F365966
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 157 | 510 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300046689|Ga0495613_0046740|Ga0495613_0046740_2218_3027 |
| Length | 269 |
| Sequence | MRAETATLEVRIGHPFRDQELLHRALTHSSLANETRSAGGETIADNEQLEFLGDSILGFLVSEALVRRRPEHREGELSRQKAHLVSAAHLYGVARRLDLGSFLEIGRSEEMSGGRAKKTLLVDGLEALIAALYLDAGIDTVREFVLTHILDAPFSGDEDAGTDIQPAITNFKSALQELAQSRKLAQPRYSIVREQGPEHSKTFTVEVRIGKDCTGQAEGRTKKVAAQRAARAVYERLLNGDALTHEEAPEEERPKSAPEGPEKLAPEGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 122 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 1.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.78 |
| Rhizosphere | 94.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495613_0046740 | 3300046689 | Unclassified | 3200 |
| 2 | Ga0070676_10081316 | 3300005328 | Unclassified | 1966 |
| 3 | Ga0070683_100000030 | 3300005329 | Bacteria | 152931 |
| 4 | Ga0070683_100005631 | 3300005329 | Bacteria | 10467 |
| 5 | Ga0070683_100360497 | 3300005329 | Unclassified | 1384 |
| 6 | Ga0070670_100127281 | 3300005331 | Bacteria | 2199 |
| 7 | Ga0068869_100024701 | 3300005334 | Unclassified | 4164 |
| 8 | Ga0070680_100078187 | 3300005336 | Unclassified | 2725 |
| 9 | Ga0068868_100600425 | 3300005338 | Unclassified | 975 |
| 10 | Ga0070689_100061331 | 3300005340 | Bacteria | 2925 |
| 11 | Ga0070692_10031333 | 3300005345 | Unclassified | 2665 |
| 12 | Ga0070673_100026436 | 3300005364 | Bacteria | 4287 |
| 13 | Ga0070667_100171021 | 3300005367 | Unclassified | 1918 |
| 14 | Ga0070667_100459561 | 3300005367 | Unclassified | 1164 |
| 15 | Ga0070713_100475034 | 3300005436 | Bacteria | 1177 |
| 16 | Ga0070711_100338420 | 3300005439 | Bacteria | 1207 |
| 17 | Ga0070663_100080493 | 3300005455 | Bacteria | 2392 |
| 18 | Ga0070678_100051423 | 3300005456 | Bacteria | 2987 |
| 19 | Ga0070681_10004846 | 3300005458 | Bacteria | 12902 |
| 20 | Ga0070681_10125527 | 3300005458 | Bacteria | 2499 |
| 21 | Ga0070681_10809558 | 3300005458 | Bacteria | 854 |
| 22 | Ga0068867_100075832 | 3300005459 | Bacteria | 2523 |
| 23 | Ga0070698_100654308 | 3300005471 | Unclassified | 992 |
| 24 | Ga0070684_100000041 | 3300005535 | Bacteria | 92959 |
| 25 | Ga0070684_100041883 | 3300005535 | Unclassified | 3951 |
| 26 | Ga0070684_100140718 | 3300005535 | Bacteria | 2182 |
| 27 | Ga0070684_100356628 | 3300005535 | Unclassified | 1345 |
| 28 | Ga0070697_100059104 | 3300005536 | Unclassified | 3121 |
| 29 | Ga0070695_100046861 | 3300005545 | Bacteria | 2759 |
| 30 | Ga0070693_100082177 | 3300005547 | Unclassified | 1923 |
| 31 | Ga0070665_100080640 | 3300005548 | Bacteria | 3260 |
| 32 | Ga0070665_100143207 | 3300005548 | Bacteria | 2393 |
| 33 | Ga0070665_100228668 | 3300005548 | Bacteria | 1860 |
| 34 | Ga0068855_100002865 | 3300005563 | Bacteria | 21186 |
| 35 | Ga0068855_100094175 | 3300005563 | Bacteria | 3454 |
| 36 | Ga0068855_100110001 | 3300005563 | Bacteria | 3164 |
| 37 | Ga0068855_100390074 | 3300005563 | Bacteria | 1527 |
| 38 | Ga0068857_100007159 | 3300005577 | Bacteria | 9610 |
| 39 | Ga0068857_100484775 | 3300005577 | Unclassified | 1159 |
| 40 | Ga0068854_100224986 | 3300005578 | Unclassified | 1486 |
| 41 | Ga0068856_100014960 | 3300005614 | Bacteria | 7493 |
| 42 | Ga0068856_100135483 | 3300005614 | Bacteria | 2468 |
| 43 | Ga0068852_100631596 | 3300005616 | Unclassified | 1077 |
| 44 | Ga0068859_100055761 | 3300005617 | Bacteria | 3976 |
| 45 | Ga0068864_100205539 | 3300005618 | Bacteria | 1811 |
| 46 | Ga0068866_10371554 | 3300005718 | Unclassified | 914 |
| 47 | Ga0068851_10022312 | 3300005834 | Bacteria | 3082 |
| 48 | Ga0068863_100470541 | 3300005841 | Unclassified | 1235 |
| 49 | Ga0068858_100301362 | 3300005842 | Unclassified | 1529 |
| 50 | Ga0068860_100039211 | 3300005843 | Bacteria | 4531 |
| 51 | Ga0068860_100057508 | 3300005843 | Bacteria | 3697 |
| 52 | Ga0070717_10003399 | 3300006028 | Bacteria | 11387 |
| 53 | Ga0070717_10024035 | 3300006028 | Bacteria | 4836 |
| 54 | Ga0070717_10029200 | 3300006028 | Bacteria | 4421 |
| 55 | Ga0070715_10152742 | 3300006163 | Bacteria | 1133 |
| 56 | Ga0097621_100043012 | 3300006237 | Unclassified | 3641 |
| 57 | Ga0097621_100255668 | 3300006237 | Unclassified | 1535 |
| 58 | Ga0068871_100016488 | 3300006358 | Bacteria | 5566 |
| 59 | Ga0068871_100058716 | 3300006358 | Bacteria | 3133 |
| 60 | Ga0075428_100423903 | 3300006844 | Bacteria | 1426 |
| 61 | Ga0068865_100619707 | 3300006881 | Unclassified | 916 |
| 62 | Ga0075436_100003800 | 3300006914 | Bacteria | 10358 |
| 63 | Ga0097620_100055762 | 3300006931 | Bacteria | 3976 |
| 64 | Ga0075435_100447844 | 3300007076 | Bacteria | 1113 |
| 65 | Ga0105240_10002840 | 3300009093 | Bacteria | 27375 |
| 66 | Ga0105240_10019034 | 3300009093 | Bacteria | 9184 |
| 67 | Ga0105240_10041513 | 3300009093 | Bacteria | 5871 |
| 68 | Ga0105240_10041982 | 3300009093 | Bacteria | 5832 |
| 69 | Ga0105240_10109049 | 3300009093 | Unclassified | 3353 |
| 70 | Ga0105240_10230372 | 3300009093 | Bacteria | 2153 |
| 71 | Ga0105240_10400036 | 3300009093 | Bacteria | 1547 |
| 72 | Ga0111539_10358618 | 3300009094 | Bacteria | 1697 |
| 73 | Ga0105245_10027460 | 3300009098 | Bacteria | 5015 |
| 74 | Ga0105245_10117924 | 3300009098 | Bacteria | 2476 |
| 75 | Ga0105245_10292233 | 3300009098 | Bacteria | 1596 |
| 76 | Ga0105243_10021158 | 3300009148 | Bacteria | 4936 |
| 77 | Ga0105243_10058927 | 3300009148 | Bacteria | 3062 |
| 78 | Ga0105243_10606108 | 3300009148 | Unclassified | 1055 |
| 79 | Ga0105241_10008015 | 3300009174 | Bacteria | 7771 |
| 80 | Ga0105242_10019915 | 3300009176 | Bacteria | 5255 |
| 81 | Ga0105242_10171736 | 3300009176 | Unclassified | 1906 |
| 82 | Ga0105242_10339144 | 3300009176 | Unclassified | 1385 |
| 83 | Ga0105248_10054815 | 3300009177 | Unclassified | 4472 |
| 84 | Ga0105248_10212170 | 3300009177 | Unclassified | 2181 |
| 85 | Ga0105248_10216946 | 3300009177 | Unclassified | 2155 |
| 86 | Ga0105237_10112324 | 3300009545 | Bacteria | 2717 |
| 87 | Ga0105237_10152040 | 3300009545 | Bacteria | 2311 |
| 88 | Ga0105237_10432715 | 3300009545 | Bacteria | 1321 |
| 89 | Ga0105238_10040782 | 3300009551 | Bacteria | 4703 |
| 90 | Ga0105238_10059875 | 3300009551 | Unclassified | 3814 |
| 91 | Ga0105238_10240033 | 3300009551 | Bacteria | 1790 |
| 92 | Ga0105238_10377922 | 3300009551 | Unclassified | 1408 |
| 93 | Ga0105249_10088909 | 3300009553 | Unclassified | 2886 |
| 94 | Ga0105239_10008697 | 3300010375 | Bacteria | 11494 |
| 95 | Ga0105239_10047919 | 3300010375 | Unclassified | 4683 |
| 96 | Ga0105239_10867148 | 3300010375 | Unclassified | 1036 |
| 97 | Ga0105246_10058949 | 3300011119 | Unclassified | 2662 |
| 98 | Ga0105246_10446338 | 3300011119 | Unclassified | 1086 |
| 99 | Ga0157370_10122157 | 3300013104 | Bacteria | 2432 |
| 100 | Ga0157370_10699386 | 3300013104 | Bacteria | 925 |
| 101 | Ga0157369_10065394 | 3300013105 | Unclassified | 3913 |
| 102 | Ga0157374_10057122 | 3300013296 | Bacteria | 3644 |
| 103 | Ga0157374_10360462 | 3300013296 | Bacteria | 1446 |
| 104 | Ga0157378_10035143 | 3300013297 | Bacteria | 4432 |
| 105 | Ga0157372_10008258 | 3300013307 | Bacteria | 11070 |
| 106 | Ga0157372_10050979 | 3300013307 | Unclassified | 4605 |
| 107 | Ga0157372_10366855 | 3300013307 | Bacteria | 1678 |
| 108 | Ga0157375_10839193 | 3300013308 | Unclassified | 1066 |
| 109 | Ga0157376_10224811 | 3300014969 | Unclassified | 1740 |
| 110 | Ga0157376_10935123 | 3300014969 | Unclassified | 887 |
| 111 | Ga0197907_10064820 | 3300020069 | Bacteria | 3726 |
| 112 | Ga0206349_1073396 | 3300020075 | Bacteria | 2750 |
| 113 | Ga0213875_10030413 | 3300021388 | Bacteria | 2556 |
| 114 | Ga0213875_10042242 | 3300021388 | Unclassified | 2142 |
| 115 | Ga0213875_10099419 | 3300021388 | Bacteria | 1358 |
| 116 | Ga0213875_10108965 | 3300021388 | Bacteria | 1293 |
| 117 | Ga0224712_10015385 | 3300022467 | Bacteria | 2488 |
| 118 | Ga0207656_10085190 | 3300025321 | Unclassified | 1426 |
| 119 | Ga0207645_10356673 | 3300025907 | Bacteria | 979 |
| 120 | Ga0207654_10031877 | 3300025911 | Unclassified | 2907 |
| 121 | Ga0207654_10066571 | 3300025911 | Bacteria | 2125 |
| 122 | Ga0207707_10064489 | 3300025912 | Bacteria | 3189 |
| 123 | Ga0207695_10084129 | 3300025913 | Bacteria | 3212 |
| 124 | Ga0207695_10182055 | 3300025913 | Bacteria | 2022 |
| 125 | Ga0207695_10448277 | 3300025913 | Unclassified | 1174 |
| 126 | Ga0207660_10195590 | 3300025917 | Bacteria | 1577 |
| 127 | Ga0207652_10023185 | 3300025921 | Bacteria | 5140 |
| 128 | Ga0207694_10060404 | 3300025924 | Bacteria | 2950 |
| 129 | Ga0207694_10373195 | 3300025924 | Unclassified | 1183 |
| 130 | Ga0207687_10001399 | 3300025927 | Bacteria | 16469 |
| 131 | Ga0207644_10046500 | 3300025931 | Unclassified | 3093 |
| 132 | Ga0207686_10089575 | 3300025934 | Bacteria | 2028 |
| 133 | Ga0207686_10102661 | 3300025934 | Unclassified | 1912 |
| 134 | Ga0207709_10046512 | 3300025935 | Bacteria | 2634 |
| 135 | Ga0207670_10026724 | 3300025936 | Bacteria | 3641 |
| 136 | Ga0207691_10343319 | 3300025940 | Unclassified | 1278 |
| 137 | Ga0207711_10009284 | 3300025941 | Bacteria | 8212 |
| 138 | Ga0207689_10049869 | 3300025942 | Unclassified | 3454 |
| 139 | Ga0207689_10084655 | 3300025942 | Bacteria | 2606 |
| 140 | Ga0207661_10000035 | 3300025944 | Bacteria | 152976 |
| 141 | Ga0207661_10086069 | 3300025944 | Unclassified | 2607 |
| 142 | Ga0207661_10118265 | 3300025944 | Bacteria | 2252 |
| 143 | Ga0207679_10099486 | 3300025945 | Unclassified | 2271 |
| 144 | Ga0207667_10092483 | 3300025949 | Bacteria | 3123 |
| 145 | Ga0207667_10450017 | 3300025949 | Bacteria | 1309 |
| 146 | Ga0207712_10569979 | 3300025961 | Unclassified | 976 |
| 147 | Ga0207640_10146434 | 3300025981 | Unclassified | 1729 |
| 148 | Ga0207658_10165955 | 3300025986 | Unclassified | 1814 |
| 149 | Ga0207703_10089481 | 3300026035 | Unclassified | 2585 |
| 150 | Ga0207703_10136346 | 3300026035 | Bacteria | 2125 |
| 151 | Ga0207639_10062898 | 3300026041 | Unclassified | 2872 |
| 152 | Ga0207678_10104408 | 3300026067 | Bacteria | 2418 |
| 153 | Ga0207702_10141097 | 3300026078 | Bacteria | 2180 |
| 154 | Ga0207641_10280104 | 3300026088 | Unclassified | 1568 |
| 155 | Ga0207676_10428579 | 3300026095 | Unclassified | 1242 |
| 156 | Ga0207674_10002518 | 3300026116 | Bacteria | 23097 |
| 157 | Ga0207674_10546986 | 3300026116 | Unclassified | 1118 |
| 158 | Ga0207683_10037523 | 3300026121 | Bacteria | 4220 |
| 159 | Ga0268266_10351250 | 3300028379 | Bacteria | 1386 |
| 160 | Ga0268266_10521419 | 3300028379 | Bacteria | 1136 |
| 161 | Ga0268264_10076601 | 3300028381 | Bacteria | 2846 |
| 162 | Ga0268264_10252905 | 3300028381 | Unclassified | 1638 |
| 163 | Ga0265323_10001909 | 3300028653 | Bacteria | 9825 |
| 164 | Ga0265330_10048733 | 3300031235 | Bacteria | 1863 |
| 165 | Ga0265325_10121759 | 3300031241 | Unclassified | 1257 |
| 166 | Ga0265331_10127920 | 3300031250 | Bacteria | 1160 |
| 167 | Ga0265327_10007764 | 3300031251 | Bacteria | 8188 |
| 168 | Ga0265316_10003166 | 3300031344 | Bacteria | 16740 |
| 169 | Ga0265316_10009699 | 3300031344 | Bacteria | 8837 |
| 170 | Ga0265316_10017640 | 3300031344 | Bacteria | 6159 |
| 171 | Ga0265316_10035692 | 3300031344 | Bacteria | 4026 |
| 172 | Ga0265314_10270297 | 3300031711 | Unclassified | 966 |
| 173 | Ga0265342_10011653 | 3300031712 | Bacteria | 6000 |
| 174 | Ga0373934_0040709 | 3300035086 | Bacteria | 1833 |
| 175 | Ga0373940_0142579 | 3300035088 | Bacteria | 758 |
| 176 | Ga0373923_0095554 | 3300035111 | Unclassified | 1305 |
| 177 | Ga0373956_0030232 | 3300035119 | Unclassified | 2366 |
| 178 | Ga0373955_0173892 | 3300035172 | Unclassified | 1276 |
| 179 | Ga0373935_0058193 | 3300035692 | Unclassified | 2468 |
| 180 | Ga0373935_0068426 | 3300035692 | Bacteria | 2285 |
| 181 | Ga0373927_0001252 | 3300035695 | Bacteria | 19261 |
| 182 | Ga0373927_0050870 | 3300035695 | Bacteria | 2680 |
| 183 | Ga0373933_0100983 | 3300035724 | Unclassified | 1790 |
| 184 | Ga0373947_0179503 | 3300035725 | Bacteria | 1378 |
| 185 | Ga0373937_0002483 | 3300036401 | Bacteria | 15327 |
| 186 | Ga0373937_0008911 | 3300036401 | Bacteria | 8710 |
| 187 | Ga0373937_0042958 | 3300036401 | Unclassified | 4126 |
| 188 | Ga0373937_0163120 | 3300036401 | Bacteria | 2090 |
| 189 | Ga0373937_0492737 | 3300036401 | Bacteria | 1164 |
| 190 | Ga0373925_0093720 | 3300037068 | Unclassified | 2299 |
| 191 | Ga0373925_0131699 | 3300037068 | Bacteria | 1950 |
| 192 | Ga0436364_0010541 | 3300037853 | Unclassified | 3939 |
| 193 | Ga0436364_0742075 | 3300037853 | Bacteria | 6403 |
| 194 | Ga0436364_1118774 | 3300037853 | Bacteria | 2713 |
| 195 | Ga0436364_1392870 | 3300037853 | Unclassified | 2927 |
| 196 | Ga0436364_1466258 | 3300037853 | Bacteria | 1619 |
| 197 | Ga0436365_0507194 | 3300039437 | Bacteria | 6250 |
| 198 | Ga0436365_1461184 | 3300039437 | Unclassified | 1644 |
| 199 | Ga0436362_0440173 | 3300039453 | Bacteria | 5580 |
| 200 | Ga0451577_0322447 | 3300042876 | Bacteria | 1401 |
| 201 | Ga0466969_0150434 | 3300044656 | Unclassified | 1073 |
| 202 | Ga0451576_0033219 | 3300045051 | Bacteria | 5485 |
| 203 | Ga0451576_0210968 | 3300045051 | Bacteria | 2028 |
| 204 | Ga0451576_0731610 | 3300045051 | Unclassified | 1039 |
| 205 | Ga0495592_0013823 | 3300046454 | Bacteria | 6137 |
| 206 | Ga0495651_0043465 | 3300046462 | Bacteria | 3486 |
| 207 | Ga0495580_0006742 | 3300046472 | Bacteria | 9318 |
| 208 | Ga0495580_0007411 | 3300046472 | Bacteria | 8823 |
| 209 | Ga0495580_0012266 | 3300046472 | Bacteria | 6580 |
| 210 | Ga0495664_0012773 | 3300046477 | Bacteria | 4757 |
| 211 | Ga0495628_0070854 | 3300046516 | Bacteria | 2717 |
| 212 | Ga0495630_0051104 | 3300046517 | Bacteria | 3093 |
| 213 | Ga0495630_0123472 | 3300046517 | Unclassified | 1965 |
| 214 | Ga0495652_0075756 | 3300046529 | Bacteria | 2793 |
| 215 | Ga0495652_0112533 | 3300046529 | Unclassified | 2187 |
| 216 | Ga0495587_0007153 | 3300046536 | Bacteria | 7242 |
| 217 | Ga0495587_0064464 | 3300046536 | Unclassified | 2141 |
| 218 | Ga0495645_0001642 | 3300046543 | Bacteria | 15171 |
| 219 | Ga0495645_0034723 | 3300046543 | Bacteria | 3677 |
| 220 | Ga0495645_0096266 | 3300046543 | Bacteria | 2110 |
| 221 | Ga0495667_0013233 | 3300046559 | Bacteria | 5587 |
| 222 | Ga0495667_0089804 | 3300046559 | Bacteria | 1991 |
| 223 | Ga0495667_0127482 | 3300046559 | Unclassified | 1642 |
| 224 | Ga0495635_0316931 | 3300046663 | Unclassified | 1044 |
| 225 | Ga0495599_0010394 | 3300046678 | Bacteria | 5694 |
| 226 | Ga0495623_0049201 | 3300046679 | Unclassified | 2672 |
| 227 | Ga0495623_0097360 | 3300046679 | Bacteria | 1797 |
| 228 | Ga0495623_0224354 | 3300046679 | Unclassified | 1069 |
| 229 | Ga0495646_0018094 | 3300046680 | Bacteria | 4463 |
| 230 | Ga0495613_0343738 | 3300046689 | Unclassified | 1026 |
| 231 | Ga0495604_0150845 | 3300047317 | Bacteria | 1652 |
| 232 | Ga0495674_0003092 | 3300047319 | Bacteria | 16177 |
| 233 | Ga0495674_0066366 | 3300047319 | Bacteria | 3131 |
| 234 | Ga0495674_0334920 | 3300047319 | Bacteria | 1230 |
| 235 | Ga0495680_0221883 | 3300047322 | Bacteria | 1349 |
| 236 | Ga0495675_0059546 | 3300047444 | Unclassified | 2421 |
| 237 | Ga0495675_0094483 | 3300047444 | Bacteria | 1875 |
| 238 | Ga0495675_0105887 | 3300047444 | Unclassified | 1758 |
| 239 | Ga0495602_0064212 | 3300048088 | Bacteria | 3176 |
| 240 | Ga0495602_0335172 | 3300048088 | Unclassified | 1096 |
| 241 | Ga0496102_0823691 | 3300048905 | Unclassified | 850 |
| 242 | Ga0496112_0155460 | 3300048915 | Unclassified | 2254 |
| 243 | Ga0501034_0052364 | 3300049571 | Bacteria | 4112 |
| 244 | Ga0501037_0045791 | 3300049573 | Unclassified | 3210 |
| 245 | Ga0501039_0457217 | 3300049575 | Bacteria | 1003 |
| 246 | Ga0501046_0175343 | 3300049580 | Bacteria | 1606 |
| 247 | Ga0501047_0004223 | 3300049581 | Bacteria | 13522 |
| 248 | Ga0501047_0434119 | 3300049581 | Bacteria | 1144 |
| 249 | Ga0501048_0031071 | 3300049582 | Bacteria | 3865 |
| 250 | Ga0501070_0127099 | 3300049586 | Unclassified | 2106 |
| 251 | Ga0501080_0013411 | 3300049742 | Bacteria | 7540 |
| 252 | Ga0501035_0116759 | 3300049822 | Bacteria | 2335 |
| 253 | Ga0501044_0026369 | 3300049823 | Bacteria | 6152 |
| 254 | nmdc:mga08x19_40039_c1 | 3300050514 | Unclassified | 2982 |
| 255 | Ga0501082_0000140 | 3300060353 | Bacteria | 59882 |
| 256 | Ga0495613_0046740 | |||
| 257 | Ga0070676_10081316 | |||
| 258 | Ga0070683_100000030 | |||
| 259 | Ga0070683_100005631 | |||
| 260 | Ga0070683_100360497 | |||
| 261 | Ga0070670_100127281 | |||
| 262 | Ga0068869_100024701 | |||
| 263 | Ga0070680_100078187 | |||
| 264 | Ga0068868_100600425 | |||
| 265 | Ga0070689_100061331 | |||
| 266 | Ga0070692_10031333 | |||
| 267 | Ga0070673_100026436 | |||
| 268 | Ga0070667_100171021 | |||
| 269 | Ga0070667_100459561 | |||
| 270 | Ga0070713_100475034 | |||
| 271 | Ga0070711_100338420 | |||
| 272 | Ga0070663_100080493 | |||
| 273 | Ga0070678_100051423 | |||
| 274 | Ga0070681_10004846 | |||
| 275 | Ga0070681_10125527 | |||
| 276 | Ga0070681_10809558 | |||
| 277 | Ga0068867_100075832 | |||
| 278 | Ga0070698_100654308 | |||
| 279 | Ga0070684_100000041 | |||
| 280 | Ga0070684_100041883 | |||
| 281 | Ga0070684_100140718 | |||
| 282 | Ga0070684_100356628 | |||
| 283 | Ga0070697_100059104 | |||
| 284 | Ga0070695_100046861 | |||
| 285 | Ga0070693_100082177 | |||
| 286 | Ga0070665_100080640 | |||
| 287 | Ga0070665_100143207 | |||
| 288 | Ga0070665_100228668 | |||
| 289 | Ga0068855_100002865 | |||
| 290 | Ga0068855_100094175 | |||
| 291 | Ga0068855_100110001 | |||
| 292 | Ga0068855_100390074 | |||
| 293 | Ga0068857_100007159 | |||
| 294 | Ga0068857_100484775 | |||
| 295 | Ga0068854_100224986 | |||
| 296 | Ga0068856_100014960 | |||
| 297 | Ga0068856_100135483 | |||
| 298 | Ga0068852_100631596 | |||
| 299 | Ga0068859_100055761 | |||
| 300 | Ga0068864_100205539 | |||
| 301 | Ga0068866_10371554 | |||
| 302 | Ga0068851_10022312 | |||
| 303 | Ga0068863_100470541 | |||
| 304 | Ga0068858_100301362 | |||
| 305 | Ga0068860_100039211 | |||
| 306 | Ga0068860_100057508 | |||
| 307 | Ga0070717_10003399 | |||
| 308 | Ga0070717_10024035 | |||
| 309 | Ga0070717_10029200 | |||
| 310 | Ga0070715_10152742 | |||
| 311 | Ga0097621_100043012 | |||
| 312 | Ga0097621_100255668 | |||
| 313 | Ga0068871_100016488 | |||
| 314 | Ga0068871_100058716 | |||
| 315 | Ga0075428_100423903 | |||
| 316 | Ga0068865_100619707 | |||
| 317 | Ga0075436_100003800 | |||
| 318 | Ga0097620_100055762 | |||
| 319 | Ga0075435_100447844 | |||
| 320 | Ga0105240_10002840 | |||
| 321 | Ga0105240_10019034 | |||
| 322 | Ga0105240_10041513 | |||
| 323 | Ga0105240_10041982 | |||
| 324 | Ga0105240_10109049 | |||
| 325 | Ga0105240_10230372 | |||
| 326 | Ga0105240_10400036 | |||
| 327 | Ga0111539_10358618 | |||
| 328 | Ga0105245_10027460 | |||
| 329 | Ga0105245_10117924 | |||
| 330 | Ga0105245_10292233 | |||
| 331 | Ga0105243_10021158 | |||
| 332 | Ga0105243_10058927 | |||
| 333 | Ga0105243_10606108 | |||
| 334 | Ga0105241_10008015 | |||
| 335 | Ga0105242_10019915 | |||
| 336 | Ga0105242_10171736 | |||
| 337 | Ga0105242_10339144 | |||
| 338 | Ga0105248_10054815 | |||
| 339 | Ga0105248_10212170 | |||
| 340 | Ga0105248_10216946 | |||
| 341 | Ga0105237_10112324 | |||
| 342 | Ga0105237_10152040 | |||
| 343 | Ga0105237_10432715 | |||
| 344 | Ga0105238_10040782 | |||
| 345 | Ga0105238_10059875 | |||
| 346 | Ga0105238_10240033 | |||
| 347 | Ga0105238_10377922 | |||
| 348 | Ga0105249_10088909 | |||
| 349 | Ga0105239_10008697 | |||
| 350 | Ga0105239_10047919 | |||
| 351 | Ga0105239_10867148 | |||
| 352 | Ga0105246_10058949 | |||
| 353 | Ga0105246_10446338 | |||
| 354 | Ga0157370_10122157 | |||
| 355 | Ga0157370_10699386 | |||
| 356 | Ga0157369_10065394 | |||
| 357 | Ga0157374_10057122 | |||
| 358 | Ga0157374_10360462 | |||
| 359 | Ga0157378_10035143 | |||
| 360 | Ga0157372_10008258 | |||
| 361 | Ga0157372_10050979 | |||
| 362 | Ga0157372_10366855 | |||
| 363 | Ga0157375_10839193 | |||
| 364 | Ga0157376_10224811 | |||
| 365 | Ga0157376_10935123 | |||
| 366 | Ga0197907_10064820 | |||
| 367 | Ga0206349_1073396 | |||
| 368 | Ga0213875_10030413 | |||
| 369 | Ga0213875_10042242 | |||
| 370 | Ga0213875_10099419 | |||
| 371 | Ga0213875_10108965 | |||
| 372 | Ga0224712_10015385 | |||
| 373 | Ga0207656_10085190 | |||
| 374 | Ga0207645_10356673 | |||
| 375 | Ga0207654_10031877 | |||
| 376 | Ga0207654_10066571 | |||
| 377 | Ga0207707_10064489 | |||
| 378 | Ga0207695_10084129 | |||
| 379 | Ga0207695_10182055 | |||
| 380 | Ga0207695_10448277 | |||
| 381 | Ga0207660_10195590 | |||
| 382 | Ga0207652_10023185 | |||
| 383 | Ga0207694_10060404 | |||
| 384 | Ga0207694_10373195 | |||
| 385 | Ga0207687_10001399 | |||
| 386 | Ga0207644_10046500 | |||
| 387 | Ga0207686_10089575 | |||
| 388 | Ga0207686_10102661 | |||
| 389 | Ga0207709_10046512 | |||
| 390 | Ga0207670_10026724 | |||
| 391 | Ga0207691_10343319 | |||
| 392 | Ga0207711_10009284 | |||
| 393 | Ga0207689_10049869 | |||
| 394 | Ga0207689_10084655 | |||
| 395 | Ga0207661_10000035 | |||
| 396 | Ga0207661_10086069 | |||
| 397 | Ga0207661_10118265 | |||
| 398 | Ga0207679_10099486 | |||
| 399 | Ga0207667_10092483 | |||
| 400 | Ga0207667_10450017 | |||
| 401 | Ga0207712_10569979 | |||
| 402 | Ga0207640_10146434 | |||
| 403 | Ga0207658_10165955 | |||
| 404 | Ga0207703_10089481 | |||
| 405 | Ga0207703_10136346 | |||
| 406 | Ga0207639_10062898 | |||
| 407 | Ga0207678_10104408 | |||
| 408 | Ga0207702_10141097 | |||
| 409 | Ga0207641_10280104 | |||
| 410 | Ga0207676_10428579 | |||
| 411 | Ga0207674_10002518 | |||
| 412 | Ga0207674_10546986 | |||
| 413 | Ga0207683_10037523 | |||
| 414 | Ga0268266_10351250 | |||
| 415 | Ga0268266_10521419 | |||
| 416 | Ga0268264_10076601 | |||
| 417 | Ga0268264_10252905 | |||
| 418 | Ga0265323_10001909 | |||
| 419 | Ga0265330_10048733 | |||
| 420 | Ga0265325_10121759 | |||
| 421 | Ga0265331_10127920 | |||
| 422 | Ga0265327_10007764 | |||
| 423 | Ga0265316_10003166 | |||
| 424 | Ga0265316_10009699 | |||
| 425 | Ga0265316_10017640 | |||
| 426 | Ga0265316_10035692 | |||
| 427 | Ga0265314_10270297 | |||
| 428 | Ga0265342_10011653 | |||
| 429 | Ga0373934_0040709 | |||
| 430 | Ga0373940_0142579 | |||
| 431 | Ga0373923_0095554 | |||
| 432 | Ga0373956_0030232 | |||
| 433 | Ga0373955_0173892 | |||
| 434 | Ga0373935_0058193 | |||
| 435 | Ga0373935_0068426 | |||
| 436 | Ga0373927_0001252 | |||
| 437 | Ga0373927_0050870 | |||
| 438 | Ga0373933_0100983 | |||
| 439 | Ga0373947_0179503 | |||
| 440 | Ga0373937_0002483 | |||
| 441 | Ga0373937_0008911 | |||
| 442 | Ga0373937_0042958 | |||
| 443 | Ga0373937_0163120 | |||
| 444 | Ga0373937_0492737 | |||
| 445 | Ga0373925_0093720 | |||
| 446 | Ga0373925_0131699 | |||
| 447 | Ga0436364_0010541 | |||
| 448 | Ga0436364_0742075 | |||
| 449 | Ga0436364_1118774 | |||
| 450 | Ga0436364_1392870 | |||
| 451 | Ga0436364_1466258 | |||
| 452 | Ga0436365_0507194 | |||
| 453 | Ga0436365_1461184 | |||
| 454 | Ga0436362_0440173 | |||
| 455 | Ga0451577_0322447 | |||
| 456 | Ga0466969_0150434 | |||
| 457 | Ga0451576_0033219 | |||
| 458 | Ga0451576_0210968 | |||
| 459 | Ga0451576_0731610 | |||
| 460 | Ga0495592_0013823 | |||
| 461 | Ga0495651_0043465 | |||
| 462 | Ga0495580_0006742 | |||
| 463 | Ga0495580_0007411 | |||
| 464 | Ga0495580_0012266 | |||
| 465 | Ga0495664_0012773 | |||
| 466 | Ga0495628_0070854 | |||
| 467 | Ga0495630_0051104 | |||
| 468 | Ga0495630_0123472 | |||
| 469 | Ga0495652_0075756 | |||
| 470 | Ga0495652_0112533 | |||
| 471 | Ga0495587_0007153 | |||
| 472 | Ga0495587_0064464 | |||
| 473 | Ga0495645_0001642 | |||
| 474 | Ga0495645_0034723 | |||
| 475 | Ga0495645_0096266 | |||
| 476 | Ga0495667_0013233 | |||
| 477 | Ga0495667_0089804 | |||
| 478 | Ga0495667_0127482 | |||
| 479 | Ga0495635_0316931 | |||
| 480 | Ga0495599_0010394 | |||
| 481 | Ga0495623_0049201 | |||
| 482 | Ga0495623_0097360 | |||
| 483 | Ga0495623_0224354 | |||
| 484 | Ga0495646_0018094 | |||
| 485 | Ga0495613_0343738 | |||
| 486 | Ga0495604_0150845 | |||
| 487 | Ga0495674_0003092 | |||
| 488 | Ga0495674_0066366 | |||
| 489 | Ga0495674_0334920 | |||
| 490 | Ga0495680_0221883 | |||
| 491 | Ga0495675_0059546 | |||
| 492 | Ga0495675_0094483 | |||
| 493 | Ga0495675_0105887 | |||
| 494 | Ga0495602_0064212 | |||
| 495 | Ga0495602_0335172 | |||
| 496 | Ga0496102_0823691 | |||
| 497 | Ga0496112_0155460 | |||
| 498 | Ga0501034_0052364 | |||
| 499 | Ga0501037_0045791 | |||
| 500 | Ga0501039_0457217 | |||
| 501 | Ga0501046_0175343 | |||
| 502 | Ga0501047_0004223 | |||
| 503 | Ga0501047_0434119 | |||
| 504 | Ga0501048_0031071 | |||
| 505 | Ga0501070_0127099 | |||
| 506 | Ga0501080_0013411 | |||
| 507 | Ga0501035_0116759 | |||
| 508 | Ga0501044_0026369 | |||
| 509 | nmdc:mga08x19_40039_c1 | |||
| 510 | Ga0501082_0000140 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1di2-assembly1.cif.gz_A | crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions | 0.9631 | 175 | 242 |
| 3n3w-assembly1.cif.gz_B | 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni | 0.9493 | 3 | 161 |
| 2a11-assembly1.cif.gz_A-2 | crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis | 0.9389 | 3 | 158 |
| 1di2-assembly1.cif.gz_A | crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions | 0.9231 | 175 | 242 |
| 6htu-assembly1.cif.gz_B | structure of hstau1 dsrbd3-4 in complex with arf1 rna | 0.9229 | 175 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VLW8_91_162_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9625 | 174 | 241 | 3.30.160.20 |
| af_Q2FZ50_16_166_1.10.1520.10 | Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain | 0.9563 | 4 | 159 | 1.10.1520.10 |
| af_P97473_17_105_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9529 | 175 | 243 | 3.30.160.20 |
| af_Q7ZW47_303_388_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9513 | 174 | 242 | 3.30.160.20 |
| af_Q9Z108_194_270_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9513 | 174 | 242 | 3.30.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4I1L7-F1-model_v4 | Ribonuclease III | 0.9825 | 6 | 132 |
GO:0004525
GO:0006396 |
| AF-A0A356E6B3-F1-model_v4 | Ribonuclease III | 0.9795 | 5 | 131 |
GO:0004525
GO:0006396 |
| AF-A0A358D5I6-F1-model_v4 | Ribonuclease III | 0.9776 | 6 | 150 |
GO:0003723
GO:0004525 GO:0005737 GO:0030422 |
| AF-A0A1G1JR72-F1-model_v4 | RNase III domain-containing protein | 0.9748 | 5 | 157 |
GO:0003723
GO:0004525 GO:0005737 GO:0030422 |
| AF-A0A2V8U0U9-F1-model_v4 | Ribonuclease III | 0.9746 | 3 | 160 |
GO:0004525
GO:0006396 |