQLKRDGVAILGPASGDQACGEVGMGRMLEAQQLFDDVRALLGPKALTGKRVVITAGPTFEAIDPVRGITNRSSGKMGYALAQAALDANADVTLISGPVTLDPPAGARLERVESAEQMFDAVKKHIKTDIFIAVAAVADYRVEKAQTQKIKRTDANLTLQLVPNPDILAWVAALPDAPFCVGFAAESQNLQEFADVKRRKKKVPLMVANLAQSAIGADDNEITLLDDSGTRTLPRASKASLARELIDHIAKLYAQRGINEKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 70 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 157 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 158 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0 |
| Isolates | 0.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0 |
| Rhizoplane | 1.95 |
| Rhizosphere | 92.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10005014 | 3300003316 | Bacteria | 7169 |
| 2 | Ga0055535_1000107 | 3300003761 | Bacteria | 89840 |
| 3 | Ga0055529_1000111 | 3300003763 | Bacteria | 118734 |
| 4 | Ga0065712_10016506 | 3300005290 | Bacteria | 1727 |
| 5 | Ga0070670_100007656 | 3300005331 | Bacteria | 9178 |
| 6 | Ga0070670_100023848 | 3300005331 | Bacteria | 5264 |
| 7 | Ga0070666_10106649 | 3300005335 | Bacteria | 1935 |
| 8 | Ga0070680_100173042 | 3300005336 | Bacteria | 1817 |
| 9 | Ga0068868_100004436 | 3300005338 | Bacteria | 9841 |
| 10 | Ga0068868_100019803 | 3300005338 | Bacteria | 5048 |
| 11 | Ga0070660_100123512 | 3300005339 | Bacteria | 2067 |
| 12 | Ga0070689_100112043 | 3300005340 | Bacteria | 2171 |
| 13 | Ga0070661_100032915 | 3300005344 | Bacteria | 3754 |
| 14 | Ga0070661_100037316 | 3300005344 | Bacteria | 3534 |
| 15 | Ga0070661_100098759 | 3300005344 | Bacteria | 2169 |
| 16 | Ga0070668_100000411 | 3300005347 | Bacteria | 28460 |
| 17 | Ga0070668_100257719 | 3300005347 | Bacteria | 1450 |
| 18 | Ga0070669_100007708 | 3300005353 | Bacteria | 7696 |
| 19 | Ga0070675_100015141 | 3300005354 | Bacteria | 6090 |
| 20 | Ga0070675_100021029 | 3300005354 | Bacteria | 5210 |
| 21 | Ga0070675_100085181 | 3300005354 | Bacteria | 2640 |
| 22 | Ga0070675_100316079 | 3300005354 | Bacteria | 1379 |
| 23 | Ga0070671_100075497 | 3300005355 | Bacteria | 2816 |
| 24 | Ga0070671_100120182 | 3300005355 | Bacteria | 2210 |
| 25 | Ga0070674_100008421 | 3300005356 | Bacteria | 6142 |
| 26 | Ga0070674_100067029 | 3300005356 | Bacteria | 2524 |
| 27 | Ga0070674_100197631 | 3300005356 | Bacteria | 1551 |
| 28 | Ga0070673_100008853 | 3300005364 | Bacteria | 6723 |
| 29 | Ga0070673_100045634 | 3300005364 | Bacteria | 3399 |
| 30 | Ga0070659_100012804 | 3300005366 | Bacteria | 6228 |
| 31 | Ga0070659_100036105 | 3300005366 | Bacteria | 3851 |
| 32 | Ga0070667_100000463 | 3300005367 | Bacteria | 41711 |
| 33 | Ga0070667_100199330 | 3300005367 | Bacteria | 1776 |
| 34 | Ga0070708_100000191 | 3300005445 | Bacteria | 44404 |
| 35 | Ga0070663_100039064 | 3300005455 | Bacteria | 3315 |
| 36 | Ga0070678_100019701 | 3300005456 | Bacteria | 4407 |
| 37 | Ga0070678_100041146 | 3300005456 | Bacteria | 3274 |
| 38 | Ga0070678_100191594 | 3300005456 | Bacteria | 1681 |
| 39 | Ga0070662_100028743 | 3300005457 | Bacteria | 3872 |
| 40 | Ga0070662_100119803 | 3300005457 | Bacteria | 2016 |
| 41 | Ga0070681_10004183 | 3300005458 | Bacteria | 13665 |
| 42 | Ga0068867_100000932 | 3300005459 | Bacteria | 19916 |
| 43 | Ga0070679_100059381 | 3300005530 | Bacteria | 3812 |
| 44 | Ga0070679_100093201 | 3300005530 | Bacteria | 2999 |
| 45 | Ga0070684_100039305 | 3300005535 | Bacteria | 4068 |
| 46 | Ga0068853_100050087 | 3300005539 | Bacteria | 3592 |
| 47 | Ga0070672_100021020 | 3300005543 | Bacteria | 4771 |
| 48 | Ga0070672_100027912 | 3300005543 | Bacteria | 4216 |
| 49 | Ga0070672_100051737 | 3300005543 | Bacteria | 3205 |
| 50 | Ga0070672_100054395 | 3300005543 | Bacteria | 3133 |
| 51 | Ga0070665_100003327 | 3300005548 | Bacteria | 17218 |
| 52 | Ga0070665_100069559 | 3300005548 | Bacteria | 3528 |
| 53 | Ga0068855_100005475 | 3300005563 | Bacteria | 15492 |
| 54 | Ga0068855_100056082 | 3300005563 | Bacteria | 4624 |
| 55 | Ga0070664_100012293 | 3300005564 | Bacteria | 6956 |
| 56 | Ga0070664_100026075 | 3300005564 | Bacteria | 4846 |
| 57 | Ga0070664_100046799 | 3300005564 | Bacteria | 3655 |
| 58 | Ga0070664_100147499 | 3300005564 | Bacteria | 2075 |
| 59 | Ga0068857_100025924 | 3300005577 | Bacteria | 5164 |
| 60 | Ga0068856_100167400 | 3300005614 | Bacteria | 2209 |
| 61 | Ga0068852_100002785 | 3300005616 | Bacteria | 12109 |
| 62 | Ga0068852_100070944 | 3300005616 | Bacteria | 3058 |
| 63 | Ga0068852_100090668 | 3300005616 | Bacteria | 2734 |
| 64 | Ga0068864_100000470 | 3300005618 | Bacteria | 34909 |
