F366035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 130 | 255 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0064374|Ga0501067_0064374_417_1205 |
| Length | 262 |
| Sequence | MRGFAFIIGPMLAGLGNAAAAANTQPICADRPSRSTGECTVPAGSWQIETGLVDWVHDRSDGITTDINVWGSSLIKYGVSANADIELGVTPLETLRTSGQERHSSFGDMIARVKYRLTADDAPLQVALDPFVKIPTANHHLGNGKVEGGMLVPMSAQLGKGPVTLSFDPELDLLADADGHGRHLGTQQVVNIGVQLNDKLNLSAELWGSWDWDPAGTGKQASGDVSAAYLVSRNLQLDAGANFGLNRQTPDVELYTGVSARF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 124 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 129 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 130 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.88 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1002071 | 3300001915 | Bacteria | 5366 |
| 2 | JGI24740J21852_10012184 | 3300001979 | Bacteria | 3247 |
| 3 | JGI24737J22298_10000867 | 3300001990 | Bacteria | 10805 |
| 4 | JGI24737J22298_10002202 | 3300001990 | Bacteria | 6944 |
| 5 | rootL2_10261103 | 3300003322 | Bacteria | 1214 |
| 6 | Ga0070658_10017445 | 3300005327 | Bacteria | 5745 |
| 7 | Ga0070658_10049473 | 3300005327 | Bacteria | 3405 |
| 8 | Ga0070658_10065661 | 3300005327 | Bacteria | 2962 |
| 9 | Ga0070676_10090798 | 3300005328 | Bacteria | 1871 |
| 10 | Ga0070683_100099747 | 3300005329 | Bacteria | 2734 |
| 11 | Ga0070683_100147146 | 3300005329 | Bacteria | 2232 |
| 12 | Ga0070670_100017295 | 3300005331 | Bacteria | 6184 |
| 13 | Ga0070670_100030989 | 3300005331 | Bacteria | 4606 |
| 14 | Ga0068869_100064603 | 3300005334 | Bacteria | 2692 |
| 15 | Ga0070680_100118910 | 3300005336 | Unclassified | 2204 |
| 16 | Ga0070682_100244562 | 3300005337 | Bacteria | 1290 |
| 17 | Ga0068868_100633618 | 3300005338 | Unclassified | 950 |
| 18 | Ga0070660_100084505 | 3300005339 | Bacteria | 2494 |
| 19 | Ga0070661_100011043 | 3300005344 | Bacteria | 6291 |
| 20 | Ga0070661_100057726 | 3300005344 | Bacteria | 2844 |
| 21 | Ga0070692_10006028 | 3300005345 | Bacteria | 5226 |
| 22 | Ga0070668_100313322 | 3300005347 | Bacteria | 1319 |
| 23 | Ga0070675_100430049 | 3300005354 | Bacteria | 1181 |
| 24 | Ga0070671_100000469 | 3300005355 | Bacteria | 28112 |
| 25 | Ga0070671_100002772 | 3300005355 | Bacteria | 13614 |
| 26 | Ga0070671_100080439 | 3300005355 | Bacteria | 2725 |
| 27 | Ga0070674_100056446 | 3300005356 | Bacteria | 2723 |
| 28 | Ga0070674_100150430 | 3300005356 | Bacteria | 1756 |
| 29 | Ga0070673_100026041 | 3300005364 | Bacteria | 4314 |
| 30 | Ga0070673_100047163 | 3300005364 | Bacteria | 3351 |
| 31 | Ga0070673_100223071 | 3300005364 | Bacteria | 1632 |
| 32 | Ga0070659_100001102 | 3300005366 | Bacteria | 19726 |
| 33 | Ga0070659_100009301 | 3300005366 | Bacteria | 7215 |
| 34 | Ga0070659_100017167 | 3300005366 | Bacteria | 5441 |
| 35 | Ga0070659_100195334 | 3300005366 | Bacteria | 1664 |
| 36 | Ga0070659_100213306 | 3300005366 | Bacteria | 1591 |
| 37 | Ga0070659_100314956 | 3300005366 | Unclassified | 1307 |
| 38 | Ga0070667_100326585 | 3300005367 | Unclassified | 1385 |
| 39 | Ga0070714_100040757 | 3300005435 | Bacteria | 3915 |
| 40 | Ga0070713_100011624 | 3300005436 | Bacteria | 6421 |
| 41 | Ga0070713_100078197 | 3300005436 | Bacteria | 2815 |
| 42 | Ga0070713_100297282 | 3300005436 | Bacteria | 1486 |
| 43 | Ga0070713_100367284 | 3300005436 | Bacteria | 1338 |
| 44 | Ga0070694_100002573 | 3300005444 | Bacteria | 10723 |
| 45 | Ga0070663_100113066 | 3300005455 | Bacteria | 2043 |
| 46 | Ga0070662_100002187 | 3300005457 | Bacteria | 11986 |
| 47 | Ga0070662_100084288 | 3300005457 | Bacteria | 2374 |
| 48 | Ga0070662_100129194 | 3300005457 | Bacteria | 1946 |
| 49 | Ga0070662_100132296 | 3300005457 | Bacteria | 1925 |
| 50 | Ga0070662_100180196 | 3300005457 | Bacteria | 1665 |
| 51 | Ga0070681_10312263 | 3300005458 | Unclassified | 1481 |
| 52 | Ga0070679_100186707 | 3300005530 | Unclassified | 2043 |
| 53 | Ga0070679_100385904 | 3300005530 | Bacteria | 1347 |
| 54 | Ga0068853_100100195 | 3300005539 | Bacteria | 2560 |
| 55 | Ga0068853_100212876 | 3300005539 | Bacteria | 1762 |
| 56 | Ga0068853_100417748 | 3300005539 | Unclassified | 1257 |
| 57 | Ga0068853_100490360 | 3300005539 | Bacteria | 1159 |
| 58 | Ga0068853_100828412 | 3300005539 | Unclassified | 887 |
| 59 | Ga0070672_100059202 | 3300005543 | Bacteria | 3013 |
| 60 | Ga0070672_100106615 | 3300005543 | Unclassified | 2280 |
| 61 | Ga0070672_100311857 | 3300005543 | Bacteria | 1336 |
| 62 | Ga0070695_100164006 | 3300005545 | Bacteria | 1562 |
| 63 | Ga0070665_100069752 | 3300005548 | Bacteria | 3523 |
