F366035

General Info

Members Datasets Scaffolds Average Seq Length
255 130 255 262

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0064374|Ga0501067_0064374_417_1205
Length 262
Sequence MRGFAFIIGPMLAGLGNAAAAANTQPICADRPSRSTGECTVPAGSWQIETGLVDWVHDRSDGITTDINVWGSSLIKYGVSANADIELGVTPLETLRTSGQERHSSFGDMIARVKYRLTADDAPLQVALDPFVKIPTANHHLGNGKVEGGMLVPMSAQLGKGPVTLSFDPELDLLADADGHGRHLGTQQVVNIGVQLNDKLNLSAELWGSWDWDPAGTGKQASGDVSAAYLVSRNLQLDAGANFGLNRQTPDVELYTGVSARF

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.88
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002071 3300001915 Bacteria 5366
2 JGI24740J21852_10012184 3300001979 Bacteria 3247
3 JGI24737J22298_10000867 3300001990 Bacteria 10805
4 JGI24737J22298_10002202 3300001990 Bacteria 6944
5 rootL2_10261103 3300003322 Bacteria 1214
6 Ga0070658_10017445 3300005327 Bacteria 5745
7 Ga0070658_10049473 3300005327 Bacteria 3405
8 Ga0070658_10065661 3300005327 Bacteria 2962
9 Ga0070676_10090798 3300005328 Bacteria 1871
10 Ga0070683_100099747 3300005329 Bacteria 2734
11 Ga0070683_100147146 3300005329 Bacteria 2232
12 Ga0070670_100017295 3300005331 Bacteria 6184
13 Ga0070670_100030989 3300005331 Bacteria 4606
14 Ga0068869_100064603 3300005334 Bacteria 2692
15 Ga0070680_100118910 3300005336 Unclassified 2204
16 Ga0070682_100244562 3300005337 Bacteria 1290
17 Ga0068868_100633618 3300005338 Unclassified 950
18 Ga0070660_100084505 3300005339 Bacteria 2494
19 Ga0070661_100011043 3300005344 Bacteria 6291
20 Ga0070661_100057726 3300005344 Bacteria 2844
21 Ga0070692_10006028 3300005345 Bacteria 5226
22 Ga0070668_100313322 3300005347 Bacteria 1319
23 Ga0070675_100430049 3300005354 Bacteria 1181
24 Ga0070671_100000469 3300005355 Bacteria 28112
25 Ga0070671_100002772 3300005355 Bacteria 13614
26 Ga0070671_100080439 3300005355 Bacteria 2725
27 Ga0070674_100056446 3300005356 Bacteria 2723
28 Ga0070674_100150430 3300005356 Bacteria 1756
29 Ga0070673_100026041 3300005364 Bacteria 4314
30 Ga0070673_100047163 3300005364 Bacteria 3351
31 Ga0070673_100223071 3300005364 Bacteria 1632
32 Ga0070659_100001102 3300005366 Bacteria 19726
33 Ga0070659_100009301 3300005366 Bacteria 7215
34 Ga0070659_100017167 3300005366 Bacteria 5441
35 Ga0070659_100195334 3300005366 Bacteria 1664
36 Ga0070659_100213306 3300005366 Bacteria 1591
37 Ga0070659_100314956 3300005366 Unclassified 1307
38 Ga0070667_100326585 3300005367 Unclassified 1385
39 Ga0070714_100040757 3300005435 Bacteria 3915
40 Ga0070713_100011624 3300005436 Bacteria 6421
41 Ga0070713_100078197 3300005436 Bacteria 2815
42 Ga0070713_100297282 3300005436 Bacteria 1486
43 Ga0070713_100367284 3300005436 Bacteria 1338
44 Ga0070694_100002573 3300005444 Bacteria 10723
45 Ga0070663_100113066 3300005455 Bacteria 2043
46 Ga0070662_100002187 3300005457 Bacteria 11986
47 Ga0070662_100084288 3300005457 Bacteria 2374
48 Ga0070662_100129194 3300005457 Bacteria 1946
49 Ga0070662_100132296 3300005457 Bacteria 1925
50 Ga0070662_100180196 3300005457 Bacteria 1665
51 Ga0070681_10312263 3300005458 Unclassified 1481
52 Ga0070679_100186707 3300005530 Unclassified 2043
53 Ga0070679_100385904 3300005530 Bacteria 1347
54 Ga0068853_100100195 3300005539 Bacteria 2560
55 Ga0068853_100212876 3300005539 Bacteria 1762
56 Ga0068853_100417748 3300005539 Unclassified 1257
57 Ga0068853_100490360 3300005539 Bacteria 1159
58 Ga0068853_100828412 3300005539 Unclassified 887
59 Ga0070672_100059202 3300005543 Bacteria 3013
60 Ga0070672_100106615 3300005543 Unclassified 2280
61 Ga0070672_100311857 3300005543 Bacteria 1336
62 Ga0070695_100164006 3300005545 Bacteria 1562
63 Ga0070665_100069752 3300005548 Bacteria 3523
64 Ga0068855_100098584 3300005563 Bacteria 3366
65 Ga0068855_100374978 3300005563 Bacteria 1563
66 Ga0068855_100670241 3300005563 Bacteria 1112
67 Ga0070664_100007759 3300005564 Bacteria 8664
68 Ga0070664_100044815 3300005564 Bacteria 3735
69 Ga0070664_100143617 3300005564 Bacteria 2103
70 Ga0070664_100184547 3300005564 Unclassified 1856
71 Ga0068857_100023192 3300005577 Bacteria 5461
72 Ga0068857_100026624 3300005577 Bacteria 5097
73 Ga0068854_100102264 3300005578 Bacteria 2150
74 Ga0068856_100381642 3300005614 Unclassified 1428
75 Ga0068856_100464267 3300005614 Bacteria 1287
76 Ga0068852_100224911 3300005616 Bacteria 1786
77 Ga0068852_100254721 3300005616 Bacteria 1683
78 Ga0068864_100009341 3300005618 Bacteria 8087
79 Ga0068864_100009951 3300005618 Bacteria 7845
80 Ga0068864_100012325 3300005618 Bacteria 7066
81 Ga0068866_10183489 3300005718 Bacteria 1238
82 Ga0068851_10034950 3300005834 Unclassified 2510
83 Ga0068870_10254805 3300005840 Unclassified 1089
84 Ga0068863_100029615 3300005841 Bacteria 5226
85 Ga0068858_100528101 3300005842 Bacteria 1141
86 Ga0068860_100628808 3300005843 Bacteria 1080
87 Ga0070717_10037096 3300006028 Bacteria 3956
88 Ga0070717_10065564 3300006028 Bacteria 3019
89 Ga0070712_100007509 3300006175 Bacteria 6811
90 Ga0070712_100012808 3300006175 Bacteria 5338
91 Ga0068871_100064519 3300006358 Bacteria 2999
92 Ga0105240_10233428 3300009093 Bacteria 2136
93 Ga0105245_10418938 3300009098 Bacteria 1342
94 Ga0105243_10224574 3300009148 Bacteria 1662
95 Ga0105243_10321188 3300009148 Bacteria 1411
96 Ga0105242_10809640 3300009176 Bacteria 928
97 Ga0105248_10000928 3300009177 Bacteria 32626
98 Ga0105248_10158526 3300009177 Unclassified 2553
99 Ga0105248_10255899 3300009177 Bacteria 1971
100 Ga0105249_10005065 3300009553 Bacteria 11354
101 Ga0105239_10033629 3300010375 Bacteria 5630
102 Ga0105246_10093013 3300011119 Bacteria 2177
103 Ga0157373_10018611 3300013100 Bacteria 5055
104 Ga0157373_10323615 3300013100 Bacteria 1097
105 Ga0157371_10179684 3300013102 Bacteria 1513
106 Ga0157370_10228670 3300013104 Unclassified 1722
107 Ga0157374_10021695 3300013296 Bacteria 5719
108 Ga0163162_10016416 3300013306 Bacteria 7235
109 Ga0163162_10206863 3300013306 Bacteria 2092
110 Ga0157372_10372260 3300013307 Bacteria 1664
111 Ga0157372_10472996 3300013307 Unclassified 1461
112 Ga0207688_10029515 3300025901 Unclassified 3020
113 Ga0207688_10106286 3300025901 Bacteria 1625
114 Ga0207647_10009939 3300025904 Bacteria 6739
115 Ga0207647_10010665 3300025904 Bacteria 6477
116 Ga0207645_10218311 3300025907 Unclassified 1256
117 Ga0207643_10160174 3300025908 Bacteria 1354
118 Ga0207705_10005854 3300025909 Bacteria 9151
119 Ga0207705_10007385 3300025909 Bacteria 8081
120 Ga0207705_10018338 3300025909 Bacteria 5005
121 Ga0207705_10040090 3300025909 Bacteria 3358
122 Ga0207693_10005058 3300025915 Bacteria 11068
123 Ga0207693_10034892 3300025915 Bacteria 3968
124 Ga0207660_10106899 3300025917 Unclassified 2099
125 Ga0207660_10311852 3300025917 Unclassified 1255
126 Ga0207657_10000868 3300025919 Bacteria 31880
127 Ga0207657_10012092 3300025919 Bacteria 8530
128 Ga0207657_10020235 3300025919 Bacteria 6295
129 Ga0207657_10049591 3300025919 Bacteria 3657
130 Ga0207657_10051628 3300025919 Bacteria 3574
131 Ga0207649_10005930 3300025920 Bacteria 6622
132 Ga0207649_10016532 3300025920 Bacteria 4164
133 Ga0207649_10105961 3300025920 Unclassified 1869
134 Ga0207649_10176976 3300025920 Bacteria 1490
135 Ga0207652_10031744 3300025921 Bacteria 4436
136 Ga0207652_10119787 3300025921 Bacteria 2341
137 Ga0207694_10385914 3300025924 Unclassified 1163
138 Ga0207650_10086201 3300025925 Unclassified 2390
139 Ga0207659_10458351 3300025926 Bacteria 1075
140 Ga0207664_10266925 3300025929 Bacteria 1498
141 Ga0207664_10283087 3300025929 Bacteria 1455
142 Ga0207644_10000514 3300025931 Bacteria 25001
143 Ga0207644_10014169 3300025931 Bacteria 5332
144 Ga0207644_10035954 3300025931 Bacteria 3474
145 Ga0207644_10220391 3300025931 Bacteria 1503
146 Ga0207644_10304764 3300025931 Unclassified 1285
147 Ga0207690_10005748 3300025932 Bacteria 7331
148 Ga0207690_10009409 3300025932 Bacteria 5804
149 Ga0207690_10034434 3300025932 Bacteria 3264
150 Ga0207690_10158486 3300025932 Bacteria 1685
151 Ga0207706_10009641 3300025933 Bacteria 8864
152 Ga0207706_10017849 3300025933 Bacteria 6390
153 Ga0207706_10038077 3300025933 Bacteria 4266
154 Ga0207706_10050293 3300025933 Bacteria 3683
155 Ga0207706_10100630 3300025933 Bacteria 2543
156 Ga0207709_10440593 3300025935 Bacteria 1005
157 Ga0207711_10000243 3300025941 Bacteria 58447
158 Ga0207711_10027882 3300025941 Bacteria 4747
159 Ga0207689_10003382 3300025942 Bacteria 14579
160 Ga0207661_10216830 3300025944 Bacteria 1690
161 Ga0207661_10397093 3300025944 Unclassified 1250
162 Ga0207679_10007755 3300025945 Bacteria 6821
163 Ga0207679_10020130 3300025945 Bacteria 4498
164 Ga0207679_10126646 3300025945 Bacteria 2042
165 Ga0207667_10589152 3300025949 Bacteria 1122
166 Ga0207651_10151816 3300025960 Bacteria 1804
167 Ga0207668_10276514 3300025972 Bacteria 1375
168 Ga0207640_10483990 3300025981 Bacteria 1027
169 Ga0207677_10601690 3300026023 Unclassified 965
170 Ga0207703_10609809 3300026035 Bacteria 1033
171 Ga0207678_10031905 3300026067 Bacteria 4593
172 Ga0207702_10149848 3300026078 Bacteria 2121
173 Ga0207676_10004053 3300026095 Bacteria 10333
174 Ga0207676_10061220 3300026095 Unclassified 2980
175 Ga0207674_10000491 3300026116 Bacteria 52076
176 Ga0207674_10011384 3300026116 Bacteria 9996
177 Ga0207683_10020037 3300026121 Bacteria 5715
178 Ga0268266_10106950 3300028379 Bacteria 2473
179 Ga0307406_10521758 3300031901 Unclassified 967
180 Ga0307416_100050621 3300032002 Bacteria 3312
181 Ga0307415_100010002 3300032126 Bacteria 5351
182 Ga0395899_0000632 3300037312 Bacteria 36585
183 Ga0395899_0055527 3300037312 Unclassified 2929
184 Ga0395900_0000075 3300037418 Bacteria 183525
185 Ga0395900_0021708 3300037418 Bacteria 6564
186 Ga0395900_0133385 3300037418 Bacteria 2544
187 Ga0395900_0134921 3300037418 Unclassified 2528
188 Ga0395900_0207815 3300037418 Bacteria 1978
189 Ga0395900_0211257 3300037418 Bacteria 1959
190 Ga0395900_0275117 3300037418 Bacteria 1677
191 Ga0395898_0000055 3300037466 Bacteria 278557
192 Ga0395898_0043490 3300037466 Bacteria 4425
193 Ga0395898_0056757 3300037466 Bacteria 3816
194 Ga0395898_0247013 3300037466 Bacteria 1702
195 Ga0395898_0372844 3300037466 Bacteria 1361
196 Ga0395905_0000067 3300037471 Bacteria 181887
197 Ga0395905_0015171 3300037471 Bacteria 7331
198 Ga0395905_0052149 3300037471 Bacteria 3831
199 Ga0395905_0069695 3300037471 Bacteria 3294
200 Ga0395905_0085890 3300037471 Unclassified 2948
201 Ga0395905_0091138 3300037471 Unclassified 2858
202 Ga0395905_0097492 3300037471 Bacteria 2760
203 Ga0395905_0114122 3300037471 Bacteria 2538
204 Ga0395905_0255207 3300037471 Bacteria 1638
205 Ga0395905_0287613 3300037471 Viruses 1530
206 Ga0395905_0306182 3300037471 Bacteria 1477
207 Ga0395905_0412993 3300037471 Unclassified 1245
208 Ga0395905_0479587 3300037471 Bacteria 1143
209 Ga0395901_0000477 3300038443 Bacteria 46511
210 Ga0395901_0008531 3300038443 Bacteria 10352
211 Ga0395901_0021848 3300038443 Bacteria 6557
212 Ga0395901_0023986 3300038443 Bacteria 6258
213 Ga0395901_0255936 3300038443 Bacteria 1823
214 Ga0395901_0260028 3300038443 Bacteria 1807
215 Ga0395901_0306843 3300038443 Bacteria 1644
216 Ga0395901_0518519 3300038443 Unclassified 1211
217 Ga0436365_1490276 3300039437 Bacteria 16241
218 Ga0466966_0016309 3300044684 Bacteria 4913
219 Ga0466966_0126302 3300044684 Bacteria 1568
220 Ga0466961_0012177 3300044693 Bacteria 5500
221 Ga0466961_0124631 3300044693 Bacteria 1617
222 Ga0466963_0013039 3300044694 Bacteria 5096
223 Ga0466971_0015953 3300044719 Bacteria 3310
224 Ga0466971_0098877 3300044719 Bacteria 1340
225 Ga0466959_0012314 3300045049 Bacteria 6176
226 Ga0466959_0084504 3300045049 Bacteria 2285
227 Ga0466958_0088039 3300045836 Unclassified 1918
228 Ga0466958_0296012 3300045836 Bacteria 1039
229 Ga0466967_0031473 3300045976 Bacteria 4466
230 Ga0466967_0369106 3300045976 Bacteria 1392
231 Ga0495663_0003630 3300046525 Bacteria 4423
232 Ga0495663_0017570 3300046525 Bacteria 2031
233 Ga0495642_0119564 3300046528 Bacteria 1130
234 Ga0495621_0018975 3300046539 Bacteria 2240
235 Ga0495668_0003092 3300046616 Bacteria 12865
236 Ga0495669_0005217 3300046684 Bacteria 5408
237 Ga0495669_0031878 3300046684 Bacteria 2314
238 Ga0495669_0068637 3300046684 Bacteria 1613
239 Ga0495681_0100647 3300047470 Bacteria 1264
240 Ga0496100_0058481 3300048903 Bacteria 2530
241 Ga0496101_0020972 3300048904 Bacteria 4484
242 Ga0496104_0580829 3300048907 Bacteria 1031
243 Ga0496106_0000666 3300048909 Bacteria 24598
244 Ga0496107_0000181 3300048910 Bacteria 32803
245 Ga0496108_0006821 3300048911 Bacteria 9239
246 Ga0496109_0000774 3300048912 Bacteria 26581
247 Ga0496109_0049252 3300048912 Bacteria 3835
248 Ga0496111_0001460 3300048914 Bacteria 13524
249 Ga0496112_0000354 3300048915 Bacteria 29882
250 Ga0496112_0145862 3300048915 Bacteria 2335
251 Ga0496112_0388242 3300048915 Unclassified 1336
252 Ga0496112_0462885 3300048915 Bacteria 1205
253 Ga0496113_0004786 3300048916 Bacteria 8365
254 Ga0496113_0118438 3300048916 Unclassified 2068
255 Ga0501067_0064374 3300049583 Unclassified 2030

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0580829 Ga0496104_0580829_312_989 225
2 3300001990 JGI24737J22298_10000867 JGI24737J22298_1000086710 246
3 3300005339 Ga0070660_100084505 Ga0070660_1000845051 246
4 3300005345 Ga0070692_10006028 Ga0070692_100060284 246
5 3300005366 Ga0070659_100001102 Ga0070659_1000011025 246
6 3300005444 Ga0070694_100002573 Ga0070694_10000257312 246
7 3300005457 Ga0070662_100002187 Ga0070662_1000021879 246
8 3300005539 Ga0068853_100100195 Ga0068853_1001001952 246
9 3300005543 Ga0070672_100059202 Ga0070672_1000592022 246
10 3300005563 Ga0068855_100098584 Ga0068855_1000985842 246
11 3300005577 Ga0068857_100026624 Ga0068857_1000266242 246
12 3300005616 Ga0068852_100254721 Ga0068852_1002547212 246
13 3300005842 Ga0068858_100528101 Ga0068858_1005281012 246
14 3300005843 Ga0068860_100628808 Ga0068860_1006288081 246
15 3300009093 Ga0105240_10233428 Ga0105240_102334282 246
16 3300009148 Ga0105243_10224574 Ga0105243_102245742 246
17 3300009553 Ga0105249_10005065 Ga0105249_1000506512 246
18 3300010375 Ga0105239_10033629 Ga0105239_100336296 246
19 3300037471 Ga0395905_0069695 Ga0395905_0069695_1468_2259 246
20 3300005327 Ga0070658_10065661 Ga0070658_100656614 247
21 3300005564 Ga0070664_100184547 Ga0070664_1001845472 247
22 3300025909 Ga0207705_10040090 Ga0207705_100400903 247
23 3300025917 Ga0207660_10311852 Ga0207660_103118521 247
24 3300025919 Ga0207657_10012092 Ga0207657_100120928 247
25 3300037418 Ga0395900_0207815 Ga0395900_0207815_219_1016 248
26 3300005337 Ga0070682_100244562 Ga0070682_1002445622 250
27 3300005364 Ga0070673_100026041 Ga0070673_1000260415 250
28 3300005367 Ga0070667_100326585 Ga0070667_1003265853 250
29 3300005457 Ga0070662_100084288 Ga0070662_1000842883 250
30 3300005548 Ga0070665_100069752 Ga0070665_1000697523 250
31 3300005840 Ga0068870_10254805 Ga0068870_102548052 250
32 3300009177 Ga0105248_10255899 Ga0105248_102558994 250
33 3300013296 Ga0157374_10021695 Ga0157374_100216954 250
34 3300013306 Ga0163162_10016416 Ga0163162_100164165 250
35 3300025901 Ga0207688_10106286 Ga0207688_101062863 250
36 3300025908 Ga0207643_10160174 Ga0207643_101601741 250
37 3300025933 Ga0207706_10038077 Ga0207706_100380777 250
38 3300028379 Ga0268266_10106950 Ga0268266_101069503 250
39 3300045836 Ga0466958_0296012 Ga0466958_0296012_158_913 250
40 3300005331 Ga0070670_100017295 Ga0070670_1000172957 252
41 3300005344 Ga0070661_100011043 Ga0070661_1000110432 252
42 3300005366 Ga0070659_100314956 Ga0070659_1003149562 252
43 3300005618 Ga0068864_100009341 Ga0068864_1000093414 252
44 3300025901 Ga0207688_10029515 Ga0207688_100295152 252
45 3300025920 Ga0207649_10005930 Ga0207649_100059302 252
46 3300025925 Ga0207650_10086201 Ga0207650_100862013 252
47 3300025944 Ga0207661_10397093 Ga0207661_103970932 252
48 3300025945 Ga0207679_10007755 Ga0207679_100077557 252
49 3300025921 Ga0207652_10119787 Ga0207652_101197874 253
50 3300005364 Ga0070673_100223071 Ga0070673_1002230712 254
51 3300005530 Ga0070679_100385904 Ga0070679_1003859041 254
52 3300013100 Ga0157373_10018611 Ga0157373_100186113 254
53 3300013102 Ga0157371_10179684 Ga0157371_101796843 254
54 3300026121 Ga0207683_10020037 Ga0207683_100200375 254
55 3300037471 Ga0395905_0306182 Ga0395905_0306182_394_1161 254
56 3300048915 Ga0496112_0388242 Ga0496112_0388242_176_940 254
57 3300048916 Ga0496113_0118438 Ga0496113_0118438_1173_1937 254
58 3300005328 Ga0070676_10090798 Ga0070676_100907982 255
59 3300005334 Ga0068869_100064603 Ga0068869_1000646032 255
60 3300005543 Ga0070672_100106615 Ga0070672_1001066151 255
61 3300005545 Ga0070695_100164006 Ga0070695_1001640062 255
62 3300005563 Ga0068855_100670241 Ga0068855_1006702412 255
63 3300005718 Ga0068866_10183489 Ga0068866_101834891 255
64 3300009098 Ga0105245_10418938 Ga0105245_104189381 255
65 3300009148 Ga0105243_10321188 Ga0105243_103211881 255
66 3300025907 Ga0207645_10218311 Ga0207645_102183112 255
67 3300025933 Ga0207706_10009641 Ga0207706_100096413 255
68 3300025935 Ga0207709_10440593 Ga0207709_104405932 255
69 3300025942 Ga0207689_10003382 Ga0207689_100033828 255
70 3300025949 Ga0207667_10589152 Ga0207667_105891521 255
71 3300026035 Ga0207703_10609809 Ga0207703_106098091 255
72 3300005366 Ga0070659_100009301 Ga0070659_1000093017 256
73 3300005457 Ga0070662_100132296 Ga0070662_1001322962 256
74 3300005539 Ga0068853_100490360 Ga0068853_1004903602 256
75 3300025904 Ga0207647_10009939 Ga0207647_100099397 256
76 3300025932 Ga0207690_10005748 Ga0207690_100057487 256
77 3300025933 Ga0207706_10050293 Ga0207706_100502933 256
78 3300005338 Ga0068868_100633618 Ga0068868_1006336181 257
79 3300005364 Ga0070673_100047163 Ga0070673_1000471632 257
80 3300005366 Ga0070659_100017167 Ga0070659_1000171676 257
81 3300005457 Ga0070662_100180196 Ga0070662_1001801962 257
82 3300005347 Ga0070668_100313322 Ga0070668_1003133221 258
83 3300005356 Ga0070674_100056446 Ga0070674_1000564463 258
84 3300005578 Ga0068854_100102264 Ga0068854_1001022642 259
85 3300025981 Ga0207640_10483990 Ga0207640_104839902 259
86 3300044694 Ga0466963_0013039 Ga0466963_0013039_548_1336 260
87 3300045976 Ga0466967_0031473 Ga0466967_0031473_3377_4165 260
88 3300049583 Ga0501067_0064374 Ga0501067_0064374_417_1205 260
89 3300005329 Ga0070683_100147146 Ga0070683_1001471462 261
90 3300005355 Ga0070671_100080439 Ga0070671_1000804392 261
91 3300025904 Ga0207647_10010665 Ga0207647_100106655 261
92 3300037418 Ga0395900_0133385 Ga0395900_0133385_400_1191 261
93 3300037471 Ga0395905_0085890 Ga0395905_0085890_661_1452 261
94 3300038443 Ga0395901_0255936 Ga0395901_0255936_633_1424 261
95 3300046616 Ga0495668_0003092 Ga0495668_0003092_915_1703 261
96 3300046684 Ga0495669_0005217 Ga0495669_0005217_986_1774 261
97 3300047470 Ga0495681_0100647 Ga0495681_0100647_82_870 261
98 3300001990 JGI24737J22298_10002202 JGI24737J22298_100022024 262
99 3300003322 rootL2_10261103 rootL2_102611032 262
100 3300005331 Ga0070670_100030989 Ga0070670_1000309892 262
101 3300005354 Ga0070675_100430049 Ga0070675_1004300491 262
102 3300005355 Ga0070671_100000469 Ga0070671_1000004697 262
103 3300005366 Ga0070659_100195334 Ga0070659_1001953342 262
104 3300005563 Ga0068855_100374978 Ga0068855_1003749782 262
105 3300005564 Ga0070664_100007759 Ga0070664_1000077595 262
106 3300005564 Ga0070664_100143617 Ga0070664_1001436173 262
107 3300005577 Ga0068857_100023192 Ga0068857_1000231925 262
108 3300005618 Ga0068864_100009951 Ga0068864_1000099514 262
109 3300005618 Ga0068864_100012325 Ga0068864_1000123253 262
110 3300005841 Ga0068863_100029615 Ga0068863_1000296154 262
111 3300009177 Ga0105248_10000928 Ga0105248_1000092812 262
112 3300011119 Ga0105246_10093013 Ga0105246_100930132 262
113 3300025919 Ga0207657_10020235 Ga0207657_100202355 262
114 3300025926 Ga0207659_10458351 Ga0207659_104583512 262
115 3300025931 Ga0207644_10000514 Ga0207644_100005142 262
116 3300025931 Ga0207644_10035954 Ga0207644_100359545 262
117 3300025931 Ga0207644_10220391 Ga0207644_102203911 262
118 3300025932 Ga0207690_10009409 Ga0207690_100094093 262
119 3300025932 Ga0207690_10158486 Ga0207690_101584862 262
120 3300025941 Ga0207711_10000243 Ga0207711_1000024342 262
121 3300025941 Ga0207711_10027882 Ga0207711_100278826 262
122 3300025945 Ga0207679_10126646 Ga0207679_101266461 262
123 3300025960 Ga0207651_10151816 Ga0207651_101518162 262
124 3300026023 Ga0207677_10601690 Ga0207677_106016901 262
125 3300026095 Ga0207676_10004053 Ga0207676_1000405312 262
126 3300026095 Ga0207676_10061220 Ga0207676_100612205 262
127 3300026116 Ga0207674_10000491 Ga0207674_1000049118 262
128 3300037471 Ga0395905_0097492 Ga0395905_0097492_894_1688 262
129 3300039437 Ga0436365_1490276 Ga0436365_1490276_15210_16004 262
130 3300044684 Ga0466966_0016309 Ga0466966_0016309_3317_4111 262
131 3300046525 Ga0495663_0017570 Ga0495663_0017570_340_1134 262
132 3300048903 Ga0496100_0058481 Ga0496100_0058481_1283_2077 262
133 3300048904 Ga0496101_0020972 Ga0496101_0020972_2431_3225 262
134 3300048909 Ga0496106_0000666 Ga0496106_0000666_15922_16716 262
135 3300048910 Ga0496107_0000181 Ga0496107_0000181_7687_8481 262
136 3300048911 Ga0496108_0006821 Ga0496108_0006821_6293_7087 262
137 3300048912 Ga0496109_0000774 Ga0496109_0000774_18144_18938 262
138 3300048912 Ga0496109_0049252 Ga0496109_0049252_878_1669 262
139 3300048914 Ga0496111_0001460 Ga0496111_0001460_7338_8132 262
140 3300048915 Ga0496112_0000354 Ga0496112_0000354_21083_21877 262
141 3300048916 Ga0496113_0004786 Ga0496113_0004786_3746_4540 262
142 3300005327 Ga0070658_10017445 Ga0070658_100174454 263
143 3300005327 Ga0070658_10049473 Ga0070658_100494735 263
144 3300005329 Ga0070683_100099747 Ga0070683_1000997472 263
145 3300005336 Ga0070680_100118910 Ga0070680_1001189103 263
146 3300005366 Ga0070659_100213306 Ga0070659_1002133062 263
147 3300005435 Ga0070714_100040757 Ga0070714_1000407575 263
148 3300005436 Ga0070713_100297282 Ga0070713_1002972822 263
149 3300005436 Ga0070713_100367284 Ga0070713_1003672841 263
150 3300005458 Ga0070681_10312263 Ga0070681_103122631 263
151 3300005530 Ga0070679_100186707 Ga0070679_1001867072 263
152 3300005539 Ga0068853_100828412 Ga0068853_1008284121 263
153 3300005543 Ga0070672_100311857 Ga0070672_1003118571 263
154 3300005614 Ga0068856_100381642 Ga0068856_1003816422 263
155 3300005614 Ga0068856_100464267 Ga0068856_1004642671 263
156 3300006175 Ga0070712_100007509 Ga0070712_1000075094 263
157 3300006358 Ga0068871_100064519 Ga0068871_1000645194 263
158 3300009176 Ga0105242_10809640 Ga0105242_108096401 263
159 3300013104 Ga0157370_10228670 Ga0157370_102286703 263
160 3300013306 Ga0163162_10206863 Ga0163162_102068633 263
161 3300013307 Ga0157372_10372260 Ga0157372_103722602 263
162 3300013307 Ga0157372_10472996 Ga0157372_104729962 263
163 3300025909 Ga0207705_10005854 Ga0207705_1000585410 263
164 3300025915 Ga0207693_10034892 Ga0207693_100348922 263
165 3300025917 Ga0207660_10106899 Ga0207660_101068993 263
166 3300025919 Ga0207657_10051628 Ga0207657_100516285 263
167 3300025920 Ga0207649_10016532 Ga0207649_100165325 263
168 3300025920 Ga0207649_10176976 Ga0207649_101769761 263
169 3300025921 Ga0207652_10031744 Ga0207652_100317443 263
170 3300025931 Ga0207644_10304764 Ga0207644_103047641 263
171 3300025944 Ga0207661_10216830 Ga0207661_102168302 263
172 3300025972 Ga0207668_10276514 Ga0207668_102765142 263
173 3300026078 Ga0207702_10149848 Ga0207702_101498481 263
174 3300031901 Ga0307406_10521758 Ga0307406_105217581 263
175 3300032002 Ga0307416_100050621 Ga0307416_1000506215 263
176 3300032126 Ga0307415_100010002 Ga0307415_1000100028 263
177 3300037312 Ga0395899_0000632 Ga0395899_0000632_17387_18184 263
178 3300037312 Ga0395899_0055527 Ga0395899_0055527_345_1142 263
179 3300037418 Ga0395900_0000075 Ga0395900_0000075_57871_58668 263
180 3300037418 Ga0395900_0021708 Ga0395900_0021708_583_1380 263
181 3300037418 Ga0395900_0134921 Ga0395900_0134921_178_975 263
182 3300037418 Ga0395900_0211257 Ga0395900_0211257_140_937 263
183 3300037418 Ga0395900_0275117 Ga0395900_0275117_173_970 263
184 3300037466 Ga0395898_0000055 Ga0395898_0000055_128170_128967 263
185 3300037466 Ga0395898_0043490 Ga0395898_0043490_3121_3918 263
186 3300037466 Ga0395898_0056757 Ga0395898_0056757_1434_2231 263
187 3300037466 Ga0395898_0247013 Ga0395898_0247013_618_1412 263
188 3300037466 Ga0395898_0372844 Ga0395898_0372844_450_1247 263
189 3300037471 Ga0395905_0000067 Ga0395905_0000067_149591_150388 263
190 3300037471 Ga0395905_0015171 Ga0395905_0015171_3998_4795 263
191 3300037471 Ga0395905_0052149 Ga0395905_0052149_330_1127 263
192 3300037471 Ga0395905_0091138 Ga0395905_0091138_1648_2445 263
193 3300037471 Ga0395905_0114122 Ga0395905_0114122_506_1300 263
194 3300037471 Ga0395905_0287613 Ga0395905_0287613_389_1186 263
195 3300037471 Ga0395905_0412993 Ga0395905_0412993_293_1090 263
196 3300038443 Ga0395901_0000477 Ga0395901_0000477_30959_31756 263
197 3300038443 Ga0395901_0008531 Ga0395901_0008531_5207_6004 263
198 3300038443 Ga0395901_0021848 Ga0395901_0021848_875_1672 263
199 3300038443 Ga0395901_0023986 Ga0395901_0023986_3548_4345 263
200 3300038443 Ga0395901_0306843 Ga0395901_0306843_830_1627 263
201 3300038443 Ga0395901_0518519 Ga0395901_0518519_172_969 263
202 3300044684 Ga0466966_0126302 Ga0466966_0126302_211_1005 263
203 3300044693 Ga0466961_0012177 Ga0466961_0012177_3290_4087 263
204 3300044693 Ga0466961_0124631 Ga0466961_0124631_116_910 263
205 3300044719 Ga0466971_0098877 Ga0466971_0098877_262_1059 263
206 3300045049 Ga0466959_0012314 Ga0466959_0012314_4804_5598 263
207 3300045049 Ga0466959_0084504 Ga0466959_0084504_856_1653 263
208 3300045836 Ga0466958_0088039 Ga0466958_0088039_626_1420 263
209 3300046525 Ga0495663_0003630 Ga0495663_0003630_211_1005 263
210 3300046528 Ga0495642_0119564 Ga0495642_0119564_270_1064 263
211 3300046539 Ga0495621_0018975 Ga0495621_0018975_1179_1973 263
212 3300046684 Ga0495669_0031878 Ga0495669_0031878_1086_1880 263
213 3300046684 Ga0495669_0068637 Ga0495669_0068637_265_1059 263
214 3300048915 Ga0496112_0462885 Ga0496112_0462885_39_836 263
215 3300009177 Ga0105248_10158526 Ga0105248_101585264 265
216 3300048915 Ga0496112_0145862 Ga0496112_0145862_1201_2004 265
217 3300001979 JGI24740J21852_10012184 JGI24740J21852_100121846 266
218 3300005344 Ga0070661_100057726 Ga0070661_1000577264 266
219 3300005355 Ga0070671_100002772 Ga0070671_10000277214 266
220 3300005356 Ga0070674_100150430 Ga0070674_1001504303 266
221 3300005436 Ga0070713_100011624 Ga0070713_1000116245 266
222 3300005436 Ga0070713_100078197 Ga0070713_1000781972 266
223 3300005455 Ga0070663_100113066 Ga0070663_1001130663 266
224 3300005457 Ga0070662_100129194 Ga0070662_1001291943 266
225 3300005539 Ga0068853_100212876 Ga0068853_1002128761 266
226 3300005539 Ga0068853_100417748 Ga0068853_1004177481 266
227 3300005564 Ga0070664_100044815 Ga0070664_1000448154 266
228 3300005616 Ga0068852_100224911 Ga0068852_1002249112 266
229 3300005834 Ga0068851_10034950 Ga0068851_100349502 266
230 3300006028 Ga0070717_10037096 Ga0070717_100370963 266
231 3300006028 Ga0070717_10065564 Ga0070717_100655642 266
232 3300006175 Ga0070712_100012808 Ga0070712_1000128082 266
233 3300013100 Ga0157373_10323615 Ga0157373_103236151 266
234 3300025909 Ga0207705_10007385 Ga0207705_100073858 266
235 3300025909 Ga0207705_10018338 Ga0207705_100183386 266
236 3300025915 Ga0207693_10005058 Ga0207693_1000505813 266
237 3300025919 Ga0207657_10000868 Ga0207657_1000086825 266
238 3300025919 Ga0207657_10049591 Ga0207657_100495916 266
239 3300025920 Ga0207649_10105961 Ga0207649_101059612 266
240 3300025924 Ga0207694_10385914 Ga0207694_103859141 266
241 3300025929 Ga0207664_10266925 Ga0207664_102669252 266
242 3300025929 Ga0207664_10283087 Ga0207664_102830872 266
243 3300025931 Ga0207644_10014169 Ga0207644_100141698 266
244 3300025932 Ga0207690_10034434 Ga0207690_100344343 266
245 3300025933 Ga0207706_10017849 Ga0207706_100178497 266
246 3300025933 Ga0207706_10100630 Ga0207706_101006304 266
247 3300025945 Ga0207679_10020130 Ga0207679_100201305 266
248 3300026067 Ga0207678_10031905 Ga0207678_100319057 266
249 3300026116 Ga0207674_10011384 Ga0207674_100113847 266
250 3300037471 Ga0395905_0255207 Ga0395905_0255207_495_1349 266
251 3300037471 Ga0395905_0479587 Ga0395905_0479587_267_1121 266
252 3300038443 Ga0395901_0260028 Ga0395901_0260028_121_957 266
253 3300044719 Ga0466971_0015953 Ga0466971_0015953_80_964 266
254 3300045976 Ga0466967_0369106 Ga0466967_0369106_512_1366 266
255 3300001915 JGI24741J21665_1002071 JGI24741J21665_10020714 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13557

Phenol_MetA_deg

Putative MetA-pathway of phenol degradation

29

262

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o65-assembly1.cif.gz_A crystal structure of the pseudomonas functional amyloid secretion protein fapf 0.8511 47 262
5o65-assembly1.cif.gz_C crystal structure of the pseudomonas functional amyloid secretion protein fapf 0.8377 47 262
5o68-assembly1.cif.gz_A crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8196 45 262
5o67-assembly1.cif.gz_A crystal structure of the fapf polypeptide transporter - f103a mutant 0.8168 43 262
5o68-assembly3.cif.gz_G crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8163 44 262
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7045 54 265 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6933 54 265 2.40.160.40
5ig0A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.685 151 201 3.10.450.50
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6719 224 263 3.10.129.10
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6613 48 262 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A7W1P276-F1-model_v4 Transporter 0.9539 42 264
AF-A0A2H0PJ47-F1-model_v4 Transporter 0.9485 25 263
AF-A0A7W9EI41-F1-model_v4 Transporter 0.9406 18 264
AF-A0A2E3Q4D8-F1-model_v4 Transporter 0.9398 26 264
AF-A0A7W7YE19-F1-model_v4 Transporter 0.9362 24 264

Feature Viewer

pLDDT pTM Quality
79.32 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map