| 65 | Ga0068864_100055665 | 3300005618 | Bacteria | 3416 |
| 66 | Ga0068861_100200870 | 3300005719 | Bacteria | 1673 |
| 67 | Ga0068851_10041346 | 3300005834 | Bacteria | 2317 |
| 68 | Ga0068870_10107170 | 3300005840 | Bacteria | 1589 |
| 69 | Ga0068863_100003312 | 3300005841 | Bacteria | 15900 |
| 70 | Ga0068863_100005782 | 3300005841 | Bacteria | 12121 |
| 71 | Ga0068863_100018683 | 3300005841 | Bacteria | 6633 |
| 72 | Ga0068863_100246097 | 3300005841 | Bacteria | 1726 |
| 73 | Ga0068858_100009778 | 3300005842 | Bacteria | 9130 |
| 74 | Ga0068858_100043072 | 3300005842 | Bacteria | 4186 |
| 75 | Ga0068858_100107627 | 3300005842 | Bacteria | 2603 |
| 76 | Ga0068860_100263255 | 3300005843 | Bacteria | 1681 |
| 77 | Ga0068862_100022654 | 3300005844 | Bacteria | 5256 |
| 78 | Ga0075366_10001921 | 3300006195 | Bacteria | 10509 |
| 79 | Ga0097621_100012889 | 3300006237 | Bacteria | 6213 |
| 80 | Ga0097621_100116745 | 3300006237 | Bacteria | 2260 |
| 81 | Ga0075370_10005490 | 3300006353 | Bacteria | 6312 |
| 82 | Ga0068871_100008710 | 3300006358 | Bacteria | 7297 |
| 83 | Ga0068865_100199356 | 3300006881 | Bacteria | 1553 |
| 84 | Ga0105240_10104955 | 3300009093 | Bacteria | 3431 |
| 85 | Ga0105240_10253378 | 3300009093 | Bacteria | 2034 |
| 86 | Ga0105245_10015255 | 3300009098 | Bacteria | 6694 |
| 87 | Ga0105245_10113076 | 3300009098 | Bacteria | 2528 |
| 88 | Ga0105243_10271573 | 3300009148 | Bacteria | 1523 |
| 89 | Ga0105242_10056763 | 3300009176 | Bacteria | 3204 |
| 90 | Ga0105248_10014263 | 3300009177 | Bacteria | 8748 |
| 91 | Ga0105238_10023869 | 3300009551 | Bacteria | 6233 |
| 92 | Ga0157373_10032290 | 3300013100 | Bacteria | 3768 |
| 93 | Ga0157371_10148763 | 3300013102 | Bacteria | 1670 |
| 94 | Ga0157370_10005790 | 3300013104 | Bacteria | 13810 |
| 95 | Ga0157370_10042641 | 3300013104 | Bacteria | 4371 |
| 96 | Ga0157370_10144027 | 3300013104 | Bacteria | 2220 |
| 97 | Ga0157369_10032539 | 3300013105 | Bacteria | 5734 |
| 98 | Ga0157369_10159388 | 3300013105 | Bacteria | 2382 |
| 99 | Ga0157378_10004527 | 3300013297 | Bacteria | 12196 |
| 100 | Ga0157378_10041642 | 3300013297 | Bacteria | 4075 |
| 101 | Ga0157378_10145370 | 3300013297 | Bacteria | 2205 |
| 102 | Ga0163162_10053419 | 3300013306 | Bacteria | 4061 |
| 103 | Ga0163162_10061801 | 3300013306 | Bacteria | 3784 |
| 104 | Ga0157372_10040065 | 3300013307 | Bacteria | 5173 |
| 105 | Ga0157372_10227419 | 3300013307 | Bacteria | 2162 |
| 106 | Ga0157375_10028957 | 3300013308 | Bacteria | 5202 |
| 107 | Ga0163163_10030695 | 3300014325 | Bacteria | 5181 |
| 108 | Ga0163163_10057199 | 3300014325 | Bacteria | 3855 |
| 109 | Ga0157380_10040621 | 3300014326 | Bacteria | 3625 |
| 110 | Ga0157379_10092575 | 3300014968 | Bacteria | 2712 |
| 111 | Ga0157376_10002171 | 3300014969 | Bacteria | 13216 |
| 112 | Ga0163161_10028980 | 3300017792 | Bacteria | 3934 |
| 113 | Ga0163161_10224656 | 3300017792 | Bacteria | 1455 |
| 114 | Ga0213872_10001253 | 3300021361 | Bacteria | 17099 |
| 115 | Ga0213872_10001765 | 3300021361 | Bacteria | 13544 |
| 116 | Ga0213872_10003865 | 3300021361 | Bacteria | 8137 |
| 117 | Ga0213872_10041283 | 3300021361 | Bacteria | 2105 |
| 118 | Ga0209258_100267 | 3300025242 | Bacteria | 89896 |
| 119 | Ga0209455_1000158 | 3300025272 | Bacteria | 118973 |
| 120 | Ga0207697_10017070 | 3300025315 | Bacteria | 2985 |
| 121 | Ga0207697_10037077 | 3300025315 | Bacteria | 1997 |
| 122 | Ga0207682_10016966 | 3300025893 | Bacteria | 2843 |
| 123 | Ga0207682_10032270 | 3300025893 | Bacteria | 2105 |
| 124 | Ga0207680_10003848 | 3300025903 | Bacteria | 7066 |
| 125 | Ga0207645_10043368 | 3300025907 | Bacteria | 2879 |
| 126 | Ga0207643_10108653 | 3300025908 | Bacteria | 1632 |
| 127 | Ga0207643_10116445 | 3300025908 | Bacteria | 1579 |
| 128 | Ga0207707_10009777 | 3300025912 | Bacteria | 8319 |
| 129 | Ga0207707_10043047 | 3300025912 | Bacteria | 3940 |
| 130 | Ga0207695_10067703 | 3300025913 | Bacteria | 3661 |
| 131 | Ga0207660_10141409 | 3300025917 | Bacteria | 1840 |
| 132 | Ga0207662_10002504 | 3300025918 | Bacteria | 9235 |
| 133 | Ga0207649_10070173 | 3300025920 | Bacteria | 2234 |
| 134 | Ga0207649_10138757 | 3300025920 | Bacteria | 1661 |
| 135 | Ga0207649_10203047 | 3300025920 | Bacteria | 1401 |
| 136 | Ga0207652_10070784 | 3300025921 | Bacteria | 3029 |
| 137 | Ga0207681_10014662 | 3300025923 | Bacteria | 4878 |
| 138 | Ga0207694_10216300 | 3300025924 | Bacteria | 1562 |
| 139 | Ga0207650_10001554 | 3300025925 | Bacteria | 16450 |
| 140 | Ga0207650_10040024 | 3300025925 | Bacteria | 3428 |