| 64 | Ga0068855_100098584 | 3300005563 | Bacteria | 3366 |
| 65 | Ga0068855_100374978 | 3300005563 | Bacteria | 1563 |
| 66 | Ga0068855_100670241 | 3300005563 | Bacteria | 1112 |
| 67 | Ga0070664_100007759 | 3300005564 | Bacteria | 8664 |
| 68 | Ga0070664_100044815 | 3300005564 | Bacteria | 3735 |
| 69 | Ga0070664_100143617 | 3300005564 | Bacteria | 2103 |
| 70 | Ga0070664_100184547 | 3300005564 | Unclassified | 1856 |
| 71 | Ga0068857_100023192 | 3300005577 | Bacteria | 5461 |
| 72 | Ga0068857_100026624 | 3300005577 | Bacteria | 5097 |
| 73 | Ga0068854_100102264 | 3300005578 | Bacteria | 2150 |
| 74 | Ga0068856_100381642 | 3300005614 | Unclassified | 1428 |
| 75 | Ga0068856_100464267 | 3300005614 | Bacteria | 1287 |
| 76 | Ga0068852_100224911 | 3300005616 | Bacteria | 1786 |
| 77 | Ga0068852_100254721 | 3300005616 | Bacteria | 1683 |
| 78 | Ga0068864_100009341 | 3300005618 | Bacteria | 8087 |
| 79 | Ga0068864_100009951 | 3300005618 | Bacteria | 7845 |
| 80 | Ga0068864_100012325 | 3300005618 | Bacteria | 7066 |
| 81 | Ga0068866_10183489 | 3300005718 | Bacteria | 1238 |
| 82 | Ga0068851_10034950 | 3300005834 | Unclassified | 2510 |
| 83 | Ga0068870_10254805 | 3300005840 | Unclassified | 1089 |
| 84 | Ga0068863_100029615 | 3300005841 | Bacteria | 5226 |
| 85 | Ga0068858_100528101 | 3300005842 | Bacteria | 1141 |
| 86 | Ga0068860_100628808 | 3300005843 | Bacteria | 1080 |
| 87 | Ga0070717_10037096 | 3300006028 | Bacteria | 3956 |
| 88 | Ga0070717_10065564 | 3300006028 | Bacteria | 3019 |
| 89 | Ga0070712_100007509 | 3300006175 | Bacteria | 6811 |
| 90 | Ga0070712_100012808 | 3300006175 | Bacteria | 5338 |
| 91 | Ga0068871_100064519 | 3300006358 | Bacteria | 2999 |
| 92 | Ga0105240_10233428 | 3300009093 | Bacteria | 2136 |
| 93 | Ga0105245_10418938 | 3300009098 | Bacteria | 1342 |
| 94 | Ga0105243_10224574 | 3300009148 | Bacteria | 1662 |
| 95 | Ga0105243_10321188 | 3300009148 | Bacteria | 1411 |
| 96 | Ga0105242_10809640 | 3300009176 | Bacteria | 928 |
| 97 | Ga0105248_10000928 | 3300009177 | Bacteria | 32626 |
| 98 | Ga0105248_10158526 | 3300009177 | Unclassified | 2553 |
| 99 | Ga0105248_10255899 | 3300009177 | Bacteria | 1971 |
| 100 | Ga0105249_10005065 | 3300009553 | Bacteria | 11354 |
| 101 | Ga0105239_10033629 | 3300010375 | Bacteria | 5630 |
| 102 | Ga0105246_10093013 | 3300011119 | Bacteria | 2177 |
| 103 | Ga0157373_10018611 | 3300013100 | Bacteria | 5055 |
| 104 | Ga0157373_10323615 | 3300013100 | Bacteria | 1097 |
| 105 | Ga0157371_10179684 | 3300013102 | Bacteria | 1513 |
| 106 | Ga0157370_10228670 | 3300013104 | Unclassified | 1722 |
| 107 | Ga0157374_10021695 | 3300013296 | Bacteria | 5719 |
| 108 | Ga0163162_10016416 | 3300013306 | Bacteria | 7235 |
| 109 | Ga0163162_10206863 | 3300013306 | Bacteria | 2092 |
| 110 | Ga0157372_10372260 | 3300013307 | Bacteria | 1664 |
| 111 | Ga0157372_10472996 | 3300013307 | Unclassified | 1461 |
| 112 | Ga0207688_10029515 | 3300025901 | Unclassified | 3020 |
| 113 | Ga0207688_10106286 | 3300025901 | Bacteria | 1625 |
| 114 | Ga0207647_10009939 | 3300025904 | Bacteria | 6739 |
| 115 | Ga0207647_10010665 | 3300025904 | Bacteria | 6477 |
| 116 | Ga0207645_10218311 | 3300025907 | Unclassified | 1256 |
| 117 | Ga0207643_10160174 | 3300025908 | Bacteria | 1354 |
| 118 | Ga0207705_10005854 | 3300025909 | Bacteria | 9151 |
| 119 | Ga0207705_10007385 | 3300025909 | Bacteria | 8081 |
| 120 | Ga0207705_10018338 | 3300025909 | Bacteria | 5005 |
| 121 | Ga0207705_10040090 | 3300025909 | Bacteria | 3358 |
| 122 | Ga0207693_10005058 | 3300025915 | Bacteria | 11068 |
| 123 | Ga0207693_10034892 | 3300025915 | Bacteria | 3968 |
| 124 | Ga0207660_10106899 | 3300025917 | Unclassified | 2099 |
| 125 | Ga0207660_10311852 | 3300025917 | Unclassified | 1255 |
| 126 | Ga0207657_10000868 | 3300025919 | Bacteria | 31880 |
| 127 | Ga0207657_10012092 | 3300025919 | Bacteria | 8530 |
| 128 | Ga0207657_10020235 | 3300025919 | Bacteria | 6295 |
| 129 | Ga0207657_10049591 | 3300025919 | Bacteria | 3657 |
| 130 | Ga0207657_10051628 | 3300025919 | Bacteria | 3574 |
| 131 | Ga0207649_10005930 | 3300025920 | Bacteria | 6622 |
| 132 | Ga0207649_10016532 | 3300025920 | Bacteria | 4164 |
| 133 | Ga0207649_10105961 | 3300025920 | Unclassified | 1869 |
| 134 | Ga0207649_10176976 | 3300025920 | Bacteria | 1490 |
| 135 | Ga0207652_10031744 | 3300025921 | Bacteria | 4436 |
| 136 | Ga0207652_10119787 | 3300025921 | Bacteria | 2341 |
| 137 | Ga0207694_10385914 | 3300025924 | Unclassified | 1163 |
| 138 | Ga0207650_10086201 | 3300025925 | Unclassified | 2390 |
| 139 | Ga0207659_10458351 | 3300025926 | Bacteria | 1075 |
| 140 | Ga0207664_10266925 | 3300025929 | Bacteria | 1498 |
| 141 | Ga0207664_10283087 | 3300025929 | Bacteria | 1455 |
| 142 | Ga0207644_10000514 | 3300025931 | Bacteria | 25001 |
| 143 | Ga0207644_10014169 | 3300025931 | Bacteria | 5332 |
| 144 | Ga0207644_10035954 | 3300025931 | Bacteria | 3474 |
| 145 | Ga0207644_10220391 | 3300025931 | Bacteria | 1503 |
| 146 | Ga0207644_10304764 | 3300025931 | Unclassified | 1285 |
| 147 | Ga0207690_10005748 | 3300025932 | Bacteria | 7331 |
| 148 | Ga0207690_10009409 | 3300025932 | Bacteria | 5804 |
| 149 | Ga0207690_10034434 | 3300025932 | Bacteria | 3264 |
| 150 | Ga0207690_10158486 | 3300025932 | Bacteria | 1685 |
| 151 | Ga0207706_10009641 | 3300025933 | Bacteria | 8864 |
| 152 | Ga0207706_10017849 | 3300025933 | Bacteria | 6390 |
| 153 | Ga0207706_10038077 | 3300025933 | Bacteria | 4266 |
| 154 | Ga0207706_10050293 | 3300025933 | Bacteria | 3683 |
| 155 | Ga0207706_10100630 | 3300025933 | Bacteria | 2543 |
| 156 | Ga0207709_10440593 | 3300025935 | Bacteria | 1005 |
| 157 | Ga0207711_10000243 | 3300025941 | Bacteria | 58447 |
| 158 | Ga0207711_10027882 | 3300025941 | Bacteria | 4747 |
| 159 | Ga0207689_10003382 | 3300025942 | Bacteria | 14579 |
| 160 | Ga0207661_10216830 | 3300025944 | Bacteria | 1690 |
| 161 | Ga0207661_10397093 | 3300025944 | Unclassified | 1250 |
| 162 | Ga0207679_10007755 | 3300025945 | Bacteria | 6821 |
| 163 | Ga0207679_10020130 | 3300025945 | Bacteria | 4498 |
| 164 | Ga0207679_10126646 | 3300025945 | Bacteria | 2042 |
| 165 | Ga0207667_10589152 | 3300025949 | Bacteria | 1122 |
| 166 | Ga0207651_10151816 | 3300025960 | Bacteria | 1804 |
| 167 | Ga0207668_10276514 | 3300025972 | Bacteria | 1375 |
| 168 | Ga0207640_10483990 | 3300025981 | Bacteria | 1027 |
| 169 | Ga0207677_10601690 | 3300026023 | Unclassified | 965 |
| 170 | Ga0207703_10609809 | 3300026035 | Bacteria | 1033 |
| 171 | Ga0207678_10031905 | 3300026067 | Bacteria | 4593 |
| 172 | Ga0207702_10149848 | 3300026078 | Bacteria | 2121 |
| 173 | Ga0207676_10004053 | 3300026095 | Bacteria | 10333 |
| 174 | Ga0207676_10061220 | 3300026095 | Unclassified | 2980 |
| 175 | Ga0207674_10000491 | 3300026116 | Bacteria | 52076 |
| 176 | Ga0207674_10011384 | 3300026116 | Bacteria | 9996 |
| 177 | Ga0207683_10020037 | 3300026121 | Bacteria | 5715 |
| 178 | Ga0268266_10106950 | 3300028379 | Bacteria | 2473 |
| 179 | Ga0307406_10521758 | 3300031901 | Unclassified | 967 |
| 180 | Ga0307416_100050621 | 3300032002 | Bacteria | 3312 |
| 181 | Ga0307415_100010002 | 3300032126 | Bacteria | 5351 |
| 182 | Ga0395899_0000632 | 3300037312 | Bacteria | 36585 |
| 183 | Ga0395899_0055527 | 3300037312 | Unclassified | 2929 |
| 184 | Ga0395900_0000075 | 3300037418 | Bacteria | 183525 |
| 185 | Ga0395900_0021708 | 3300037418 | Bacteria | 6564 |
| 186 | Ga0395900_0133385 | 3300037418 | Bacteria | 2544 |
| 187 | Ga0395900_0134921 | 3300037418 | Unclassified | 2528 |
| 188 | Ga0395900_0207815 | 3300037418 | Bacteria | 1978 |
| 189 | Ga0395900_0211257 | 3300037418 | Bacteria | 1959 |
| 190 | Ga0395900_0275117 | 3300037418 | Bacteria | 1677 |
| 191 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 192 | Ga0395898_0043490 | 3300037466 | Bacteria | 4425 |
| 193 | Ga0395898_0056757 | 3300037466 | Bacteria | 3816 |
| 194 | Ga0395898_0247013 | 3300037466 | Bacteria | 1702 |
| 195 | Ga0395898_0372844 | 3300037466 | Bacteria | 1361 |
| 196 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 197 | Ga0395905_0015171 | 3300037471 | Bacteria | 7331 |
| 198 | Ga0395905_0052149 | 3300037471 | Bacteria | 3831 |
| 199 | Ga0395905_0069695 | 3300037471 | Bacteria | 3294 |
| 200 | Ga0395905_0085890 | 3300037471 | Unclassified | 2948 |
| 201 | Ga0395905_0091138 | 3300037471 | Unclassified | 2858 |
| 202 | Ga0395905_0097492 | 3300037471 | Bacteria | 2760 |
| 203 | Ga0395905_0114122 | 3300037471 | Bacteria | 2538 |
| 204 | Ga0395905_0255207 | 3300037471 | Bacteria | 1638 |
| 205 | Ga0395905_0287613 | 3300037471 | Viruses | 1530 |
| 206 | Ga0395905_0306182 | 3300037471 | Bacteria | 1477 |
| 207 | Ga0395905_0412993 | 3300037471 | Unclassified | 1245 |
| 208 | Ga0395905_0479587 | 3300037471 | Bacteria | 1143 |
| 209 | Ga0395901_0000477 | 3300038443 | Bacteria | 46511 |
| 210 | Ga0395901_0008531 | 3300038443 | Bacteria | 10352 |
| 211 | Ga0395901_0021848 | 3300038443 | Bacteria | 6557 |
| 212 | Ga0395901_0023986 | 3300038443 | Bacteria | 6258 |
| 213 | Ga0395901_0255936 | 3300038443 | Bacteria | 1823 |
| 214 | Ga0395901_0260028 | 3300038443 | Bacteria | 1807 |
| 215 | Ga0395901_0306843 | 3300038443 | Bacteria | 1644 |
| 216 | Ga0395901_0518519 | 3300038443 | Unclassified | 1211 |
| 217 | Ga0436365_1490276 | 3300039437 | Bacteria | 16241 |
| 218 | Ga0466966_0016309 | 3300044684 | Bacteria | 4913 |
| 219 | Ga0466966_0126302 | 3300044684 | Bacteria | 1568 |
| 220 | Ga0466961_0012177 | 3300044693 | Bacteria | 5500 |
| 221 | Ga0466961_0124631 | 3300044693 | Bacteria | 1617 |
| 222 | Ga0466963_0013039 | 3300044694 | Bacteria | 5096 |
| 223 | Ga0466971_0015953 | 3300044719 | Bacteria | 3310 |
| 224 | Ga0466971_0098877 | 3300044719 | Bacteria | 1340 |
| 225 | Ga0466959_0012314 | 3300045049 | Bacteria | 6176 |
| 226 | Ga0466959_0084504 | 3300045049 | Bacteria | 2285 |
| 227 | Ga0466958_0088039 | 3300045836 | Unclassified | 1918 |
| 228 | Ga0466958_0296012 | 3300045836 | Bacteria | 1039 |
| 229 | Ga0466967_0031473 | 3300045976 | Bacteria | 4466 |
| 230 | Ga0466967_0369106 | 3300045976 | Bacteria | 1392 |
| 231 | Ga0495663_0003630 | 3300046525 | Bacteria | 4423 |
| 232 | Ga0495663_0017570 | 3300046525 | Bacteria | 2031 |
| 233 | Ga0495642_0119564 | 3300046528 | Bacteria | 1130 |
| 234 | Ga0495621_0018975 | 3300046539 | Bacteria | 2240 |
| 235 | Ga0495668_0003092 | 3300046616 | Bacteria | 12865 |
| 236 | Ga0495669_0005217 | 3300046684 | Bacteria | 5408 |
| 237 | Ga0495669_0031878 | 3300046684 | Bacteria | 2314 |
| 238 | Ga0495669_0068637 | 3300046684 | Bacteria | 1613 |
| 239 | Ga0495681_0100647 | 3300047470 | Bacteria | 1264 |
| 240 | Ga0496100_0058481 | 3300048903 | Bacteria | 2530 |
| 241 | Ga0496101_0020972 | 3300048904 | Bacteria | 4484 |
| 242 | Ga0496104_0580829 | 3300048907 | Bacteria | 1031 |
| 243 | Ga0496106_0000666 | 3300048909 | Bacteria | 24598 |
| 244 | Ga0496107_0000181 | 3300048910 | Bacteria | 32803 |
| 245 | Ga0496108_0006821 | 3300048911 | Bacteria | 9239 |
| 246 | Ga0496109_0000774 | 3300048912 | Bacteria | 26581 |
| 247 | Ga0496109_0049252 | 3300048912 | Bacteria | 3835 |
| 248 | Ga0496111_0001460 | 3300048914 | Bacteria | 13524 |
| 249 | Ga0496112_0000354 | 3300048915 | Bacteria | 29882 |
| 250 | Ga0496112_0145862 | 3300048915 | Bacteria | 2335 |
| 251 | Ga0496112_0388242 | 3300048915 | Unclassified | 1336 |
| 252 | Ga0496112_0462885 | 3300048915 | Bacteria | 1205 |
| 253 | Ga0496113_0004786 | 3300048916 | Bacteria | 8365 |
| 254 | Ga0496113_0118438 | 3300048916 | Unclassified | 2068 |
| 255 | Ga0501067_0064374 | 3300049583 | Unclassified | 2030 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0580829 | Ga0496104_0580829_312_989 | 225 |
| 2 | 3300001990 | JGI24737J22298_10000867 | JGI24737J22298_1000086710 | 246 |
| 3 | 3300005339 | Ga0070660_100084505 | Ga0070660_1000845051 | 246 |
| 4 | 3300005345 | Ga0070692_10006028 | Ga0070692_100060284 | 246 |
| 5 | 3300005366 | Ga0070659_100001102 | Ga0070659_1000011025 | 246 |
| 6 | 3300005444 | Ga0070694_100002573 | Ga0070694_10000257312 | 246 |
| 7 | 3300005457 | Ga0070662_100002187 | Ga0070662_1000021879 | 246 |
| 8 | 3300005539 | Ga0068853_100100195 | Ga0068853_1001001952 | 246 |
| 9 | 3300005543 | Ga0070672_100059202 | Ga0070672_1000592022 | 246 |
| 10 | 3300005563 | Ga0068855_100098584 | Ga0068855_1000985842 | 246 |
| 11 | 3300005577 | Ga0068857_100026624 | Ga0068857_1000266242 | 246 |
| 12 | 3300005616 | Ga0068852_100254721 | Ga0068852_1002547212 | 246 |
| 13 | 3300005842 | Ga0068858_100528101 | Ga0068858_1005281012 | 246 |
| 14 | 3300005843 | Ga0068860_100628808 | Ga0068860_1006288081 | 246 |
| 15 | 3300009093 | Ga0105240_10233428 | Ga0105240_102334282 | 246 |
| 16 | 3300009148 | Ga0105243_10224574 | Ga0105243_102245742 | 246 |
| 17 | 3300009553 | Ga0105249_10005065 | Ga0105249_1000506512 | 246 |
| 18 | 3300010375 | Ga0105239_10033629 | Ga0105239_100336296 | 246 |
| 19 | 3300037471 | Ga0395905_0069695 | Ga0395905_0069695_1468_2259 | 246 |
| 20 | 3300005327 | Ga0070658_10065661 | Ga0070658_100656614 | 247 |
| 21 | 3300005564 | Ga0070664_100184547 | Ga0070664_1001845472 | 247 |
| 22 | 3300025909 | Ga0207705_10040090 | Ga0207705_100400903 | 247 |
| 23 | 3300025917 | Ga0207660_10311852 | Ga0207660_103118521 | 247 |
| 24 | 3300025919 | Ga0207657_10012092 | Ga0207657_100120928 | 247 |
| 25 | 3300037418 | Ga0395900_0207815 | Ga0395900_0207815_219_1016 | 248 |
| 26 | 3300005337 | Ga0070682_100244562 | Ga0070682_1002445622 | 250 |
| 27 | 3300005364 | Ga0070673_100026041 | Ga0070673_1000260415 | 250 |
| 28 | 3300005367 | Ga0070667_100326585 | Ga0070667_1003265853 | 250 |
| 29 | 3300005457 | Ga0070662_100084288 | Ga0070662_1000842883 | 250 |
| 30 | 3300005548 | Ga0070665_100069752 | Ga0070665_1000697523 | 250 |
| 31 | 3300005840 | Ga0068870_10254805 | Ga0068870_102548052 | 250 |
| 32 | 3300009177 | Ga0105248_10255899 | Ga0105248_102558994 | 250 |
| 33 | 3300013296 | Ga0157374_10021695 | Ga0157374_100216954 | 250 |
| 34 | 3300013306 | Ga0163162_10016416 | Ga0163162_100164165 | 250 |
| 35 | 3300025901 | Ga0207688_10106286 | Ga0207688_101062863 | 250 |
| 36 | 3300025908 | Ga0207643_10160174 | Ga0207643_101601741 | 250 |
| 37 | 3300025933 | Ga0207706_10038077 | Ga0207706_100380777 | 250 |
| 38 | 3300028379 | Ga0268266_10106950 | Ga0268266_101069503 | 250 |
| 39 | 3300045836 | Ga0466958_0296012 | Ga0466958_0296012_158_913 | 250 |
| 40 | 3300005331 | Ga0070670_100017295 | Ga0070670_1000172957 | 252 |
| 41 | 3300005344 | Ga0070661_100011043 | Ga0070661_1000110432 | 252 |
| 42 | 3300005366 | Ga0070659_100314956 | Ga0070659_1003149562 | 252 |
| 43 | 3300005618 | Ga0068864_100009341 | Ga0068864_1000093414 | 252 |
| 44 | 3300025901 | Ga0207688_10029515 | Ga0207688_100295152 | 252 |
| 45 | 3300025920 | Ga0207649_10005930 | Ga0207649_100059302 | 252 |
| 46 | 3300025925 | Ga0207650_10086201 | Ga0207650_100862013 | 252 |
| 47 | 3300025944 | Ga0207661_10397093 | Ga0207661_103970932 | 252 |
| 48 | 3300025945 | Ga0207679_10007755 | Ga0207679_100077557 | 252 |
| 49 | 3300025921 | Ga0207652_10119787 | Ga0207652_101197874 | 253 |
| 50 | 3300005364 | Ga0070673_100223071 | Ga0070673_1002230712 | 254 |
| 51 | 3300005530 | Ga0070679_100385904 | Ga0070679_1003859041 | 254 |
| 52 | 3300013100 | Ga0157373_10018611 | Ga0157373_100186113 | 254 |
| 53 | 3300013102 | Ga0157371_10179684 | Ga0157371_101796843 | 254 |
| 54 | 3300026121 | Ga0207683_10020037 | Ga0207683_100200375 | 254 |
| 55 | 3300037471 | Ga0395905_0306182 | Ga0395905_0306182_394_1161 | 254 |
| 56 | 3300048915 | Ga0496112_0388242 | Ga0496112_0388242_176_940 | 254 |
| 57 | 3300048916 | Ga0496113_0118438 | Ga0496113_0118438_1173_1937 | 254 |
| 58 | 3300005328 | Ga0070676_10090798 | Ga0070676_100907982 | 255 |
| 59 | 3300005334 | Ga0068869_100064603 | Ga0068869_1000646032 | 255 |
| 60 | 3300005543 | Ga0070672_100106615 | Ga0070672_1001066151 | 255 |
| 61 | 3300005545 | Ga0070695_100164006 | Ga0070695_1001640062 | 255 |
| 62 | 3300005563 | Ga0068855_100670241 | Ga0068855_1006702412 | 255 |
| 63 | 3300005718 | Ga0068866_10183489 | Ga0068866_101834891 | 255 |
| 64 | 3300009098 | Ga0105245_10418938 | Ga0105245_104189381 | 255 |
| 65 | 3300009148 | Ga0105243_10321188 | Ga0105243_103211881 | 255 |
| 66 | 3300025907 | Ga0207645_10218311 | Ga0207645_102183112 | 255 |
| 67 | 3300025933 | Ga0207706_10009641 | Ga0207706_100096413 | 255 |
| 68 | 3300025935 | Ga0207709_10440593 | Ga0207709_104405932 | 255 |
| 69 | 3300025942 | Ga0207689_10003382 | Ga0207689_100033828 | 255 |
| 70 | 3300025949 | Ga0207667_10589152 | Ga0207667_105891521 | 255 |
| 71 | 3300026035 | Ga0207703_10609809 | Ga0207703_106098091 | 255 |
| 72 | 3300005366 | Ga0070659_100009301 | Ga0070659_1000093017 | 256 |
| 73 | 3300005457 | Ga0070662_100132296 | Ga0070662_1001322962 | 256 |
| 74 | 3300005539 | Ga0068853_100490360 | Ga0068853_1004903602 | 256 |
| 75 | 3300025904 | Ga0207647_10009939 | Ga0207647_100099397 | 256 |
| 76 | 3300025932 | Ga0207690_10005748 | Ga0207690_100057487 | 256 |
| 77 | 3300025933 | Ga0207706_10050293 | Ga0207706_100502933 | 256 |
| 78 | 3300005338 | Ga0068868_100633618 | Ga0068868_1006336181 | 257 |
| 79 | 3300005364 | Ga0070673_100047163 | Ga0070673_1000471632 | 257 |
| 80 | 3300005366 | Ga0070659_100017167 | Ga0070659_1000171676 | 257 |
| 81 | 3300005457 | Ga0070662_100180196 | Ga0070662_1001801962 | 257 |
| 82 | 3300005347 | Ga0070668_100313322 | Ga0070668_1003133221 | 258 |
| 83 | 3300005356 | Ga0070674_100056446 | Ga0070674_1000564463 | 258 |
| 84 | 3300005578 | Ga0068854_100102264 | Ga0068854_1001022642 | 259 |
| 85 | 3300025981 | Ga0207640_10483990 | Ga0207640_104839902 | 259 |
| 86 | 3300044694 | Ga0466963_0013039 | Ga0466963_0013039_548_1336 | 260 |
| 87 | 3300045976 | Ga0466967_0031473 | Ga0466967_0031473_3377_4165 | 260 |
| 88 | 3300049583 | Ga0501067_0064374 | Ga0501067_0064374_417_1205 | 260 |
| 89 | 3300005329 | Ga0070683_100147146 | Ga0070683_1001471462 | 261 |
| 90 | 3300005355 | Ga0070671_100080439 | Ga0070671_1000804392 | 261 |
| 91 | 3300025904 | Ga0207647_10010665 | Ga0207647_100106655 | 261 |
| 92 | 3300037418 | Ga0395900_0133385 | Ga0395900_0133385_400_1191 | 261 |
| 93 | 3300037471 | Ga0395905_0085890 | Ga0395905_0085890_661_1452 | 261 |
| 94 | 3300038443 | Ga0395901_0255936 | Ga0395901_0255936_633_1424 | 261 |
| 95 | 3300046616 | Ga0495668_0003092 | Ga0495668_0003092_915_1703 | 261 |
| 96 | 3300046684 | Ga0495669_0005217 | Ga0495669_0005217_986_1774 | 261 |
| 97 | 3300047470 | Ga0495681_0100647 | Ga0495681_0100647_82_870 | 261 |
| 98 | 3300001990 | JGI24737J22298_10002202 | JGI24737J22298_100022024 | 262 |
| 99 | 3300003322 | rootL2_10261103 | rootL2_102611032 | 262 |
| 100 | 3300005331 | Ga0070670_100030989 | Ga0070670_1000309892 | 262 |
| 101 | 3300005354 | Ga0070675_100430049 | Ga0070675_1004300491 | 262 |
| 102 | 3300005355 | Ga0070671_100000469 | Ga0070671_1000004697 | 262 |
| 103 | 3300005366 | Ga0070659_100195334 | Ga0070659_1001953342 | 262 |
| 104 | 3300005563 | Ga0068855_100374978 | Ga0068855_1003749782 | 262 |
| 105 | 3300005564 | Ga0070664_100007759 | Ga0070664_1000077595 | 262 |
| 106 | 3300005564 | Ga0070664_100143617 | Ga0070664_1001436173 | 262 |
| 107 | 3300005577 | Ga0068857_100023192 | Ga0068857_1000231925 | 262 |
| 108 | 3300005618 | Ga0068864_100009951 | Ga0068864_1000099514 | 262 |
| 109 | 3300005618 | Ga0068864_100012325 | Ga0068864_1000123253 | 262 |
| 110 | 3300005841 | Ga0068863_100029615 | Ga0068863_1000296154 | 262 |
| 111 | 3300009177 | Ga0105248_10000928 | Ga0105248_1000092812 | 262 |
| 112 | 3300011119 | Ga0105246_10093013 | Ga0105246_100930132 | 262 |
| 113 | 3300025919 | Ga0207657_10020235 | Ga0207657_100202355 | 262 |
| 114 | 3300025926 | Ga0207659_10458351 | Ga0207659_104583512 | 262 |
| 115 | 3300025931 | Ga0207644_10000514 | Ga0207644_100005142 | 262 |
| 116 | 3300025931 | Ga0207644_10035954 | Ga0207644_100359545 | 262 |
| 117 | 3300025931 | Ga0207644_10220391 | Ga0207644_102203911 | 262 |
| 118 | 3300025932 | Ga0207690_10009409 | Ga0207690_100094093 | 262 |
| 119 | 3300025932 | Ga0207690_10158486 | Ga0207690_101584862 | 262 |
| 120 | 3300025941 | Ga0207711_10000243 | Ga0207711_1000024342 | 262 |
| 121 | 3300025941 | Ga0207711_10027882 | Ga0207711_100278826 | 262 |
| 122 | 3300025945 | Ga0207679_10126646 | Ga0207679_101266461 | 262 |
| 123 | 3300025960 | Ga0207651_10151816 | Ga0207651_101518162 | 262 |
| 124 | 3300026023 | Ga0207677_10601690 | Ga0207677_106016901 | 262 |
| 125 | 3300026095 | Ga0207676_10004053 | Ga0207676_1000405312 | 262 |
| 126 | 3300026095 | Ga0207676_10061220 | Ga0207676_100612205 | 262 |
| 127 | 3300026116 | Ga0207674_10000491 | Ga0207674_1000049118 | 262 |
| 128 | 3300037471 | Ga0395905_0097492 | Ga0395905_0097492_894_1688 | 262 |
| 129 | 3300039437 | Ga0436365_1490276 | Ga0436365_1490276_15210_16004 | 262 |
| 130 | 3300044684 | Ga0466966_0016309 | Ga0466966_0016309_3317_4111 | 262 |
| 131 | 3300046525 | Ga0495663_0017570 | Ga0495663_0017570_340_1134 | 262 |
| 132 | 3300048903 | Ga0496100_0058481 | Ga0496100_0058481_1283_2077 | 262 |
| 133 | 3300048904 | Ga0496101_0020972 | Ga0496101_0020972_2431_3225 | 262 |
| 134 | 3300048909 | Ga0496106_0000666 | Ga0496106_0000666_15922_16716 | 262 |
| 135 | 3300048910 | Ga0496107_0000181 | Ga0496107_0000181_7687_8481 | 262 |
| 136 | 3300048911 | Ga0496108_0006821 | Ga0496108_0006821_6293_7087 | 262 |
| 137 | 3300048912 | Ga0496109_0000774 | Ga0496109_0000774_18144_18938 | 262 |
| 138 | 3300048912 | Ga0496109_0049252 | Ga0496109_0049252_878_1669 | 262 |
| 139 | 3300048914 | Ga0496111_0001460 | Ga0496111_0001460_7338_8132 | 262 |
| 140 | 3300048915 | Ga0496112_0000354 | Ga0496112_0000354_21083_21877 | 262 |
| 141 | 3300048916 | Ga0496113_0004786 | Ga0496113_0004786_3746_4540 | 262 |
| 142 | 3300005327 | Ga0070658_10017445 | Ga0070658_100174454 | 263 |
| 143 | 3300005327 | Ga0070658_10049473 | Ga0070658_100494735 | 263 |
| 144 | 3300005329 | Ga0070683_100099747 | Ga0070683_1000997472 | 263 |
| 145 | 3300005336 | Ga0070680_100118910 | Ga0070680_1001189103 | 263 |
| 146 | 3300005366 | Ga0070659_100213306 | Ga0070659_1002133062 | 263 |
| 147 | 3300005435 | Ga0070714_100040757 | Ga0070714_1000407575 | 263 |
| 148 | 3300005436 | Ga0070713_100297282 | Ga0070713_1002972822 | 263 |
| 149 | 3300005436 | Ga0070713_100367284 | Ga0070713_1003672841 | 263 |
| 150 | 3300005458 | Ga0070681_10312263 | Ga0070681_103122631 | 263 |
| 151 | 3300005530 | Ga0070679_100186707 | Ga0070679_1001867072 | 263 |
| 152 | 3300005539 | Ga0068853_100828412 | Ga0068853_1008284121 | 263 |
| 153 | 3300005543 | Ga0070672_100311857 | Ga0070672_1003118571 | 263 |
| 154 | 3300005614 | Ga0068856_100381642 | Ga0068856_1003816422 | 263 |
| 155 | 3300005614 | Ga0068856_100464267 | Ga0068856_1004642671 | 263 |
| 156 | 3300006175 | Ga0070712_100007509 | Ga0070712_1000075094 | 263 |
| 157 | 3300006358 | Ga0068871_100064519 | Ga0068871_1000645194 | 263 |
| 158 | 3300009176 | Ga0105242_10809640 | Ga0105242_108096401 | 263 |
| 159 | 3300013104 | Ga0157370_10228670 | Ga0157370_102286703 | 263 |
| 160 | 3300013306 | Ga0163162_10206863 | Ga0163162_102068633 | 263 |
| 161 | 3300013307 | Ga0157372_10372260 | Ga0157372_103722602 | 263 |
| 162 | 3300013307 | Ga0157372_10472996 | Ga0157372_104729962 | 263 |
| 163 | 3300025909 | Ga0207705_10005854 | Ga0207705_1000585410 | 263 |
| 164 | 3300025915 | Ga0207693_10034892 | Ga0207693_100348922 | 263 |
| 165 | 3300025917 | Ga0207660_10106899 | Ga0207660_101068993 | 263 |
| 166 | 3300025919 | Ga0207657_10051628 | Ga0207657_100516285 | 263 |
| 167 | 3300025920 | Ga0207649_10016532 | Ga0207649_100165325 | 263 |
| 168 | 3300025920 | Ga0207649_10176976 | Ga0207649_101769761 | 263 |
| 169 | 3300025921 | Ga0207652_10031744 | Ga0207652_100317443 | 263 |
| 170 | 3300025931 | Ga0207644_10304764 | Ga0207644_103047641 | 263 |
| 171 | 3300025944 | Ga0207661_10216830 | Ga0207661_102168302 | 263 |
| 172 | 3300025972 | Ga0207668_10276514 | Ga0207668_102765142 | 263 |
| 173 | 3300026078 | Ga0207702_10149848 | Ga0207702_101498481 | 263 |
| 174 | 3300031901 | Ga0307406_10521758 | Ga0307406_105217581 | 263 |
| 175 | 3300032002 | Ga0307416_100050621 | Ga0307416_1000506215 | 263 |
| 176 | 3300032126 | Ga0307415_100010002 | Ga0307415_1000100028 | 263 |
| 177 | 3300037312 | Ga0395899_0000632 | Ga0395899_0000632_17387_18184 | 263 |
| 178 | 3300037312 | Ga0395899_0055527 | Ga0395899_0055527_345_1142 | 263 |
| 179 | 3300037418 | Ga0395900_0000075 | Ga0395900_0000075_57871_58668 | 263 |
| 180 | 3300037418 | Ga0395900_0021708 | Ga0395900_0021708_583_1380 | 263 |
| 181 | 3300037418 | Ga0395900_0134921 | Ga0395900_0134921_178_975 | 263 |
| 182 | 3300037418 | Ga0395900_0211257 | Ga0395900_0211257_140_937 | 263 |
| 183 | 3300037418 | Ga0395900_0275117 | Ga0395900_0275117_173_970 | 263 |
| 184 | 3300037466 | Ga0395898_0000055 | Ga0395898_0000055_128170_128967 | 263 |
| 185 | 3300037466 | Ga0395898_0043490 | Ga0395898_0043490_3121_3918 | 263 |
| 186 | 3300037466 | Ga0395898_0056757 | Ga0395898_0056757_1434_2231 | 263 |
| 187 | 3300037466 | Ga0395898_0247013 | Ga0395898_0247013_618_1412 | 263 |
| 188 | 3300037466 | Ga0395898_0372844 | Ga0395898_0372844_450_1247 | 263 |
| 189 | 3300037471 | Ga0395905_0000067 | Ga0395905_0000067_149591_150388 | 263 |
| 190 | 3300037471 | Ga0395905_0015171 | Ga0395905_0015171_3998_4795 | 263 |
| 191 | 3300037471 | Ga0395905_0052149 | Ga0395905_0052149_330_1127 | 263 |
| 192 | 3300037471 | Ga0395905_0091138 | Ga0395905_0091138_1648_2445 | 263 |
| 193 | 3300037471 | Ga0395905_0114122 | Ga0395905_0114122_506_1300 | 263 |
| 194 | 3300037471 | Ga0395905_0287613 | Ga0395905_0287613_389_1186 | 263 |
| 195 | 3300037471 | Ga0395905_0412993 | Ga0395905_0412993_293_1090 | 263 |
| 196 | 3300038443 | Ga0395901_0000477 | Ga0395901_0000477_30959_31756 | 263 |
| 197 | 3300038443 | Ga0395901_0008531 | Ga0395901_0008531_5207_6004 | 263 |
| 198 | 3300038443 | Ga0395901_0021848 | Ga0395901_0021848_875_1672 | 263 |
| 199 | 3300038443 | Ga0395901_0023986 | Ga0395901_0023986_3548_4345 | 263 |
| 200 | 3300038443 | Ga0395901_0306843 | Ga0395901_0306843_830_1627 | 263 |
| 201 | 3300038443 | Ga0395901_0518519 | Ga0395901_0518519_172_969 | 263 |
| 202 | 3300044684 | Ga0466966_0126302 | Ga0466966_0126302_211_1005 | 263 |
| 203 | 3300044693 | Ga0466961_0012177 | Ga0466961_0012177_3290_4087 | 263 |
| 204 | 3300044693 | Ga0466961_0124631 | Ga0466961_0124631_116_910 | 263 |
| 205 | 3300044719 | Ga0466971_0098877 | Ga0466971_0098877_262_1059 | 263 |
| 206 | 3300045049 | Ga0466959_0012314 | Ga0466959_0012314_4804_5598 | 263 |
| 207 | 3300045049 | Ga0466959_0084504 | Ga0466959_0084504_856_1653 | 263 |
| 208 | 3300045836 | Ga0466958_0088039 | Ga0466958_0088039_626_1420 | 263 |
| 209 | 3300046525 | Ga0495663_0003630 | Ga0495663_0003630_211_1005 | 263 |
| 210 | 3300046528 | Ga0495642_0119564 | Ga0495642_0119564_270_1064 | 263 |
| 211 | 3300046539 | Ga0495621_0018975 | Ga0495621_0018975_1179_1973 | 263 |
| 212 | 3300046684 | Ga0495669_0031878 | Ga0495669_0031878_1086_1880 | 263 |
| 213 | 3300046684 | Ga0495669_0068637 | Ga0495669_0068637_265_1059 | 263 |
| 214 | 3300048915 | Ga0496112_0462885 | Ga0496112_0462885_39_836 | 263 |
| 215 | 3300009177 | Ga0105248_10158526 | Ga0105248_101585264 | 265 |
| 216 | 3300048915 | Ga0496112_0145862 | Ga0496112_0145862_1201_2004 | 265 |
| 217 | 3300001979 | JGI24740J21852_10012184 | JGI24740J21852_100121846 | 266 |
| 218 | 3300005344 | Ga0070661_100057726 | Ga0070661_1000577264 | 266 |
| 219 | 3300005355 | Ga0070671_100002772 | Ga0070671_10000277214 | 266 |
| 220 | 3300005356 | Ga0070674_100150430 | Ga0070674_1001504303 | 266 |
| 221 | 3300005436 | Ga0070713_100011624 | Ga0070713_1000116245 | 266 |
| 222 | 3300005436 | Ga0070713_100078197 | Ga0070713_1000781972 | 266 |
| 223 | 3300005455 | Ga0070663_100113066 | Ga0070663_1001130663 | 266 |
| 224 | 3300005457 | Ga0070662_100129194 | Ga0070662_1001291943 | 266 |
| 225 | 3300005539 | Ga0068853_100212876 | Ga0068853_1002128761 | 266 |
| 226 | 3300005539 | Ga0068853_100417748 | Ga0068853_1004177481 | 266 |
| 227 | 3300005564 | Ga0070664_100044815 | Ga0070664_1000448154 | 266 |
| 228 | 3300005616 | Ga0068852_100224911 | Ga0068852_1002249112 | 266 |
| 229 | 3300005834 | Ga0068851_10034950 | Ga0068851_100349502 | 266 |
| 230 | 3300006028 | Ga0070717_10037096 | Ga0070717_100370963 | 266 |
| 231 | 3300006028 | Ga0070717_10065564 | Ga0070717_100655642 | 266 |
| 232 | 3300006175 | Ga0070712_100012808 | Ga0070712_1000128082 | 266 |
| 233 | 3300013100 | Ga0157373_10323615 | Ga0157373_103236151 | 266 |
| 234 | 3300025909 | Ga0207705_10007385 | Ga0207705_100073858 | 266 |
| 235 | 3300025909 | Ga0207705_10018338 | Ga0207705_100183386 | 266 |
| 236 | 3300025915 | Ga0207693_10005058 | Ga0207693_1000505813 | 266 |
| 237 | 3300025919 | Ga0207657_10000868 | Ga0207657_1000086825 | 266 |
| 238 | 3300025919 | Ga0207657_10049591 | Ga0207657_100495916 | 266 |
| 239 | 3300025920 | Ga0207649_10105961 | Ga0207649_101059612 | 266 |
| 240 | 3300025924 | Ga0207694_10385914 | Ga0207694_103859141 | 266 |
| 241 | 3300025929 | Ga0207664_10266925 | Ga0207664_102669252 | 266 |
| 242 | 3300025929 | Ga0207664_10283087 | Ga0207664_102830872 | 266 |
| 243 | 3300025931 | Ga0207644_10014169 | Ga0207644_100141698 | 266 |
| 244 | 3300025932 | Ga0207690_10034434 | Ga0207690_100344343 | 266 |
| 245 | 3300025933 | Ga0207706_10017849 | Ga0207706_100178497 | 266 |
| 246 | 3300025933 | Ga0207706_10100630 | Ga0207706_101006304 | 266 |
| 247 | 3300025945 | Ga0207679_10020130 | Ga0207679_100201305 | 266 |
| 248 | 3300026067 | Ga0207678_10031905 | Ga0207678_100319057 | 266 |
| 249 | 3300026116 | Ga0207674_10011384 | Ga0207674_100113847 | 266 |
| 250 | 3300037471 | Ga0395905_0255207 | Ga0395905_0255207_495_1349 | 266 |
| 251 | 3300037471 | Ga0395905_0479587 | Ga0395905_0479587_267_1121 | 266 |
| 252 | 3300038443 | Ga0395901_0260028 | Ga0395901_0260028_121_957 | 266 |
| 253 | 3300044719 | Ga0466971_0015953 | Ga0466971_0015953_80_964 | 266 |
| 254 | 3300045976 | Ga0466967_0369106 | Ga0466967_0369106_512_1366 | 266 |
| 255 | 3300001915 | JGI24741J21665_1002071 | JGI24741J21665_10020714 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o65-assembly1.cif.gz_A | crystal structure of the pseudomonas functional amyloid secretion protein fapf | 0.8511 | 47 | 262 |
| 5o65-assembly1.cif.gz_C | crystal structure of the pseudomonas functional amyloid secretion protein fapf | 0.8377 | 47 | 262 |
| 5o68-assembly1.cif.gz_A | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.8196 | 45 | 262 |
| 5o67-assembly1.cif.gz_A | crystal structure of the fapf polypeptide transporter - f103a mutant | 0.8168 | 43 | 262 |
| 5o68-assembly3.cif.gz_G | crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant | 0.8163 | 44 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.7045 | 54 | 265 | 2.40.160.40 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6933 | 54 | 265 | 2.40.160.40 |
| 5ig0A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.685 | 151 | 201 | 3.10.450.50 |
| 2av9A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.6719 | 224 | 263 | 3.10.129.10 |
| af_P76773_24_229_2.40.160.40 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6613 | 48 | 262 | 2.40.160.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1P276-F1-model_v4 | Transporter | 0.9539 | 42 | 264 |
|
| AF-A0A2H0PJ47-F1-model_v4 | Transporter | 0.9485 | 25 | 263 |
|
| AF-A0A7W9EI41-F1-model_v4 | Transporter | 0.9406 | 18 | 264 |
|
| AF-A0A2E3Q4D8-F1-model_v4 | Transporter | 0.9398 | 26 | 264 |
|
| AF-A0A7W7YE19-F1-model_v4 | Transporter | 0.9362 | 24 | 264 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar