F365966

General Info

Members Datasets Scaffolds Average Seq Length
255 157 510 241

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0046740|Ga0495613_0046740_2218_3027
Length 269
Sequence MRAETATLEVRIGHPFRDQELLHRALTHSSLANETRSAGGETIADNEQLEFLGDSILGFLVSEALVRRRPEHREGELSRQKAHLVSAAHLYGVARRLDLGSFLEIGRSEEMSGGRAKKTLLVDGLEALIAALYLDAGIDTVREFVLTHILDAPFSGDEDAGTDIQPAITNFKSALQELAQSRKLAQPRYSIVREQGPEHSKTFTVEVRIGKDCTGQAEGRTKKVAAQRAARAVYERLLNGDALTHEEAPEEERPKSAPEGPEKLAPEGR

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 36.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0046740 3300046689 Unclassified 3200
2 Ga0070676_10081316 3300005328 Unclassified 1966
3 Ga0070683_100000030 3300005329 Bacteria 152931
4 Ga0070683_100005631 3300005329 Bacteria 10467
5 Ga0070683_100360497 3300005329 Unclassified 1384
6 Ga0070670_100127281 3300005331 Bacteria 2199
7 Ga0068869_100024701 3300005334 Unclassified 4164
8 Ga0070680_100078187 3300005336 Unclassified 2725
9 Ga0068868_100600425 3300005338 Unclassified 975
10 Ga0070689_100061331 3300005340 Bacteria 2925
11 Ga0070692_10031333 3300005345 Unclassified 2665
12 Ga0070673_100026436 3300005364 Bacteria 4287
13 Ga0070667_100171021 3300005367 Unclassified 1918
14 Ga0070667_100459561 3300005367 Unclassified 1164
15 Ga0070713_100475034 3300005436 Bacteria 1177
16 Ga0070711_100338420 3300005439 Bacteria 1207
17 Ga0070663_100080493 3300005455 Bacteria 2392
18 Ga0070678_100051423 3300005456 Bacteria 2987
19 Ga0070681_10004846 3300005458 Bacteria 12902
20 Ga0070681_10125527 3300005458 Bacteria 2499
21 Ga0070681_10809558 3300005458 Bacteria 854
22 Ga0068867_100075832 3300005459 Bacteria 2523
23 Ga0070698_100654308 3300005471 Unclassified 992
24 Ga0070684_100000041 3300005535 Bacteria 92959
25 Ga0070684_100041883 3300005535 Unclassified 3951
26 Ga0070684_100140718 3300005535 Bacteria 2182
27 Ga0070684_100356628 3300005535 Unclassified 1345
28 Ga0070697_100059104 3300005536 Unclassified 3121
29 Ga0070695_100046861 3300005545 Bacteria 2759
30 Ga0070693_100082177 3300005547 Unclassified 1923
31 Ga0070665_100080640 3300005548 Bacteria 3260
32 Ga0070665_100143207 3300005548 Bacteria 2393
33 Ga0070665_100228668 3300005548 Bacteria 1860
34 Ga0068855_100002865 3300005563 Bacteria 21186
35 Ga0068855_100094175 3300005563 Bacteria 3454
36 Ga0068855_100110001 3300005563 Bacteria 3164
37 Ga0068855_100390074 3300005563 Bacteria 1527
38 Ga0068857_100007159 3300005577 Bacteria 9610
39 Ga0068857_100484775 3300005577 Unclassified 1159
40 Ga0068854_100224986 3300005578 Unclassified 1486
41 Ga0068856_100014960 3300005614 Bacteria 7493
42 Ga0068856_100135483 3300005614 Bacteria 2468
43 Ga0068852_100631596 3300005616 Unclassified 1077
44 Ga0068859_100055761 3300005617 Bacteria 3976
45 Ga0068864_100205539 3300005618 Bacteria 1811
46 Ga0068866_10371554 3300005718 Unclassified 914
47 Ga0068851_10022312 3300005834 Bacteria 3082
48 Ga0068863_100470541 3300005841 Unclassified 1235
49 Ga0068858_100301362 3300005842 Unclassified 1529
50 Ga0068860_100039211 3300005843 Bacteria 4531
51 Ga0068860_100057508 3300005843 Bacteria 3697
52 Ga0070717_10003399 3300006028 Bacteria 11387
53 Ga0070717_10024035 3300006028 Bacteria 4836
54 Ga0070717_10029200 3300006028 Bacteria 4421
55 Ga0070715_10152742 3300006163 Bacteria 1133
56 Ga0097621_100043012 3300006237 Unclassified 3641
57 Ga0097621_100255668 3300006237 Unclassified 1535
58 Ga0068871_100016488 3300006358 Bacteria 5566
59 Ga0068871_100058716 3300006358 Bacteria 3133
60 Ga0075428_100423903 3300006844 Bacteria 1426
61 Ga0068865_100619707 3300006881 Unclassified 916
62 Ga0075436_100003800 3300006914 Bacteria 10358
63 Ga0097620_100055762 3300006931 Bacteria 3976
64 Ga0075435_100447844 3300007076 Bacteria 1113
65 Ga0105240_10002840 3300009093 Bacteria 27375
66 Ga0105240_10019034 3300009093 Bacteria 9184
67 Ga0105240_10041513 3300009093 Bacteria 5871
68 Ga0105240_10041982 3300009093 Bacteria 5832
69 Ga0105240_10109049 3300009093 Unclassified 3353
70 Ga0105240_10230372 3300009093 Bacteria 2153
71 Ga0105240_10400036 3300009093 Bacteria 1547
72 Ga0111539_10358618 3300009094 Bacteria 1697
73 Ga0105245_10027460 3300009098 Bacteria 5015
74 Ga0105245_10117924 3300009098 Bacteria 2476
75 Ga0105245_10292233 3300009098 Bacteria 1596
76 Ga0105243_10021158 3300009148 Bacteria 4936
77 Ga0105243_10058927 3300009148 Bacteria 3062
78 Ga0105243_10606108 3300009148 Unclassified 1055
79 Ga0105241_10008015 3300009174 Bacteria 7771
80 Ga0105242_10019915 3300009176 Bacteria 5255
81 Ga0105242_10171736 3300009176 Unclassified 1906
82 Ga0105242_10339144 3300009176 Unclassified 1385
83 Ga0105248_10054815 3300009177 Unclassified 4472
84 Ga0105248_10212170 3300009177 Unclassified 2181
85 Ga0105248_10216946 3300009177 Unclassified 2155
86 Ga0105237_10112324 3300009545 Bacteria 2717
87 Ga0105237_10152040 3300009545 Bacteria 2311
88 Ga0105237_10432715 3300009545 Bacteria 1321
89 Ga0105238_10040782 3300009551 Bacteria 4703
90 Ga0105238_10059875 3300009551 Unclassified 3814
91 Ga0105238_10240033 3300009551 Bacteria 1790
92 Ga0105238_10377922 3300009551 Unclassified 1408
93 Ga0105249_10088909 3300009553 Unclassified 2886
94 Ga0105239_10008697 3300010375 Bacteria 11494
95 Ga0105239_10047919 3300010375 Unclassified 4683
96 Ga0105239_10867148 3300010375 Unclassified 1036
97 Ga0105246_10058949 3300011119 Unclassified 2662
98 Ga0105246_10446338 3300011119 Unclassified 1086
99 Ga0157370_10122157 3300013104 Bacteria 2432
100 Ga0157370_10699386 3300013104 Bacteria 925
101 Ga0157369_10065394 3300013105 Unclassified 3913
102 Ga0157374_10057122 3300013296 Bacteria 3644
103 Ga0157374_10360462 3300013296 Bacteria 1446
104 Ga0157378_10035143 3300013297 Bacteria 4432
105 Ga0157372_10008258 3300013307 Bacteria 11070
106 Ga0157372_10050979 3300013307 Unclassified 4605
107 Ga0157372_10366855 3300013307 Bacteria 1678
108 Ga0157375_10839193 3300013308 Unclassified 1066
109 Ga0157376_10224811 3300014969 Unclassified 1740
110 Ga0157376_10935123 3300014969 Unclassified 887
111 Ga0197907_10064820 3300020069 Bacteria 3726
112 Ga0206349_1073396 3300020075 Bacteria 2750
113 Ga0213875_10030413 3300021388 Bacteria 2556
114 Ga0213875_10042242 3300021388 Unclassified 2142
115 Ga0213875_10099419 3300021388 Bacteria 1358
116 Ga0213875_10108965 3300021388 Bacteria 1293
117 Ga0224712_10015385 3300022467 Bacteria 2488
118 Ga0207656_10085190 3300025321 Unclassified 1426
119 Ga0207645_10356673 3300025907 Bacteria 979
120 Ga0207654_10031877 3300025911 Unclassified 2907
121 Ga0207654_10066571 3300025911 Bacteria 2125
122 Ga0207707_10064489 3300025912 Bacteria 3189
123 Ga0207695_10084129 3300025913 Bacteria 3212
124 Ga0207695_10182055 3300025913 Bacteria 2022
125 Ga0207695_10448277 3300025913 Unclassified 1174
126 Ga0207660_10195590 3300025917 Bacteria 1577
127 Ga0207652_10023185 3300025921 Bacteria 5140
128 Ga0207694_10060404 3300025924 Bacteria 2950
129 Ga0207694_10373195 3300025924 Unclassified 1183
130 Ga0207687_10001399 3300025927 Bacteria 16469
131 Ga0207644_10046500 3300025931 Unclassified 3093
132 Ga0207686_10089575 3300025934 Bacteria 2028
133 Ga0207686_10102661 3300025934 Unclassified 1912
134 Ga0207709_10046512 3300025935 Bacteria 2634
135 Ga0207670_10026724 3300025936 Bacteria 3641
136 Ga0207691_10343319 3300025940 Unclassified 1278
137 Ga0207711_10009284 3300025941 Bacteria 8212
138 Ga0207689_10049869 3300025942 Unclassified 3454
139 Ga0207689_10084655 3300025942 Bacteria 2606
140 Ga0207661_10000035 3300025944 Bacteria 152976
141 Ga0207661_10086069 3300025944 Unclassified 2607
142 Ga0207661_10118265 3300025944 Bacteria 2252
143 Ga0207679_10099486 3300025945 Unclassified 2271
144 Ga0207667_10092483 3300025949 Bacteria 3123
145 Ga0207667_10450017 3300025949 Bacteria 1309
146 Ga0207712_10569979 3300025961 Unclassified 976
147 Ga0207640_10146434 3300025981 Unclassified 1729
148 Ga0207658_10165955 3300025986 Unclassified 1814
149 Ga0207703_10089481 3300026035 Unclassified 2585
150 Ga0207703_10136346 3300026035 Bacteria 2125
151 Ga0207639_10062898 3300026041 Unclassified 2872
152 Ga0207678_10104408 3300026067 Bacteria 2418
153 Ga0207702_10141097 3300026078 Bacteria 2180
154 Ga0207641_10280104 3300026088 Unclassified 1568
155 Ga0207676_10428579 3300026095 Unclassified 1242
156 Ga0207674_10002518 3300026116 Bacteria 23097
157 Ga0207674_10546986 3300026116 Unclassified 1118
158 Ga0207683_10037523 3300026121 Bacteria 4220
159 Ga0268266_10351250 3300028379 Bacteria 1386
160 Ga0268266_10521419 3300028379 Bacteria 1136
161 Ga0268264_10076601 3300028381 Bacteria 2846
162 Ga0268264_10252905 3300028381 Unclassified 1638
163 Ga0265323_10001909 3300028653 Bacteria 9825
164 Ga0265330_10048733 3300031235 Bacteria 1863
165 Ga0265325_10121759 3300031241 Unclassified 1257
166 Ga0265331_10127920 3300031250 Bacteria 1160
167 Ga0265327_10007764 3300031251 Bacteria 8188
168 Ga0265316_10003166 3300031344 Bacteria 16740
169 Ga0265316_10009699 3300031344 Bacteria 8837
170 Ga0265316_10017640 3300031344 Bacteria 6159
171 Ga0265316_10035692 3300031344 Bacteria 4026
172 Ga0265314_10270297 3300031711 Unclassified 966
173 Ga0265342_10011653 3300031712 Bacteria 6000
174 Ga0373934_0040709 3300035086 Bacteria 1833
175 Ga0373940_0142579 3300035088 Bacteria 758
176 Ga0373923_0095554 3300035111 Unclassified 1305
177 Ga0373956_0030232 3300035119 Unclassified 2366
178 Ga0373955_0173892 3300035172 Unclassified 1276
179 Ga0373935_0058193 3300035692 Unclassified 2468
180 Ga0373935_0068426 3300035692 Bacteria 2285
181 Ga0373927_0001252 3300035695 Bacteria 19261
182 Ga0373927_0050870 3300035695 Bacteria 2680
183 Ga0373933_0100983 3300035724 Unclassified 1790
184 Ga0373947_0179503 3300035725 Bacteria 1378
185 Ga0373937_0002483 3300036401 Bacteria 15327
186 Ga0373937_0008911 3300036401 Bacteria 8710
187 Ga0373937_0042958 3300036401 Unclassified 4126
188 Ga0373937_0163120 3300036401 Bacteria 2090
189 Ga0373937_0492737 3300036401 Bacteria 1164
190 Ga0373925_0093720 3300037068 Unclassified 2299
191 Ga0373925_0131699 3300037068 Bacteria 1950
192 Ga0436364_0010541 3300037853 Unclassified 3939
193 Ga0436364_0742075 3300037853 Bacteria 6403
194 Ga0436364_1118774 3300037853 Bacteria 2713
195 Ga0436364_1392870 3300037853 Unclassified 2927
196 Ga0436364_1466258 3300037853 Bacteria 1619
197 Ga0436365_0507194 3300039437 Bacteria 6250
198 Ga0436365_1461184 3300039437 Unclassified 1644
199 Ga0436362_0440173 3300039453 Bacteria 5580
200 Ga0451577_0322447 3300042876 Bacteria 1401
201 Ga0466969_0150434 3300044656 Unclassified 1073
202 Ga0451576_0033219 3300045051 Bacteria 5485
203 Ga0451576_0210968 3300045051 Bacteria 2028
204 Ga0451576_0731610 3300045051 Unclassified 1039
205 Ga0495592_0013823 3300046454 Bacteria 6137
206 Ga0495651_0043465 3300046462 Bacteria 3486
207 Ga0495580_0006742 3300046472 Bacteria 9318
208 Ga0495580_0007411 3300046472 Bacteria 8823
209 Ga0495580_0012266 3300046472 Bacteria 6580
210 Ga0495664_0012773 3300046477 Bacteria 4757
211 Ga0495628_0070854 3300046516 Bacteria 2717
212 Ga0495630_0051104 3300046517 Bacteria 3093
213 Ga0495630_0123472 3300046517 Unclassified 1965
214 Ga0495652_0075756 3300046529 Bacteria 2793
215 Ga0495652_0112533 3300046529 Unclassified 2187
216 Ga0495587_0007153 3300046536 Bacteria 7242
217 Ga0495587_0064464 3300046536 Unclassified 2141
218 Ga0495645_0001642 3300046543 Bacteria 15171
219 Ga0495645_0034723 3300046543 Bacteria 3677
220 Ga0495645_0096266 3300046543 Bacteria 2110
221 Ga0495667_0013233 3300046559 Bacteria 5587
222 Ga0495667_0089804 3300046559 Bacteria 1991
223 Ga0495667_0127482 3300046559 Unclassified 1642
224 Ga0495635_0316931 3300046663 Unclassified 1044
225 Ga0495599_0010394 3300046678 Bacteria 5694
226 Ga0495623_0049201 3300046679 Unclassified 2672
227 Ga0495623_0097360 3300046679 Bacteria 1797
228 Ga0495623_0224354 3300046679 Unclassified 1069
229 Ga0495646_0018094 3300046680 Bacteria 4463
230 Ga0495613_0343738 3300046689 Unclassified 1026
231 Ga0495604_0150845 3300047317 Bacteria 1652
232 Ga0495674_0003092 3300047319 Bacteria 16177
233 Ga0495674_0066366 3300047319 Bacteria 3131
234 Ga0495674_0334920 3300047319 Bacteria 1230
235 Ga0495680_0221883 3300047322 Bacteria 1349
236 Ga0495675_0059546 3300047444 Unclassified 2421
237 Ga0495675_0094483 3300047444 Bacteria 1875
238 Ga0495675_0105887 3300047444 Unclassified 1758
239 Ga0495602_0064212 3300048088 Bacteria 3176
240 Ga0495602_0335172 3300048088 Unclassified 1096
241 Ga0496102_0823691 3300048905 Unclassified 850
242 Ga0496112_0155460 3300048915 Unclassified 2254
243 Ga0501034_0052364 3300049571 Bacteria 4112
244 Ga0501037_0045791 3300049573 Unclassified 3210
245 Ga0501039_0457217 3300049575 Bacteria 1003
246 Ga0501046_0175343 3300049580 Bacteria 1606
247 Ga0501047_0004223 3300049581 Bacteria 13522
248 Ga0501047_0434119 3300049581 Bacteria 1144
249 Ga0501048_0031071 3300049582 Bacteria 3865
250 Ga0501070_0127099 3300049586 Unclassified 2106
251 Ga0501080_0013411 3300049742 Bacteria 7540
252 Ga0501035_0116759 3300049822 Bacteria 2335
253 Ga0501044_0026369 3300049823 Bacteria 6152
254 nmdc:mga08x19_40039_c1 3300050514 Unclassified 2982
255 Ga0501082_0000140 3300060353 Bacteria 59882
256 Ga0495613_0046740
257 Ga0070676_10081316
258 Ga0070683_100000030
259 Ga0070683_100005631
260 Ga0070683_100360497
261 Ga0070670_100127281
262 Ga0068869_100024701
263 Ga0070680_100078187
264 Ga0068868_100600425
265 Ga0070689_100061331
266 Ga0070692_10031333
267 Ga0070673_100026436
268 Ga0070667_100171021
269 Ga0070667_100459561
270 Ga0070713_100475034
271 Ga0070711_100338420
272 Ga0070663_100080493
273 Ga0070678_100051423
274 Ga0070681_10004846
275 Ga0070681_10125527
276 Ga0070681_10809558
277 Ga0068867_100075832
278 Ga0070698_100654308
279 Ga0070684_100000041
280 Ga0070684_100041883
281 Ga0070684_100140718
282 Ga0070684_100356628
283 Ga0070697_100059104
284 Ga0070695_100046861
285 Ga0070693_100082177
286 Ga0070665_100080640
287 Ga0070665_100143207
288 Ga0070665_100228668
289 Ga0068855_100002865
290 Ga0068855_100094175
291 Ga0068855_100110001
292 Ga0068855_100390074
293 Ga0068857_100007159
294 Ga0068857_100484775
295 Ga0068854_100224986
296 Ga0068856_100014960
297 Ga0068856_100135483
298 Ga0068852_100631596
299 Ga0068859_100055761
300 Ga0068864_100205539
301 Ga0068866_10371554
302 Ga0068851_10022312
303 Ga0068863_100470541
304 Ga0068858_100301362
305 Ga0068860_100039211
306 Ga0068860_100057508
307 Ga0070717_10003399
308 Ga0070717_10024035
309 Ga0070717_10029200
310 Ga0070715_10152742
311 Ga0097621_100043012
312 Ga0097621_100255668
313 Ga0068871_100016488
314 Ga0068871_100058716
315 Ga0075428_100423903
316 Ga0068865_100619707
317 Ga0075436_100003800
318 Ga0097620_100055762
319 Ga0075435_100447844
320 Ga0105240_10002840
321 Ga0105240_10019034
322 Ga0105240_10041513
323 Ga0105240_10041982
324 Ga0105240_10109049
325 Ga0105240_10230372
326 Ga0105240_10400036
327 Ga0111539_10358618
328 Ga0105245_10027460
329 Ga0105245_10117924
330 Ga0105245_10292233
331 Ga0105243_10021158
332 Ga0105243_10058927
333 Ga0105243_10606108
334 Ga0105241_10008015
335 Ga0105242_10019915
336 Ga0105242_10171736
337 Ga0105242_10339144
338 Ga0105248_10054815
339 Ga0105248_10212170
340 Ga0105248_10216946
341 Ga0105237_10112324
342 Ga0105237_10152040
343 Ga0105237_10432715
344 Ga0105238_10040782
345 Ga0105238_10059875
346 Ga0105238_10240033
347 Ga0105238_10377922
348 Ga0105249_10088909
349 Ga0105239_10008697
350 Ga0105239_10047919
351 Ga0105239_10867148
352 Ga0105246_10058949
353 Ga0105246_10446338
354 Ga0157370_10122157
355 Ga0157370_10699386
356 Ga0157369_10065394
357 Ga0157374_10057122
358 Ga0157374_10360462
359 Ga0157378_10035143
360 Ga0157372_10008258
361 Ga0157372_10050979
362 Ga0157372_10366855
363 Ga0157375_10839193
364 Ga0157376_10224811
365 Ga0157376_10935123
366 Ga0197907_10064820
367 Ga0206349_1073396
368 Ga0213875_10030413
369 Ga0213875_10042242
370 Ga0213875_10099419
371 Ga0213875_10108965
372 Ga0224712_10015385
373 Ga0207656_10085190
374 Ga0207645_10356673
375 Ga0207654_10031877
376 Ga0207654_10066571
377 Ga0207707_10064489
378 Ga0207695_10084129
379 Ga0207695_10182055
380 Ga0207695_10448277
381 Ga0207660_10195590
382 Ga0207652_10023185
383 Ga0207694_10060404
384 Ga0207694_10373195
385 Ga0207687_10001399
386 Ga0207644_10046500
387 Ga0207686_10089575
388 Ga0207686_10102661
389 Ga0207709_10046512
390 Ga0207670_10026724
391 Ga0207691_10343319
392 Ga0207711_10009284
393 Ga0207689_10049869
394 Ga0207689_10084655
395 Ga0207661_10000035
396 Ga0207661_10086069
397 Ga0207661_10118265
398 Ga0207679_10099486
399 Ga0207667_10092483
400 Ga0207667_10450017
401 Ga0207712_10569979
402 Ga0207640_10146434
403 Ga0207658_10165955
404 Ga0207703_10089481
405 Ga0207703_10136346
406 Ga0207639_10062898
407 Ga0207678_10104408
408 Ga0207702_10141097
409 Ga0207641_10280104
410 Ga0207676_10428579
411 Ga0207674_10002518
412 Ga0207674_10546986
413 Ga0207683_10037523
414 Ga0268266_10351250
415 Ga0268266_10521419
416 Ga0268264_10076601
417 Ga0268264_10252905
418 Ga0265323_10001909
419 Ga0265330_10048733
420 Ga0265325_10121759
421 Ga0265331_10127920
422 Ga0265327_10007764
423 Ga0265316_10003166
424 Ga0265316_10009699
425 Ga0265316_10017640
426 Ga0265316_10035692
427 Ga0265314_10270297
428 Ga0265342_10011653
429 Ga0373934_0040709
430 Ga0373940_0142579
431 Ga0373923_0095554
432 Ga0373956_0030232
433 Ga0373955_0173892
434 Ga0373935_0058193
435 Ga0373935_0068426
436 Ga0373927_0001252
437 Ga0373927_0050870
438 Ga0373933_0100983
439 Ga0373947_0179503
440 Ga0373937_0002483
441 Ga0373937_0008911
442 Ga0373937_0042958
443 Ga0373937_0163120
444 Ga0373937_0492737
445 Ga0373925_0093720
446 Ga0373925_0131699
447 Ga0436364_0010541
448 Ga0436364_0742075
449 Ga0436364_1118774
450 Ga0436364_1392870
451 Ga0436364_1466258
452 Ga0436365_0507194
453 Ga0436365_1461184
454 Ga0436362_0440173
455 Ga0451577_0322447
456 Ga0466969_0150434
457 Ga0451576_0033219
458 Ga0451576_0210968
459 Ga0451576_0731610
460 Ga0495592_0013823
461 Ga0495651_0043465
462 Ga0495580_0006742
463 Ga0495580_0007411
464 Ga0495580_0012266
465 Ga0495664_0012773
466 Ga0495628_0070854
467 Ga0495630_0051104
468 Ga0495630_0123472
469 Ga0495652_0075756
470 Ga0495652_0112533
471 Ga0495587_0007153
472 Ga0495587_0064464
473 Ga0495645_0001642
474 Ga0495645_0034723
475 Ga0495645_0096266
476 Ga0495667_0013233
477 Ga0495667_0089804
478 Ga0495667_0127482
479 Ga0495635_0316931
480 Ga0495599_0010394
481 Ga0495623_0049201
482 Ga0495623_0097360
483 Ga0495623_0224354
484 Ga0495646_0018094
485 Ga0495613_0343738
486 Ga0495604_0150845
487 Ga0495674_0003092
488 Ga0495674_0066366
489 Ga0495674_0334920
490 Ga0495680_0221883
491 Ga0495675_0059546
492 Ga0495675_0094483
493 Ga0495675_0105887
494 Ga0495602_0064212
495 Ga0495602_0335172
496 Ga0496102_0823691
497 Ga0496112_0155460
498 Ga0501034_0052364
499 Ga0501037_0045791
500 Ga0501039_0457217
501 Ga0501046_0175343
502 Ga0501047_0004223
503 Ga0501047_0434119
504 Ga0501048_0031071
505 Ga0501070_0127099
506 Ga0501080_0013411
507 Ga0501035_0116759
508 Ga0501044_0026369
509 nmdc:mga08x19_40039_c1
510 Ga0501082_0000140

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00035

dsrm

Double-stranded RNA binding motif

171

237

0.96

PF00636

Ribonuclease_3

Ribonuclease III domain

47

137

0.95

PF14622

Ribonucleas_3_3

Ribonuclease-III-like

18

152

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1di2-assembly1.cif.gz_A crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions 0.9631 175 242
3n3w-assembly1.cif.gz_B 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9493 3 161
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9389 3 158
1di2-assembly1.cif.gz_A crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions 0.9231 175 242
6htu-assembly1.cif.gz_B structure of hstau1 dsrbd3-4 in complex with arf1 rna 0.9229 175 243
ID Description Score Start End Superfamily
af_Q9VLW8_91_162_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9625 174 241 3.30.160.20
af_Q2FZ50_16_166_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9563 4 159 1.10.1520.10
af_P97473_17_105_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9529 175 243 3.30.160.20
af_Q7ZW47_303_388_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9513 174 242 3.30.160.20
af_Q9Z108_194_270_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9513 174 242 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A3D4I1L7-F1-model_v4 Ribonuclease III 0.9825 6 132 GO:0004525
GO:0006396
AF-A0A356E6B3-F1-model_v4 Ribonuclease III 0.9795 5 131 GO:0004525
GO:0006396
AF-A0A358D5I6-F1-model_v4 Ribonuclease III 0.9776 6 150 GO:0003723
GO:0004525
GO:0005737
GO:0030422
AF-A0A1G1JR72-F1-model_v4 RNase III domain-containing protein 0.9748 5 157 GO:0003723
GO:0004525
GO:0005737
GO:0030422
AF-A0A2V8U0U9-F1-model_v4 Ribonuclease III 0.9746 3 160 GO:0004525
GO:0006396

Map