| 141 | Ga0207659_10005249 | 3300025926 | Bacteria | 7843 |
| 142 | Ga0207659_10269280 | 3300025926 | Bacteria | 1389 |
| 143 | Ga0207700_10122493 | 3300025928 | Bacteria | 2111 |
| 144 | Ga0207644_10014320 | 3300025931 | Bacteria | 5305 |
| 145 | Ga0207644_10022737 | 3300025931 | Bacteria | 4286 |
| 146 | Ga0207690_10017546 | 3300025932 | Bacteria | 4373 |
| 147 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 148 | Ga0207706_10055564 | 3300025933 | Bacteria | 3491 |
| 149 | Ga0207706_10262486 | 3300025933 | Bacteria | 1508 |
| 150 | Ga0207670_10090018 | 3300025936 | Bacteria | 2167 |
| 151 | Ga0207669_10012607 | 3300025937 | Bacteria | 4163 |
| 152 | Ga0207691_10001663 | 3300025940 | Bacteria | 21997 |
| 153 | Ga0207691_10061252 | 3300025940 | Bacteria | 3418 |
| 154 | Ga0207691_10148300 | 3300025940 | Bacteria | 2064 |
| 155 | Ga0207711_10111266 | 3300025941 | Bacteria | 2436 |
| 156 | Ga0207689_10046178 | 3300025942 | Bacteria | 3600 |
| 157 | Ga0207661_10010949 | 3300025944 | Bacteria | 6549 |
| 158 | Ga0207679_10000906 | 3300025945 | Bacteria | 18937 |
| 159 | Ga0207679_10001222 | 3300025945 | Bacteria | 16342 |
| 160 | Ga0207679_10176017 | 3300025945 | Bacteria | 1766 |
| 161 | Ga0207667_10001525 | 3300025949 | Bacteria | 29102 |
| 162 | Ga0207667_10207849 | 3300025949 | Bacteria | 2007 |
| 163 | Ga0207667_10394382 | 3300025949 | Bacteria | 1409 |
| 164 | Ga0207651_10007162 | 3300025960 | Bacteria | 5927 |
| 165 | Ga0207651_10010483 | 3300025960 | Bacteria | 5139 |
| 166 | Ga0207668_10002933 | 3300025972 | Bacteria | 10010 |
| 167 | Ga0207668_10025697 | 3300025972 | Bacteria | 3814 |
| 168 | Ga0207658_10066367 | 3300025986 | Bacteria | 2714 |
| 169 | Ga0207677_10024780 | 3300026023 | Bacteria | 3733 |
| 170 | Ga0207703_10116630 | 3300026035 | Bacteria | 2286 |
| 171 | Ga0207639_10086100 | 3300026041 | Bacteria | 2501 |
| 172 | Ga0207678_10090851 | 3300026067 | Bacteria | 2610 |
| 173 | Ga0207708_10089765 | 3300026075 | Bacteria | 2369 |
| 174 | Ga0207641_10001090 | 3300026088 | Bacteria | 27309 |
| 175 | Ga0207641_10011755 | 3300026088 | Bacteria | 7190 |
| 176 | Ga0207641_10024278 | 3300026088 | Bacteria | 4997 |
| 177 | Ga0207648_10000512 | 3300026089 | Bacteria | 43350 |
| 178 | Ga0207648_10077036 | 3300026089 | Bacteria | 2907 |
| 179 | Ga0207676_10002120 | 3300026095 | Bacteria | 14370 |
| 180 | Ga0207676_10002385 | 3300026095 | Bacteria | 13410 |
| 181 | Ga0207676_10026026 | 3300026095 | Bacteria | 4346 |
| 182 | Ga0207676_10040743 | 3300026095 | Bacteria | 3561 |
| 183 | Ga0207674_10003155 | 3300026116 | Bacteria | 20315 |
| 184 | Ga0207674_10081670 | 3300026116 | Bacteria | 3234 |
| 185 | Ga0207675_100034206 | 3300026118 | Bacteria | 4737 |
| 186 | Ga0207675_100328003 | 3300026118 | Bacteria | 1495 |
| 187 | Ga0207683_10000019 | 3300026121 | Bacteria | 119524 |
| 188 | Ga0207683_10003565 | 3300026121 | Bacteria | 13573 |
| 189 | Ga0207683_10008343 | 3300026121 | Bacteria | 8861 |
| 190 | Ga0207683_10011473 | 3300026121 | Bacteria | 7562 |
| 191 | Ga0207683_10092515 | 3300026121 | Bacteria | 2694 |
| 192 | Ga0207698_10010035 | 3300026142 | Bacteria | 6064 |
| 193 | Ga0268266_10003010 | 3300028379 | Bacteria | 17318 |
| 194 | Ga0268265_10027736 | 3300028380 | Bacteria | 4046 |
| 195 | Ga0268265_10114711 | 3300028380 | Bacteria | 2207 |
| 196 | Ga0268264_10054722 | 3300028381 | Bacteria | 3333 |
| 197 | Ga0268264_10208759 | 3300028381 | Bacteria | 1791 |
| 198 | Ga0307515_10000093 | 3300028794 | Bacteria | 212053 |
| 199 | Ga0307515_10073756 | 3300028794 | Bacteria | 4579 |
| 200 | Ga0307515_10242476 | 3300028794 | Bacteria | 1570 |
| 201 | Ga0265338_10001217 | 3300028800 | Bacteria | 42536 |
| 202 | Ga0265338_10178599 | 3300028800 | Bacteria | 1621 |
| 203 | Ga0265330_10019142 | 3300031235 | Bacteria | 3140 |
| 204 | Ga0265332_10004178 | 3300031238 | Bacteria | 6848 |
| 205 | Ga0265328_10000007 | 3300031239 | Bacteria | 224310 |
| 206 | Ga0265328_10004697 | 3300031239 | Bacteria | 5903 |
| 207 | Ga0265340_10026905 | 3300031247 | Bacteria | 2904 |
| 208 | Ga0265331_10001179 | 3300031250 | Bacteria | 19910 |
| 209 | Ga0265331_10019065 | 3300031250 | Bacteria | 3546 |
| 210 | Ga0265316_10139178 | 3300031344 | Bacteria | 1824 |
| 211 | Ga0265314_10000660 | 3300031711 | Bacteria | 42242 |
| 212 | Ga0307516_10003211 | 3300031730 | Bacteria | 21220 |
| 213 | Ga0307413_10074261 | 3300031824 | Bacteria | 2153 |
| 214 | Ga0307410_10134771 | 3300031852 | Bacteria | 1819 |
| 215 | Ga0400490_05991 | 3300038726 | Bacteria | 1568 |
| 216 | Ga0436361_0183078 | 3300039447 | Bacteria | 10188 |
| 217 | Ga0436361_0313546 | 3300039447 | Bacteria | 35556 |
| 218 | Ga0436361_0500164 | 3300039447 | Bacteria | 28968 |
| 219 | Ga0436361_0632282 | 3300039447 | Bacteria | 3698 |
| 220 | Ga0436361_0833848 | 3300039447 | Bacteria | 20064 |
| 221 | Ga0451577_0001784 | 3300042876 | Bacteria | 27608 |
| 222 | Ga0451577_0003831 | 3300042876 | Bacteria | 16362 |
| 223 | Ga0451577_0013756 | 3300042876 | Bacteria | 7562 |
| 224 | Ga0451576_0017156 | 3300045051 | Bacteria | 7964 |
| 225 | Ga0451576_0046314 | 3300045051 | Bacteria | 4580 |
| 226 | Ga0495650_0004936 | 3300046471 | Bacteria | 8909 |
| 227 | Ga0495642_0081163 | 3300046528 | Bacteria | 1366 |
| 228 | Ga0495658_0014941 | 3300046683 | Bacteria | 3978 |
| 229 | Ga0496106_0010685 | 3300048909 | Bacteria | 6785 |
| 230 | Ga0496107_0022136 | 3300048910 | Bacteria | 4491 |
| 231 | Ga0496108_0442435 | 3300048911 | Bacteria | 1135 |
| 232 | Ga0496109_0112384 | 3300048912 | Bacteria | 2533 |
| 233 | Ga0496114_0067401 | 3300048917 | Bacteria | 3003 |
| 234 | Ga0495678_015836 | 3300049459 | Bacteria | 3461 |
| 235 | Ga0501032_0016600 | 3300049569 | Bacteria | 5177 |
| 236 | Ga0501033_0059064 | 3300049570 | Bacteria | 2832 |
| 237 | Ga0501034_0032770 | 3300049571 | Bacteria | 5276 |
| 238 | Ga0501034_0039708 | 3300049571 | Bacteria | 4767 |
| 239 | Ga0501034_0189870 | 3300049571 | Bacteria | 2017 |
| 240 | Ga0501038_0039263 | 3300049574 | Bacteria | 4141 |
| 241 | Ga0501039_0040073 | 3300049575 | Bacteria | 3616 |
| 242 | Ga0501043_0300608 | 3300049579 | Bacteria | 1226 |
| 243 | Ga0501047_0074875 | 3300049581 | Bacteria | 3259 |
| 244 | Ga0501067_0008233 | 3300049583 | Bacteria | 5789 |
| 245 | Ga0501070_0010311 | 3300049586 | Bacteria | 7898 |
| 246 | Ga0501072_0016231 | 3300049588 | Bacteria | 5712 |
| 247 | Ga0501073_0034104 | 3300049589 | Bacteria | 3623 |
| 248 | Ga0501074_0160179 | 3300049590 | Bacteria | 1607 |
| 249 | Ga0501035_0010423 | 3300049822 | Bacteria | 8615 |
| 250 | Ga0501035_0034278 | 3300049822 | Bacteria | 4614 |
| 251 | Ga0501035_0215282 | 3300049822 | Bacteria | 1642 |
| 252 | nmdc:mga0k408_2673_c1 | 3300050493 | Bacteria | 9451 |
| 253 | nmdc:mga07m45_650_c1 | 3300050496 | Bacteria | 14760 |
| 254 | Ga0590071_001980 | 3300059421 | Bacteria | 5239 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0081163 | Ga0495642_0081163_17_1081 | 346 |
| 2 | 3300049579 | Ga0501043_0300608 | Ga0501043_0300608_18_1067 | 346 |
| 3 | 3300026067 | Ga0207678_10090851 | Ga0207678_100908511 | 358 |
| 4 | 3300048911 | Ga0496108_0442435 | Ga0496108_0442435_37_1125 | 359 |
| 5 | 3300025921 | Ga0207652_10070784 | Ga0207652_100707843 | 372 |
| 6 | 3300026116 | Ga0207674_10081670 | Ga0207674_100816704 | 372 |
| 7 | 3300005347 | Ga0070668_100257719 | Ga0070668_1002577192 | 375 |
| 8 | 3300005543 | Ga0070672_100021020 | Ga0070672_1000210202 | 375 |
| 9 | 3300005616 | Ga0068852_100090668 | Ga0068852_1000906682 | 375 |
| 10 | 3300013306 | Ga0163162_10061801 | Ga0163162_100618012 | 375 |
| 11 | 3300013308 | Ga0157375_10028957 | Ga0157375_100289573 | 375 |
| 12 | 3300025931 | Ga0207644_10014320 | Ga0207644_100143204 | 375 |
| 13 | 3300005336 | Ga0070680_100173042 | Ga0070680_1001730421 | 376 |
| 14 | 3300005344 | Ga0070661_100037316 | Ga0070661_1000373162 | 376 |
| 15 | 3300005530 | Ga0070679_100059381 | Ga0070679_1000593812 | 376 |
| 16 | 3300013100 | Ga0157373_10032290 | Ga0157373_100322901 | 376 |
| 17 | 3300013104 | Ga0157370_10042641 | Ga0157370_100426411 | 376 |
| 18 | 3300013307 | Ga0157372_10040065 | Ga0157372_100400652 | 376 |
| 19 | 3300025912 | Ga0207707_10043047 | Ga0207707_100430472 | 376 |
| 20 | 3300025917 | Ga0207660_10141409 | Ga0207660_101414092 | 376 |
| 21 | 3300013297 | Ga0157378_10041642 | Ga0157378_100416423 | 380 |
| 22 | 3300009093 | Ga0105240_10253378 | Ga0105240_102533782 | 383 |
| 23 | 3300026121 | Ga0207683_10000019 | Ga0207683_100000192 | 383 |
| 24 | 3300013105 | Ga0157369_10032539 | Ga0157369_100325395 | 387 |
| 25 | 3300028380 | Ga0268265_10027736 | Ga0268265_100277363 | 388 |
| 26 | 3300005335 | Ga0070666_10106649 | Ga0070666_101066492 | 389 |
| 27 | 3300005338 | Ga0068868_100019803 | Ga0068868_1000198034 | 389 |
| 28 | 3300005340 | Ga0070689_100112043 | Ga0070689_1001120431 | 389 |
| 29 | 3300005347 | Ga0070668_100000411 | Ga0070668_10000041118 | 389 |
| 30 | 3300005353 | Ga0070669_100007708 | Ga0070669_1000077086 | 389 |
| 31 | 3300005354 | Ga0070675_100021029 | Ga0070675_1000210292 | 389 |
| 32 | 3300005356 | Ga0070674_100008421 | Ga0070674_1000084216 | 389 |
| 33 | 3300005364 | Ga0070673_100008853 | Ga0070673_1000088536 | 389 |
| 34 | 3300005367 | Ga0070667_100000463 | Ga0070667_10000046323 | 389 |
| 35 | 3300005456 | Ga0070678_100041146 | Ga0070678_1000411463 | 389 |
| 36 | 3300005459 | Ga0068867_100000932 | Ga0068867_1000009326 | 389 |
| 37 | 3300005548 | Ga0070665_100003327 | Ga0070665_1000033272 | 389 |
| 38 | 3300005618 | Ga0068864_100055665 | Ga0068864_1000556654 | 389 |
| 39 | 3300005840 | Ga0068870_10107170 | Ga0068870_101071701 | 389 |
| 40 | 3300005841 | Ga0068863_100003312 | Ga0068863_10000331212 | 389 |
| 41 | 3300005842 | Ga0068858_100009778 | Ga0068858_1000097785 | 389 |
| 42 | 3300006237 | Ga0097621_100012889 | Ga0097621_1000128896 | 389 |
| 43 | 3300006358 | Ga0068871_100008710 | Ga0068871_1000087106 | 389 |
| 44 | 3300009177 | Ga0105248_10014263 | Ga0105248_100142632 | 389 |
| 45 | 3300013297 | Ga0157378_10145370 | Ga0157378_101453701 | 389 |
| 46 | 3300013306 | Ga0163162_10053419 | Ga0163162_100534193 | 389 |
| 47 | 3300014968 | Ga0157379_10092575 | Ga0157379_100925754 | 389 |
| 48 | 3300014969 | Ga0157376_10002171 | Ga0157376_100021715 | 389 |
| 49 | 3300025315 | Ga0207697_10017070 | Ga0207697_100170702 | 389 |
| 50 | 3300025903 | Ga0207680_10003848 | Ga0207680_100038485 | 389 |
| 51 | 3300025908 | Ga0207643_10108653 | Ga0207643_101086532 | 389 |
| 52 | 3300025923 | Ga0207681_10014662 | Ga0207681_100146625 | 389 |
| 53 | 3300025925 | Ga0207650_10040024 | Ga0207650_100400242 | 389 |
| 54 | 3300025926 | Ga0207659_10005249 | Ga0207659_100052497 | 389 |
| 55 | 3300025931 | Ga0207644_10022737 | Ga0207644_100227373 | 389 |
| 56 | 3300025936 | Ga0207670_10090018 | Ga0207670_100900182 | 389 |
| 57 | 3300025937 | Ga0207669_10012607 | Ga0207669_100126073 | 389 |
| 58 | 3300025940 | Ga0207691_10001663 | Ga0207691_100016636 | 389 |
| 59 | 3300025941 | Ga0207711_10111266 | Ga0207711_101112662 | 389 |
| 60 | 3300025960 | Ga0207651_10007162 | Ga0207651_100071622 | 389 |
| 61 | 3300025972 | Ga0207668_10002933 | Ga0207668_100029335 | 389 |
| 62 | 3300026023 | Ga0207677_10024780 | Ga0207677_100247805 | 389 |
| 63 | 3300026088 | Ga0207641_10001090 | Ga0207641_1000109018 | 389 |
| 64 | 3300026089 | Ga0207648_10000512 | Ga0207648_1000051224 | 389 |
| 65 | 3300026095 | Ga0207676_10040743 | Ga0207676_100407434 | 389 |
| 66 | 3300026121 | Ga0207683_10003565 | Ga0207683_100035655 | 389 |
| 67 | 3300028379 | Ga0268266_10003010 | Ga0268266_100030109 | 389 |
| 68 | 3300031250 | Ga0265331_10019065 | Ga0265331_100190652 | 389 |
| 69 | 3300038726 | Ga0400490_05991 | Ga0400490_05991_283_1458 | 389 |
| 70 | 3300039447 | Ga0436361_0183078 | Ga0436361_0183078_682_1854 | 389 |
| 71 | iso_pu_bacteria | 8048746797 | 8048748393 | 389 |
| 72 | 3300009098 | Ga0105245_10113076 | Ga0105245_101130764 | 390 |
| 73 | 3300009148 | Ga0105243_10271573 | Ga0105243_102715732 | 390 |
| 74 | 3300009176 | Ga0105242_10056763 | Ga0105242_100567632 | 390 |
| 75 | 3300042876 | Ga0451577_0001784 | Ga0451577_0001784_22588_23790 | 390 |
| 76 | iso_pu_bacteria | 2998344455 | 2998346414 | 390 |
| 77 | 3300005355 | Ga0070671_100120182 | Ga0070671_1001201823 | 391 |
| 78 | 3300013104 | Ga0157370_10144027 | Ga0157370_101440274 | 391 |
| 79 | 3300017792 | Ga0163161_10028980 | Ga0163161_100289804 | 391 |
| 80 | 3300025933 | Ga0207706_10055564 | Ga0207706_100555642 | 391 |
| 81 | 3300026035 | Ga0207703_10116630 | Ga0207703_101166304 | 391 |
| 82 | 3300026089 | Ga0207648_10077036 | Ga0207648_100770363 | 391 |
| 83 | 3300028381 | Ga0268264_10208759 | Ga0268264_102087591 | 391 |
| 84 | 3300028794 | Ga0307515_10242476 | Ga0307515_102424761 | 391 |
| 85 | 3300031239 | Ga0265328_10000007 | Ga0265328_1000000764 | 391 |
| 86 | 3300005445 | Ga0070708_100000191 | Ga0070708_1000001916 | 392 |
| 87 | 3300005564 | Ga0070664_100046799 | Ga0070664_1000467995 | 392 |
| 88 | 3300006195 | Ga0075366_10001921 | Ga0075366_100019216 | 392 |
| 89 | 3300006353 | Ga0075370_10005490 | Ga0075370_100054902 | 392 |
| 90 | 3300021361 | Ga0213872_10041283 | Ga0213872_100412832 | 392 |
| 91 | 3300025945 | Ga0207679_10001222 | Ga0207679_100012229 | 392 |
| 92 | 3300025986 | Ga0207658_10066367 | Ga0207658_100663672 | 392 |
| 93 | 3300031730 | Ga0307516_10003211 | Ga0307516_1000321110 | 392 |
| 94 | 3300031824 | Ga0307413_10074261 | Ga0307413_100742612 | 392 |
| 95 | 3300039447 | Ga0436361_0833848 | Ga0436361_0833848_11251_12429 | 392 |
| 96 | 3300042876 | Ga0451577_0013756 | Ga0451577_0013756_1602_2804 | 392 |
| 97 | 3300045051 | Ga0451576_0017156 | Ga0451576_0017156_4289_5491 | 392 |
| 98 | 3300050493 | nmdc:mga0k408_2673_c1 | nmdc:mga0k408_2673_c1_5264_6499 | 392 |
| 99 | 3300050496 | nmdc:mga07m45_650_c1 | nmdc:mga07m45_650_c1_5461_6696 | 392 |
| 100 | 3300059421 | Ga0590071_001980 | Ga0590071_001980_3156_4376 | 392 |
| 101 | 3300003761 | Ga0055535_1000107 | Ga0055535_100010745 | 393 |
| 102 | 3300003763 | Ga0055529_1000111 | Ga0055529_100011132 | 393 |
| 103 | 3300005841 | Ga0068863_100018683 | Ga0068863_1000186833 | 393 |
| 104 | 3300025242 | Ga0209258_100267 | Ga0209258_10026745 | 393 |
| 105 | 3300025272 | Ga0209455_1000158 | Ga0209455_100015863 | 393 |
| 106 | 3300026088 | Ga0207641_10024278 | Ga0207641_100242785 | 393 |
| 107 | 3300028794 | Ga0307515_10000093 | Ga0307515_1000009352 | 393 |
| 108 | 3300049571 | Ga0501034_0189870 | Ga0501034_0189870_364_1572 | 393 |
| 109 | 3300049583 | Ga0501067_0008233 | Ga0501067_0008233_2278_3486 | 393 |
| 110 | 3300049586 | Ga0501070_0010311 | Ga0501070_0010311_6225_7433 | 393 |
| 111 | 3300049588 | Ga0501072_0016231 | Ga0501072_0016231_280_1488 | 393 |
| 112 | 3300049589 | Ga0501073_0034104 | Ga0501073_0034104_26_1234 | 393 |
| 113 | 3300049590 | Ga0501074_0160179 | Ga0501074_0160179_384_1592 | 393 |
| 114 | 3300049822 | Ga0501035_0215282 | Ga0501035_0215282_230_1438 | 393 |
| 115 | 3300005456 | Ga0070678_100019701 | Ga0070678_1000197016 | 394 |
| 116 | 3300005543 | Ga0070672_100027912 | Ga0070672_1000279122 | 394 |
| 117 | 3300005564 | Ga0070664_100026075 | Ga0070664_1000260755 | 394 |
| 118 | 3300005842 | Ga0068858_100043072 | Ga0068858_1000430722 | 394 |
| 119 | 3300005843 | Ga0068860_100263255 | Ga0068860_1002632552 | 394 |
| 120 | 3300005844 | Ga0068862_100022654 | Ga0068862_1000226543 | 394 |
| 121 | 3300006881 | Ga0068865_100199356 | Ga0068865_1001993561 | 394 |
| 122 | 3300013297 | Ga0157378_10004527 | Ga0157378_100045277 | 394 |
| 123 | 3300014326 | Ga0157380_10040621 | Ga0157380_100406213 | 394 |
| 124 | 3300025924 | Ga0207694_10216300 | Ga0207694_102163001 | 394 |
| 125 | 3300025940 | Ga0207691_10148300 | Ga0207691_101483002 | 394 |
| 126 | 3300025944 | Ga0207661_10010949 | Ga0207661_100109497 | 394 |
| 127 | 3300025945 | Ga0207679_10000906 | Ga0207679_1000090613 | 394 |
| 128 | 3300025949 | Ga0207667_10394382 | Ga0207667_103943821 | 394 |
| 129 | 3300026116 | Ga0207674_10003155 | Ga0207674_1000315524 | 394 |
| 130 | 3300026121 | Ga0207683_10008343 | Ga0207683_100083432 | 394 |
| 131 | 3300028381 | Ga0268264_10054722 | Ga0268264_100547223 | 394 |
| 132 | 3300048912 | Ga0496109_0112384 | Ga0496109_0112384_1252_2487 | 394 |
| 133 | 3300048917 | Ga0496114_0067401 | Ga0496114_0067401_1439_2674 | 394 |
| 134 | 3300005331 | Ga0070670_100007656 | Ga0070670_1000076567 | 395 |
| 135 | 3300005457 | Ga0070662_100119803 | Ga0070662_1001198031 | 395 |
| 136 | 3300005548 | Ga0070665_100069559 | Ga0070665_1000695592 | 395 |
| 137 | 3300005564 | Ga0070664_100147499 | Ga0070664_1001474992 | 395 |
| 138 | 3300005616 | Ga0068852_100070944 | Ga0068852_1000709442 | 395 |
| 139 | 3300005618 | Ga0068864_100000470 | Ga0068864_10000047017 | 395 |
| 140 | 3300005719 | Ga0068861_100200870 | Ga0068861_1002008702 | 395 |
| 141 | 3300005841 | Ga0068863_100005782 | Ga0068863_10000578212 | 395 |
| 142 | 3300009098 | Ga0105245_10015255 | Ga0105245_100152553 | 395 |
| 143 | 3300014325 | Ga0163163_10057199 | Ga0163163_100571993 | 395 |
| 144 | 3300025893 | Ga0207682_10016966 | Ga0207682_100169663 | 395 |
| 145 | 3300025918 | Ga0207662_10002504 | Ga0207662_100025047 | 395 |
| 146 | 3300025920 | Ga0207649_10070173 | Ga0207649_100701733 | 395 |
| 147 | 3300025925 | Ga0207650_10001554 | Ga0207650_1000155411 | 395 |
| 148 | 3300025928 | Ga0207700_10122493 | Ga0207700_101224931 | 395 |
| 149 | 3300025933 | Ga0207706_10262486 | Ga0207706_102624862 | 395 |
| 150 | 3300025942 | Ga0207689_10046178 | Ga0207689_100461785 | 395 |
| 151 | 3300025945 | Ga0207679_10176017 | Ga0207679_101760171 | 395 |
| 152 | 3300025972 | Ga0207668_10025697 | Ga0207668_100256972 | 395 |
| 153 | 3300026088 | Ga0207641_10011755 | Ga0207641_100117553 | 395 |
| 154 | 3300026095 | Ga0207676_10002120 | Ga0207676_100021203 | 395 |
| 155 | 3300026095 | Ga0207676_10002385 | Ga0207676_100023851 | 395 |
| 156 | 3300026118 | Ga0207675_100034206 | Ga0207675_1000342064 | 395 |
| 157 | 3300026121 | Ga0207683_10092515 | Ga0207683_100925153 | 395 |
| 158 | 3300028380 | Ga0268265_10114711 | Ga0268265_101147112 | 395 |
| 159 | 3300028800 | Ga0265338_10178599 | Ga0265338_101785991 | 395 |
| 160 | 3300031235 | Ga0265330_10019142 | Ga0265330_100191424 | 395 |
| 161 | 3300031238 | Ga0265332_10004178 | Ga0265332_100041787 | 395 |
| 162 | 3300031239 | Ga0265328_10004697 | Ga0265328_100046976 | 395 |
| 163 | 3300031250 | Ga0265331_10001179 | Ga0265331_100011792 | 395 |
| 164 | 3300031344 | Ga0265316_10139178 | Ga0265316_101391782 | 395 |
| 165 | 3300031711 | Ga0265314_10000660 | Ga0265314_1000066047 | 395 |
| 166 | 3300049459 | Ga0495678_015836 | Ga0495678_015836_709_1914 | 395 |
| 167 | 3300005290 | Ga0065712_10016506 | Ga0065712_100165062 | 396 |
| 168 | 3300005338 | Ga0068868_100004436 | Ga0068868_1000044365 | 396 |
| 169 | 3300005354 | Ga0070675_100015141 | Ga0070675_1000151417 | 396 |
| 170 | 3300005356 | Ga0070674_100067029 | Ga0070674_1000670292 | 396 |
| 171 | 3300005364 | Ga0070673_100045634 | Ga0070673_1000456342 | 396 |
| 172 | 3300005543 | Ga0070672_100054395 | Ga0070672_1000543954 | 396 |
| 173 | 3300005614 | Ga0068856_100167400 | Ga0068856_1001674002 | 396 |
| 174 | 3300005616 | Ga0068852_100002785 | Ga0068852_1000027854 | 396 |
| 175 | 3300005834 | Ga0068851_10041346 | Ga0068851_100413461 | 396 |
| 176 | 3300006237 | Ga0097621_100116745 | Ga0097621_1001167452 | 396 |
| 177 | 3300025960 | Ga0207651_10010483 | Ga0207651_100104835 | 396 |
| 178 | 3300026095 | Ga0207676_10026026 | Ga0207676_100260262 | 396 |
| 179 | 3300026142 | Ga0207698_10010035 | Ga0207698_100100353 | 396 |
| 180 | 3300028794 | Ga0307515_10073756 | Ga0307515_100737565 | 396 |
| 181 | 3300042876 | Ga0451577_0003831 | Ga0451577_0003831_6237_7463 | 396 |
| 182 | 3300046471 | Ga0495650_0004936 | Ga0495650_0004936_980_2212 | 396 |
| 183 | 3300046683 | Ga0495658_0014941 | Ga0495658_0014941_2038_3261 | 396 |
| 184 | 3300049569 | Ga0501032_0016600 | Ga0501032_0016600_3624_4829 | 396 |
| 185 | 3300049570 | Ga0501033_0059064 | Ga0501033_0059064_1580_2785 | 396 |
| 186 | 3300049571 | Ga0501034_0032770 | Ga0501034_0032770_3723_4928 | 396 |
| 187 | 3300049574 | Ga0501038_0039263 | Ga0501038_0039263_296_1501 | 396 |
| 188 | 3300049575 | Ga0501039_0040073 | Ga0501039_0040073_1353_2558 | 396 |
| 189 | 3300049822 | Ga0501035_0010423 | Ga0501035_0010423_5541_6746 | 396 |
| 190 | 3300049822 | Ga0501035_0034278 | Ga0501035_0034278_1603_2808 | 396 |
| 191 | 3300003316 | rootH1_10005014 | rootH1_100050145 | 397 |
| 192 | 3300005331 | Ga0070670_100023848 | Ga0070670_1000238482 | 397 |
| 193 | 3300005339 | Ga0070660_100123512 | Ga0070660_1001235122 | 397 |
| 194 | 3300005344 | Ga0070661_100032915 | Ga0070661_1000329151 | 397 |
| 195 | 3300005344 | Ga0070661_100098759 | Ga0070661_1000987592 | 397 |
| 196 | 3300005354 | Ga0070675_100085181 | Ga0070675_1000851812 | 397 |
| 197 | 3300005354 | Ga0070675_100316079 | Ga0070675_1003160791 | 397 |
| 198 | 3300005355 | Ga0070671_100075497 | Ga0070671_1000754973 | 397 |
| 199 | 3300005356 | Ga0070674_100197631 | Ga0070674_1001976311 | 397 |
| 200 | 3300005366 | Ga0070659_100012804 | Ga0070659_1000128043 | 397 |
| 201 | 3300005366 | Ga0070659_100036105 | Ga0070659_1000361052 | 397 |
| 202 | 3300005367 | Ga0070667_100199330 | Ga0070667_1001993302 | 397 |
| 203 | 3300005455 | Ga0070663_100039064 | Ga0070663_1000390644 | 397 |
| 204 | 3300005456 | Ga0070678_100191594 | Ga0070678_1001915942 | 397 |
| 205 | 3300005457 | Ga0070662_100028743 | Ga0070662_1000287434 | 397 |
| 206 | 3300005458 | Ga0070681_10004183 | Ga0070681_1000418314 | 397 |
| 207 | 3300005530 | Ga0070679_100093201 | Ga0070679_1000932013 | 397 |
| 208 | 3300005535 | Ga0070684_100039305 | Ga0070684_1000393052 | 397 |
| 209 | 3300005539 | Ga0068853_100050087 | Ga0068853_1000500871 | 397 |
| 210 | 3300005543 | Ga0070672_100051737 | Ga0070672_1000517372 | 397 |
| 211 | 3300005563 | Ga0068855_100005475 | Ga0068855_10000547511 | 397 |
| 212 | 3300005563 | Ga0068855_100056082 | Ga0068855_1000560825 | 397 |
| 213 | 3300005564 | Ga0070664_100012293 | Ga0070664_1000122936 | 397 |
| 214 | 3300005577 | Ga0068857_100025924 | Ga0068857_1000259244 | 397 |
| 215 | 3300005841 | Ga0068863_100246097 | Ga0068863_1002460972 | 397 |
| 216 | 3300005842 | Ga0068858_100107627 | Ga0068858_1001076272 | 397 |
| 217 | 3300009093 | Ga0105240_10104955 | Ga0105240_101049552 | 397 |
| 218 | 3300009551 | Ga0105238_10023869 | Ga0105238_100238695 | 397 |
| 219 | 3300013102 | Ga0157371_10148763 | Ga0157371_101487632 | 397 |
| 220 | 3300013104 | Ga0157370_10005790 | Ga0157370_1000579010 | 397 |
| 221 | 3300013105 | Ga0157369_10159388 | Ga0157369_101593883 | 397 |
| 222 | 3300013307 | Ga0157372_10227419 | Ga0157372_102274191 | 397 |
| 223 | 3300014325 | Ga0163163_10030695 | Ga0163163_100306952 | 397 |
| 224 | 3300017792 | Ga0163161_10224656 | Ga0163161_102246561 | 397 |
| 225 | 3300021361 | Ga0213872_10001253 | Ga0213872_1000125317 | 397 |
| 226 | 3300021361 | Ga0213872_10001765 | Ga0213872_100017652 | 397 |
| 227 | 3300021361 | Ga0213872_10003865 | Ga0213872_100038657 | 397 |
| 228 | 3300025315 | Ga0207697_10037077 | Ga0207697_100370772 | 397 |
| 229 | 3300025893 | Ga0207682_10032270 | Ga0207682_100322702 | 397 |
| 230 | 3300025907 | Ga0207645_10043368 | Ga0207645_100433682 | 397 |
| 231 | 3300025908 | Ga0207643_10116445 | Ga0207643_101164451 | 397 |
| 232 | 3300025912 | Ga0207707_10009777 | Ga0207707_100097778 | 397 |
| 233 | 3300025913 | Ga0207695_10067703 | Ga0207695_100677033 | 397 |
| 234 | 3300025920 | Ga0207649_10138757 | Ga0207649_101387572 | 397 |
| 235 | 3300025920 | Ga0207649_10203047 | Ga0207649_102030471 | 397 |
| 236 | 3300025926 | Ga0207659_10269280 | Ga0207659_102692801 | 397 |
| 237 | 3300025932 | Ga0207690_10017546 | Ga0207690_100175465 | 397 |
| 238 | 3300025933 | Ga0207706_10000040 | Ga0207706_10000040109 | 397 |
| 239 | 3300025940 | Ga0207691_10061252 | Ga0207691_100612522 | 397 |
| 240 | 3300025949 | Ga0207667_10001525 | Ga0207667_1000152510 | 397 |
| 241 | 3300025949 | Ga0207667_10207849 | Ga0207667_102078492 | 397 |
| 242 | 3300026041 | Ga0207639_10086100 | Ga0207639_100861002 | 397 |
| 243 | 3300026075 | Ga0207708_10089765 | Ga0207708_100897653 | 397 |
| 244 | 3300026118 | Ga0207675_100328003 | Ga0207675_1003280031 | 397 |
| 245 | 3300026121 | Ga0207683_10011473 | Ga0207683_100114734 | 397 |
| 246 | 3300028800 | Ga0265338_10001217 | Ga0265338_1000121722 | 397 |
| 247 | 3300031247 | Ga0265340_10026905 | Ga0265340_100269053 | 397 |
| 248 | 3300031852 | Ga0307410_10134771 | Ga0307410_101347712 | 397 |
| 249 | 3300039447 | Ga0436361_0313546 | Ga0436361_0313546_28715_29962 | 397 |
| 250 | 3300039447 | Ga0436361_0500164 | Ga0436361_0500164_1695_2942 | 397 |
| 251 | 3300039447 | Ga0436361_0632282 | Ga0436361_0632282_807_2054 | 397 |
| 252 | 3300045051 | Ga0451576_0046314 | Ga0451576_0046314_459_1709 | 397 |
| 253 | 3300048909 | Ga0496106_0010685 | Ga0496106_0010685_2545_3792 | 397 |
| 254 | 3300048910 | Ga0496107_0022136 | Ga0496107_0022136_232_1479 | 397 |
| 255 | 3300049571 | Ga0501034_0039708 | Ga0501034_0039708_2204_3412 | 397 |
| 256 | 3300049581 | Ga0501047_0074875 | Ga0501047_0074875_1988_3205 | 397 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u7u-assembly1.cif.gz_A-2 | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.969 | 184 | 395 |
| 1u7w-assembly1.cif.gz_B | phosphopantothenoylcysteine synthetase from e. coli, ctp-complex | 0.967 | 184 | 397 |
| 1u7w-assembly1.cif.gz_A | phosphopantothenoylcysteine synthetase from e. coli, ctp-complex | 0.9609 | 184 | 395 |
| 1u7w-assembly2.cif.gz_C-2 | phosphopantothenoylcysteine synthetase from e. coli, ctp-complex | 0.9565 | 184 | 393 |
| 1u80-assembly1.cif.gz_B | phosphopantothenoylcysteine synthetase from e. coli, cmp complex | 0.9525 | 184 | 397 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G268_1_185_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9827 | 5 | 180 | 3.40.50.1950 |
| af_P0ABQ0_1_184_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9682 | 1 | 181 | 3.40.50.1950 |
| 1u7wB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CoaB-like | 0.967 | 184 | 397 | 3.40.50.10300 |
| af_Q2G268_186_399_3.40.50.10300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CoaB-like | 0.9662 | 184 | 391 | 3.40.50.10300 |
| af_P9WNZ1_7_185_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9625 | 4 | 178 | 3.40.50.1950 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5FXM7-F1-model_v4 | deleted | 0.9989 | 5 | 123 |
|
| AF-A0A3C1MT56-F1-model_v4 | Phosphopantothenate synthase | 0.9955 | 317 | 397 |
GO:0003824
GO:0015937 |
| AF-A0A7C3SGT7-F1-model_v4 | Bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase (EC 4.1.1.36, EC 6.3.2.5) | 0.9933 | 79 | 176 |
GO:0004632
GO:0004633 GO:0010181 GO:0015937 GO:0071513 |
| AF-A0A4Q5PFZ4-F1-model_v4 | Phosphopantothenate synthase | 0.9931 | 5 | 174 |
GO:0004633
GO:0010181 GO:0015937 GO:0071513 |
| AF-A0A2H9M9Q5-F1-model_v4 | Phosphopantothenate synthase | 0.9927 | 186 | 393 |
GO:0003824
GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar