F365784

General Info

Members Datasets Scaffolds Average Seq Length
255 84 221 423

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10000339|Ga0265318_1000033913
Length 472
Sequence MRSQFRLLALLSAIGFFGLVGHSATITGTVKGVDGAPFQGAFVQAQNTKTKIAVNVLSDPQGRYKIEQLPAGDYRVQIRAIGYTAEPHTGVSLTADQNASFDFALQQGTVRWSDLSVYQAKQLLPPGRGRDILFSDSCSVCHSFQSRMAAVHRDADGWADRIQYMRTAMKYALATRFTDQDATDLGAYLTSVFGPDSVLPKSPTDLPGYKATLRPISKDALNIVYVEYDMPGPSRMPFSAAPDKNGFVWIPNFGNANKITRIDTKTGAAQDFTVPNVGTAAIHSAVPAPDGSVWLAEQGSNKLGHWDPATQQITEYLDAPKGSKHTVRVDAAGNVWSTGSPLTKFDPETQKFTRFEEVKDSYDVRPAANGDVWFTRLFGSKLGKIDGKTMKVTMWDPPTPNAGPRRMEIAPDGMIWTDEYNVGKIASFDPKTEKFKEYPLPXXXXEVTAEIYMREFFRYLAGKNGSKMPSGN

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
4 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
5 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
6 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
7 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
8 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
9 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
13 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
14 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
15 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
16 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
17 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
46 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
47 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
48 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
54 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
55 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
56 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
57 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
67 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
68 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
75 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
76 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
77 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100142838 3300005338 Unclassified 1966
2 Ga0070713_100047985 3300005436 Bacteria 3513
3 Ga0070663_100035879 3300005455 Unclassified 3442
4 Ga0068870_10008675 3300005840 Bacteria 4583
5 Ga0068863_100065979 3300005841 Bacteria 3424
6 Ga0068858_100200351 3300005842 Unclassified 1888
7 Ga0099795_10020387 3300007788 Bacteria 2159
8 Ga0105240_10015342 3300009093 Bacteria 10420
9 Ga0105240_10041898 3300009093 Bacteria 5839
10 Ga0111539_10109025 3300009094 Bacteria 3249
11 Ga0105248_10122214 3300009177 Unclassified 2937
12 Ga0105249_10055286 3300009553 Bacteria 3630
13 Ga0157374_10016167 3300013296 Bacteria 6557
14 Ga0157374_10133033 3300013296 Bacteria 2408
15 Ga0157378_10010355 3300013297 Bacteria 8140
16 Ga0157377_10062014 3300014745 Bacteria 2138
17 Ga0157379_10052925 3300014968 Bacteria 3626
18 Ga0228598_1006480 3300024227 Bacteria 2422
19 Ga0207656_10030083 3300025321 Unclassified 2241
20 Ga0207642_10005278 3300025899 Bacteria 4210
21 Ga0207645_10030736 3300025907 Bacteria 3460
22 Ga0207693_10034980 3300025915 Bacteria 3963
23 Ga0207662_10041386 3300025918 Unclassified 2713
24 Ga0207657_10177345 3300025919 Unclassified 1724
25 Ga0207649_10033645 3300025920 Bacteria 3065
26 Ga0207659_10052888 3300025926 Unclassified 2895
27 Ga0207691_10046977 3300025940 Bacteria 3965
28 Ga0207689_10029019 3300025942 Bacteria 4624
29 Ga0207678_10034073 3300026067 Bacteria 4435
30 Ga0207648_10045729 3300026089 Bacteria 3839
31 Ga0207674_10096190 3300026116 Unclassified 2946
32 Ga0207675_100038591 3300026118 Bacteria 4457
33 Ga0265319_1001419 3300028563 Bacteria 14355
34 Ga0265319_1001573 3300028563 Bacteria 13385
35 Ga0265319_1002286 3300028563 Bacteria 10571
36 Ga0265319_1003060 3300028563 Bacteria 8857
37 Ga0265319_1003567 3300028563 Bacteria 8070
38 Ga0265319_1004213 3300028563 Bacteria 7190
39 Ga0265319_1019657 3300028563 Bacteria 2517
40 Ga0265319_1024631 3300028563 Unclassified 2163
41 Ga0265318_10000092 3300028577 Bacteria 82224
42 Ga0265318_10000164 3300028577 Bacteria 58752
43 Ga0265318_10000165 3300028577 Bacteria 58672
44 Ga0265318_10000282 3300028577 Bacteria 42238
45 Ga0265318_10000339 3300028577 Bacteria 37188
46 Ga0265318_10000442 3300028577 Bacteria 31287
47 Ga0265318_10000617 3300028577 Bacteria 24601
48 Ga0265318_10002915 3300028577 Bacteria 8883
49 Ga0265338_10013170 3300028800 Bacteria 9363
50 Ga0265338_10013967 3300028800 Bacteria 9005
51 Ga0265338_10014532 3300028800 Bacteria 8749
52 Ga0265338_10026902 3300028800 Bacteria 5788
53 Ga0265338_10037122 3300028800 Unclassified 4645
54 Ga0265338_10047919 3300028800 Bacteria 3895
55 Ga0265338_10091147 3300028800 Unclassified 2520
56 Ga0265338_10100443 3300028800 Bacteria 2360
57 Ga0265338_10108802 3300028800 Unclassified 2238
58 Ga0265332_10004924 3300031238 Bacteria 6210
59 Ga0265332_10032122 3300031238 Unclassified 2288
60 Ga0265320_10000067 3300031240 Bacteria 93425
61 Ga0265320_10000098 3300031240 Bacteria 73999
62 Ga0265320_10000099 3300031240 Bacteria 73908
63 Ga0265320_10000128 3300031240 Bacteria 66582
64 Ga0265320_10001045 3300031240 Bacteria 20546
65 Ga0265320_10001217 3300031240 Bacteria 18901
66 Ga0265320_10008717 3300031240 Bacteria 6178
67 Ga0265320_10031433 3300031240 Bacteria 2726
68 Ga0265325_10001003 3300031241 Bacteria 20300
69 Ga0265325_10001957 3300031241 Bacteria 14178
70 Ga0265325_10002229 3300031241 Bacteria 13153
71 Ga0265325_10002261 3300031241 Bacteria 13050
72 Ga0265325_10002550 3300031241 Bacteria 12255
73 Ga0265325_10002754 3300031241 Bacteria 11743
74 Ga0265325_10003503 3300031241 Bacteria 10216
75 Ga0265325_10004605 3300031241 Bacteria 8664
76 Ga0265325_10006069 3300031241 Bacteria 7392
77 Ga0265325_10006620 3300031241 Bacteria 7014
78 Ga0265325_10006842 3300031241 Bacteria 6891
79 Ga0265325_10012142 3300031241 Unclassified 4932
80 Ga0265325_10013406 3300031241 Bacteria 4668
81 Ga0265325_10021742 3300031241 Bacteria 3519
82 Ga0265325_10024277 3300031241 Bacteria 3300
83 Ga0265325_10055856 3300031241 Unclassified 2018
84 Ga0265329_10000117 3300031242 Bacteria 37211
85 Ga0265329_10000140 3300031242 Bacteria 34889
86 Ga0265329_10000254 3300031242 Bacteria 28465
87 Ga0265329_10000260 3300031242 Bacteria 27933
88 Ga0265329_10000595 3300031242 Bacteria 18705
89 Ga0265329_10000607 3300031242 Bacteria 18458
90 Ga0265329_10001193 3300031242 Bacteria 12747
91 Ga0265329_10002736 3300031242 Bacteria 7907
92 Ga0265329_10004337 3300031242 Bacteria 5924
93 Ga0265340_10000833 3300031247 Bacteria 17535
94 Ga0265340_10001459 3300031247 Bacteria 13555
95 Ga0265340_10003023 3300031247 Bacteria 9573
96 Ga0265340_10003870 3300031247 Bacteria 8431
97 Ga0265340_10005535 3300031247 Bacteria 7002
98 Ga0265340_10006495 3300031247 Bacteria 6432
99 Ga0265340_10046815 3300031247 Unclassified 2108
100 Ga0265339_10001250 3300031249 Bacteria 19125
101 Ga0265339_10001665 3300031249 Bacteria 16410
102 Ga0265339_10003082 3300031249 Bacteria 11728
103 Ga0265339_10010341 3300031249 Bacteria 5799
104 Ga0265339_10010791 3300031249 Bacteria 5654
105 Ga0265339_10012792 3300031249 Bacteria 5102
106 Ga0265339_10055308 3300031249 Bacteria 2153
107 Ga0265331_10000047 3300031250 Bacteria 183230
108 Ga0265331_10000081 3300031250 Bacteria 136351
109 Ga0265331_10000094 3300031250 Bacteria 122448
110 Ga0265331_10000196 3300031250 Bacteria 73914
111 Ga0265331_10000360 3300031250 Bacteria 47793
112 Ga0265331_10000867 3300031250 Bacteria 24622
113 Ga0265331_10004004 3300031250 Bacteria 9303
114 Ga0265331_10005101 3300031250 Bacteria 8007
115 Ga0265331_10005605 3300031250 Bacteria 7551
116 Ga0265331_10006447 3300031250 Bacteria 6934
117 Ga0265331_10007499 3300031250 Bacteria 6307
118 Ga0265331_10008178 3300031250 Bacteria 5969
119 Ga0265331_10016183 3300031250 Unclassified 3920
120 Ga0265331_10018108 3300031250 Unclassified 3659
121 Ga0265331_10026390 3300031250 Bacteria 2921
122 Ga0265331_10037608 3300031250 Bacteria 2369
123 Ga0265316_10001555 3300031344 Bacteria 24601
124 Ga0265316_10003080 3300031344 Bacteria 17006
125 Ga0265316_10004628 3300031344 Bacteria 13648
126 Ga0265316_10005320 3300031344 Bacteria 12542
127 Ga0265316_10005519 3300031344 Bacteria 12271
128 Ga0265316_10008660 3300031344 Bacteria 9420
129 Ga0265316_10009081 3300031344 Bacteria 9160
130 Ga0265316_10009168 3300031344 Bacteria 9118
131 Ga0265316_10010072 3300031344 Bacteria 8642
132 Ga0265316_10013330 3300031344 Bacteria 7308
133 Ga0265316_10014168 3300031344 Bacteria 7034
134 Ga0265316_10016585 3300031344 Bacteria 6385
135 Ga0265316_10025752 3300031344 Bacteria 4903
136 Ga0265316_10025906 3300031344 Unclassified 4886
137 Ga0265316_10029193 3300031344 Unclassified 4539
138 Ga0265316_10044143 3300031344 Unclassified 3547
139 Ga0265316_10047083 3300031344 Bacteria 3413
140 Ga0265316_10060111 3300031344 Bacteria 2954
141 Ga0265316_10079164 3300031344 Unclassified 2522
142 Ga0265316_10086169 3300031344 Bacteria 2401
143 Ga0265316_10087560 3300031344 Bacteria 2379
144 Ga0265313_10001396 3300031595 Bacteria 22632
145 Ga0265313_10001796 3300031595 Bacteria 19608
146 Ga0265313_10001917 3300031595 Bacteria 18877
147 Ga0265313_10002265 3300031595 Bacteria 16912
148 Ga0265313_10003949 3300031595 Bacteria 11667
149 Ga0265313_10005028 3300031595 Bacteria 9867
150 Ga0265313_10005508 3300031595 Bacteria 9279
151 Ga0265313_10006217 3300031595 Bacteria 8535
152 Ga0265313_10016988 3300031595 Bacteria 4159
153 Ga0265313_10027120 3300031595 Bacteria 3004
154 Ga0265313_10029109 3300031595 Unclassified 2861
155 Ga0265314_10003879 3300031711 Bacteria 14235
156 Ga0265314_10010437 3300031711 Bacteria 7748
157 Ga0265314_10013152 3300031711 Bacteria 6703
158 Ga0265314_10019387 3300031711 Bacteria 5271
159 Ga0265314_10044826 3300031711 Unclassified 3131
160 Ga0265342_10000247 3300031712 Bacteria 60566
161 Ga0265342_10000483 3300031712 Bacteria 43126
162 Ga0265342_10000588 3300031712 Bacteria 38307
163 Ga0265342_10000649 3300031712 Bacteria 36485
164 Ga0265342_10000901 3300031712 Bacteria 29558
165 Ga0265342_10000969 3300031712 Bacteria 28495
166 Ga0265342_10002276 3300031712 Bacteria 16784
167 Ga0265342_10003329 3300031712 Bacteria 13265
168 Ga0265342_10006479 3300031712 Bacteria 8718
169 Ga0265342_10063455 3300031712 Bacteria 2171
170 Ga0373926_0010055 3300035083 Unclassified 3166
171 Ga0373944_0005310 3300035089 Bacteria 3387
172 Ga0373936_0011320 3300035113 Bacteria 3377
173 Ga0373954_0009317 3300035118 Unclassified 4321
174 Ga0373935_0003341 3300035692 Bacteria 9296
175 Ga0373927_0014660 3300035695 Bacteria 5183
176 Ga0373947_0003353 3300035725 Bacteria 9482
177 Ga0495603_0005851 3300046455 Bacteria 7354
178 Ga0495651_0001436 3300046462 Bacteria 18452
179 Ga0495580_0002681 3300046472 Bacteria 15429
180 Ga0495639_0008408 3300046475 Bacteria 4425
181 Ga0495607_0063885 3300046501 Unclassified 2081
182 Ga0495608_0004129 3300046511 Bacteria 10410
183 Ga0495608_0017256 3300046511 Unclassified 4996
184 Ga0495618_0005022 3300046514 Bacteria 8084
185 Ga0495628_0009378 3300046516 Bacteria 8354
186 Ga0495628_0009545 3300046516 Bacteria 8285
187 Ga0495628_0043916 3300046516 Unclassified 3558
188 Ga0495630_0000813 3300046517 Bacteria 21934
189 Ga0495652_0006049 3300046529 Bacteria 11317
190 Ga0495665_0012927 3300046531 Unclassified 4518
191 Ga0495640_0040382 3300046533 Unclassified 3268
192 Ga0495586_0002738 3300046535 Bacteria 9538
193 Ga0495586_0076844 3300046535 Bacteria 1830
194 Ga0495587_0000358 3300046536 Bacteria 32704
195 Ga0495667_0004007 3300046559 Bacteria 9892
196 Ga0495667_0129585 3300046559 Unclassified 1627
197 Ga0495623_0001717 3300046679 Bacteria 14721
198 Ga0495646_0004588 3300046680 Bacteria 8707
199 Ga0495658_0005843 3300046683 Bacteria 6041
200 Ga0495613_0019345 3300046689 Bacteria 5077
201 Ga0495613_0056399 3300046689 Bacteria 2885
202 Ga0495613_0063288 3300046689 Unclassified 2707
203 Ga0495589_0072894 3300046794 Unclassified 1677
204 Ga0495604_0000845 3300047317 Bacteria 25565
205 Ga0495674_0018894 3300047319 Bacteria 6410
206 Ga0495674_0033120 3300047319 Unclassified 4683
207 Ga0495676_0021932 3300047321 Bacteria 5566
208 Ga0495680_0000639 3300047322 Bacteria 39236
209 Ga0495680_0001497 3300047322 Bacteria 25124
210 Ga0495675_0028073 3300047444 Bacteria 3587
211 Ga0495675_0066281 3300047444 Bacteria 2282
212 Ga0495602_0047388 3300048088 Unclassified 3873
213 Ga0495602_0072754 3300048088 Unclassified 2929
214 Ga0496100_0071374 3300048903 Unclassified 2318
215 Ga0496101_0055890 3300048904 Bacteria 2852
216 Ga0496101_0106914 3300048904 Bacteria 2101
217 Ga0496104_0014252 3300048907 Bacteria 7176
218 Ga0496109_0050662 3300048912 Bacteria 3781
219 Ga0496111_0039379 3300048914 Bacteria 3388
220 Ga0496113_0002500 3300048916 Bacteria 10710
221 nmdc:mga08y16_31650_c1 3300050511 Bacteria 3603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10024277 Ga0265325_100242771 349
2 3300028563 Ga0265319_1004213 Ga0265319_10042135 350
3 3300028577 Ga0265318_10000092 Ga0265318_1000009226 350
4 3300031240 Ga0265320_10000067 Ga0265320_1000006750 350
5 3300031249 Ga0265339_10001665 Ga0265339_100016655 350
6 3300031250 Ga0265331_10000047 Ga0265331_10000047131 350
7 3300031344 Ga0265316_10009168 Ga0265316_100091682 350
8 3300031595 Ga0265313_10003949 Ga0265313_100039496 350
9 3300031712 Ga0265342_10000247 Ga0265342_1000024718 350
10 3300028800 Ga0265338_10026902 Ga0265338_100269022 359
11 3300031241 Ga0265325_10002261 Ga0265325_100022619 359
12 3300028563 Ga0265319_1003060 Ga0265319_10030602 361
13 3300028577 Ga0265318_10000339 Ga0265318_1000033929 361
14 3300031238 Ga0265332_10004924 Ga0265332_100049244 361
15 3300031240 Ga0265320_10000128 Ga0265320_1000012817 361
16 3300031242 Ga0265329_10000260 Ga0265329_100002605 361
17 3300031250 Ga0265331_10000094 Ga0265331_1000009474 361
18 3300031344 Ga0265316_10014168 Ga0265316_100141683 361
19 3300031595 Ga0265313_10001396 Ga0265313_1000139615 361
20 3300031712 Ga0265342_10000969 Ga0265342_1000096917 361
21 3300028577 Ga0265318_10000442 Ga0265318_1000044218 362
22 3300031240 Ga0265320_10001217 Ga0265320_1000121713 362
23 3300031242 Ga0265329_10001193 Ga0265329_100011931 362
24 3300031247 Ga0265340_10046815 Ga0265340_100468151 362
25 3300031249 Ga0265339_10012792 Ga0265339_100127924 362
26 3300031250 Ga0265331_10000360 Ga0265331_100003601 362
27 3300031712 Ga0265342_10000649 Ga0265342_1000064933 362
28 3300028800 Ga0265338_10013967 Ga0265338_100139673 363
29 3300031241 Ga0265325_10006620 Ga0265325_100066204 363
30 3300028577 Ga0265318_10000442 Ga0265318_1000044220 364
31 3300028800 Ga0265338_10047919 Ga0265338_100479191 364
32 3300028800 Ga0265338_10100443 Ga0265338_101004431 364
33 3300031240 Ga0265320_10031433 Ga0265320_100314332 364
34 3300031241 Ga0265325_10002550 Ga0265325_100025506 364
35 3300031241 Ga0265325_10021742 Ga0265325_100217422 364
36 3300031242 Ga0265329_10002736 Ga0265329_100027362 364
37 3300031247 Ga0265340_10003870 Ga0265340_100038708 364
38 3300031249 Ga0265339_10012792 Ga0265339_100127922 364
39 3300031250 Ga0265331_10005101 Ga0265331_100051012 364
40 3300031344 Ga0265316_10010072 Ga0265316_100100728 364
41 3300031344 Ga0265316_10087560 Ga0265316_100875602 364
42 3300031712 Ga0265342_10006479 Ga0265342_100064798 364
43 3300028563 Ga0265319_1001419 Ga0265319_10014197 367
44 3300028577 Ga0265318_10000339 Ga0265318_100003398 367
45 3300031240 Ga0265320_10000128 Ga0265320_1000012837 367
46 3300031241 Ga0265325_10001003 Ga0265325_1000100310 367
47 3300031242 Ga0265329_10000607 Ga0265329_100006075 367
48 3300031247 Ga0265340_10003023 Ga0265340_100030237 367
49 3300031250 Ga0265331_10000094 Ga0265331_1000009453 367
50 3300031344 Ga0265316_10003080 Ga0265316_100030809 367
51 3300031344 Ga0265316_10008660 Ga0265316_100086609 367
52 3300031595 Ga0265313_10005508 Ga0265313_100055086 367
53 3300031711 Ga0265314_10003879 Ga0265314_100038792 367
54 3300031712 Ga0265342_10000483 Ga0265342_1000048317 367
55 3300035083 Ga0373926_0010055 Ga0373926_0010055_1156_2682 367
56 3300035118 Ga0373954_0009317 Ga0373954_0009317_869_2371 367
57 3300035692 Ga0373935_0003341 Ga0373935_0003341_7333_8835 367
58 3300035695 Ga0373927_0014660 Ga0373927_0014660_1247_2749 367
59 3300046472 Ga0495580_0002681 Ga0495580_0002681_7759_9285 367
60 3300046511 Ga0495608_0017256 Ga0495608_0017256_1397_2899 367
61 3300046516 Ga0495628_0009545 Ga0495628_0009545_756_2258 367
62 3300046529 Ga0495652_0006049 Ga0495652_0006049_7412_8914 367
63 3300046531 Ga0495665_0012927 Ga0495665_0012927_1638_3164 367
64 3300046535 Ga0495586_0002738 Ga0495586_0002738_2530_4032 367
65 3300046559 Ga0495667_0129585 Ga0495667_0129585_10_1539 367
66 3300046680 Ga0495646_0004588 Ga0495646_0004588_2307_3809 367
67 3300046689 Ga0495613_0019345 Ga0495613_0019345_1365_2891 367
68 3300048088 Ga0495602_0072754 Ga0495602_0072754_264_1766 367
69 3300046679 Ga0495623_0001717 Ga0495623_0001717_7252_8754 368
70 3300031250 Ga0265331_10008178 Ga0265331_100081783 369
71 3300031344 Ga0265316_10001555 Ga0265316_100015559 369
72 3300028800 Ga0265338_10091147 Ga0265338_100911472 370
73 3300031344 Ga0265316_10013330 Ga0265316_100133307 370
74 3300031250 Ga0265331_10037608 Ga0265331_100376081 371
75 3300031595 Ga0265313_10027120 Ga0265313_100271202 371
76 3300009093 Ga0105240_10041898 Ga0105240_100418984 373
77 3300031241 Ga0265325_10002754 Ga0265325_100027543 373
78 3300046517 Ga0495630_0000813 Ga0495630_0000813_6846_8435 374
79 3300047319 Ga0495674_0033120 Ga0495674_0033120_100_1689 374
80 3300047444 Ga0495675_0028073 Ga0495675_0028073_1539_3128 374
81 3300031595 Ga0265313_10016988 Ga0265313_100169882 375
82 3300028563 Ga0265319_1001419 Ga0265319_10014196 376
83 3300028577 Ga0265318_10000339 Ga0265318_100003397 376
84 3300028800 Ga0265338_10013967 Ga0265338_100139672 376
85 3300031238 Ga0265332_10032122 Ga0265332_100321221 376
86 3300031240 Ga0265320_10000128 Ga0265320_1000012838 376
87 3300031241 Ga0265325_10006620 Ga0265325_100066203 376
88 3300031242 Ga0265329_10000607 Ga0265329_100006076 376
89 3300031247 Ga0265340_10003023 Ga0265340_100030236 376
90 3300031249 Ga0265339_10001250 Ga0265339_1000125013 376
91 3300031250 Ga0265331_10000094 Ga0265331_1000009452 376
92 3300031344 Ga0265316_10003080 Ga0265316_100030808 376
93 3300031711 Ga0265314_10003879 Ga0265314_100038793 376
94 3300031712 Ga0265342_10000483 Ga0265342_1000048318 376
95 3300009093 Ga0105240_10015342 Ga0105240_100153422 377
96 3300028577 Ga0265318_10000339 Ga0265318_1000033914 377
97 3300031240 Ga0265320_10000128 Ga0265320_1000012832 377
98 3300031242 Ga0265329_10004337 Ga0265329_100043375 377
99 3300031247 Ga0265340_10006495 Ga0265340_100064952 377
100 3300031250 Ga0265331_10000094 Ga0265331_1000009459 377
101 3300031250 Ga0265331_10016183 Ga0265331_100161832 377
102 3300031344 Ga0265316_10044143 Ga0265316_100441432 377
103 3300031344 Ga0265316_10047083 Ga0265316_100470833 377
104 3300031595 Ga0265313_10005508 Ga0265313_100055081 377
105 3300031712 Ga0265342_10000483 Ga0265342_1000048312 377
106 3300035089 Ga0373944_0005310 Ga0373944_0005310_32_1594 377
107 3300028563 Ga0265319_1001573 Ga0265319_100157311 378
108 3300028577 Ga0265318_10000442 Ga0265318_1000044217 378
109 3300031240 Ga0265320_10001217 Ga0265320_1000121712 378
110 3300031241 Ga0265325_10055856 Ga0265325_100558562 378
111 3300031242 Ga0265329_10001193 Ga0265329_100011932 378
112 3300031250 Ga0265331_10000360 Ga0265331_100003602 378
113 3300031344 Ga0265316_10025906 Ga0265316_100259062 378
114 3300031344 Ga0265316_10079164 Ga0265316_100791642 378
115 3300031595 Ga0265313_10001796 Ga0265313_100017962 378
116 3300031712 Ga0265342_10000649 Ga0265342_1000064932 378
117 3300031250 Ga0265331_10004004 Ga0265331_100040044 379
118 3300031344 Ga0265316_10016585 Ga0265316_100165852 379
119 3300028563 Ga0265319_1019657 Ga0265319_10196572 380
120 3300028800 Ga0265338_10014532 Ga0265338_100145325 380
121 3300028800 Ga0265338_10108802 Ga0265338_101088022 380
122 3300031241 Ga0265325_10002229 Ga0265325_100022293 380
123 3300031241 Ga0265325_10004605 Ga0265325_100046052 380
124 3300031241 Ga0265325_10006842 Ga0265325_100068427 380
125 3300031250 Ga0265331_10018108 Ga0265331_100181082 380
126 3300031344 Ga0265316_10029193 Ga0265316_100291932 380
127 3300031250 Ga0265331_10007499 Ga0265331_100074995 381
128 3300028563 Ga0265319_1003567 Ga0265319_10035678 383
129 3300028577 Ga0265318_10000164 Ga0265318_1000016431 383
130 3300031240 Ga0265320_10000098 Ga0265320_1000009824 383
131 3300031241 Ga0265325_10006069 Ga0265325_100060694 383
132 3300031242 Ga0265329_10000254 Ga0265329_100002542 383
133 3300031247 Ga0265340_10001459 Ga0265340_100014595 383
134 3300031249 Ga0265339_10010341 Ga0265339_100103412 383
135 3300031250 Ga0265331_10000081 Ga0265331_1000008185 383
136 3300031344 Ga0265316_10025752 Ga0265316_100257521 383
137 3300031344 Ga0265316_10086169 Ga0265316_100861691 383
138 3300031595 Ga0265313_10001917 Ga0265313_100019174 383
139 3300031711 Ga0265314_10013152 Ga0265314_100131522 383
140 3300031712 Ga0265342_10000901 Ga0265342_1000090127 383
141 3300028800 Ga0265338_10013170 Ga0265338_100131704 384
142 3300031241 Ga0265325_10013406 Ga0265325_100134063 384
143 3300031241 Ga0265325_10003503 Ga0265325_100035032 385
144 3300035113 Ga0373936_0011320 Ga0373936_0011320_364_1926 385
145 3300035725 Ga0373947_0003353 Ga0373947_0003353_4189_5751 385
146 3300046455 Ga0495603_0005851 Ga0495603_0005851_2034_3596 385
147 3300046475 Ga0495639_0008408 Ga0495639_0008408_1148_2710 385
148 3300046501 Ga0495607_0063885 Ga0495607_0063885_220_1782 385
149 3300046683 Ga0495658_0005843 Ga0495658_0005843_3428_4990 385
150 3300047321 Ga0495676_0021932 Ga0495676_0021932_3962_5524 385
151 3300024227 Ga0228598_1006480 Ga0228598_10064801 386
152 3300028800 Ga0265338_10037122 Ga0265338_100371225 386
153 3300031241 Ga0265325_10001957 Ga0265325_1000195710 386
154 3300031250 Ga0265331_10026390 Ga0265331_100263902 386
155 3300031344 Ga0265316_10060111 Ga0265316_100601115 386
156 3300013296 Ga0157374_10133033 Ga0157374_101330332 387
157 3300046689 Ga0495613_0063288 Ga0495613_0063288_433_1998 387
158 3300013297 Ga0157378_10010355 Ga0157378_100103557 391
159 3300028563 Ga0265319_1024631 Ga0265319_10246312 392
160 3300028577 Ga0265318_10000617 Ga0265318_100006173 392
161 3300028577 Ga0265318_10002915 Ga0265318_100029152 392
162 3300031240 Ga0265320_10001045 Ga0265320_1000104524 392
163 3300031240 Ga0265320_10008717 Ga0265320_100087171 392
164 3300031241 Ga0265325_10012142 Ga0265325_100121425 392
165 3300031242 Ga0265329_10000140 Ga0265329_100001404 392
166 3300031247 Ga0265340_10005535 Ga0265340_100055352 392
167 3300031249 Ga0265339_10055308 Ga0265339_100553081 392
168 3300031250 Ga0265331_10000867 Ga0265331_1000086724 392
169 3300031250 Ga0265331_10005605 Ga0265331_100056051 392
170 3300031250 Ga0265331_10006447 Ga0265331_100064476 392
171 3300031344 Ga0265316_10005519 Ga0265316_100055193 392
172 3300031344 Ga0265316_10009081 Ga0265316_100090815 392
173 3300031595 Ga0265313_10005028 Ga0265313_100050283 392
174 3300031595 Ga0265313_10029109 Ga0265313_100291092 392
175 3300031711 Ga0265314_10010437 Ga0265314_100104373 392
176 3300031712 Ga0265342_10003329 Ga0265342_100033292 392
177 3300031712 Ga0265342_10063455 Ga0265342_100634551 392
178 3300014745 Ga0157377_10062014 Ga0157377_100620141 393
179 3300028563 Ga0265319_1002286 Ga0265319_10022862 393
180 3300028577 Ga0265318_10000165 Ga0265318_1000016539 393
181 3300031240 Ga0265320_10000099 Ga0265320_1000009939 393
182 3300031242 Ga0265329_10000117 Ga0265329_1000011734 393
183 3300031249 Ga0265339_10010791 Ga0265339_100107912 393
184 3300031250 Ga0265331_10000196 Ga0265331_1000019639 393
185 3300031344 Ga0265316_10005320 Ga0265316_100053208 393
186 3300031595 Ga0265313_10006217 Ga0265313_100062175 393
187 3300031711 Ga0265314_10044826 Ga0265314_100448263 393
188 3300031712 Ga0265342_10000588 Ga0265342_100005884 393
189 3300028577 Ga0265318_10000282 Ga0265318_1000028211 394
190 3300031241 Ga0265325_10002754 Ga0265325_100027542 394
191 3300031242 Ga0265329_10000595 Ga0265329_100005954 394
192 3300031247 Ga0265340_10000833 Ga0265340_100008337 394
193 3300031249 Ga0265339_10003082 Ga0265339_100030825 394
194 3300031250 Ga0265331_10000081 Ga0265331_1000008111 394
195 3300031344 Ga0265316_10004628 Ga0265316_100046289 394
196 3300031595 Ga0265313_10002265 Ga0265313_100022657 394
197 3300031711 Ga0265314_10019387 Ga0265314_100193872 394
198 3300031712 Ga0265342_10002276 Ga0265342_100022767 394
199 3300005436 Ga0070713_100047985 Ga0070713_1000479852 395
200 3300028577 Ga0265318_10000339 Ga0265318_1000033913 395
201 3300031240 Ga0265320_10000128 Ga0265320_1000012833 395
202 3300031247 Ga0265340_10006495 Ga0265340_100064951 395
203 3300031250 Ga0265331_10000094 Ga0265331_1000009458 395
204 3300031595 Ga0265313_10005508 Ga0265313_100055082 395
205 3300031712 Ga0265342_10000483 Ga0265342_1000048313 395
206 3300013296 Ga0157374_10016167 Ga0157374_100161673 396
207 3300046462 Ga0495651_0001436 Ga0495651_0001436_5519_7135 396
208 3300046516 Ga0495628_0043916 Ga0495628_0043916_1933_3522 396
209 3300046689 Ga0495613_0056399 Ga0495613_0056399_408_2003 396
210 3300047319 Ga0495674_0018894 Ga0495674_0018894_1805_3400 396
211 3300047322 Ga0495680_0000639 Ga0495680_0000639_33188_34804 396
212 3300047444 Ga0495675_0066281 Ga0495675_0066281_621_2237 396
213 3300007788 Ga0099795_10020387 Ga0099795_100203871 397
214 3300009094 Ga0111539_10109025 Ga0111539_101090253 397
215 3300025926 Ga0207659_10052888 Ga0207659_100528883 397
216 3300046511 Ga0495608_0004129 Ga0495608_0004129_7275_8864 397
217 3300046514 Ga0495618_0005022 Ga0495618_0005022_3740_5329 397
218 3300046516 Ga0495628_0009378 Ga0495628_0009378_694_2283 397
219 3300046533 Ga0495640_0040382 Ga0495640_0040382_418_2007 397
220 3300046535 Ga0495586_0076844 Ga0495586_0076844_98_1693 397
221 3300046536 Ga0495587_0000358 Ga0495587_0000358_25264_26853 397
222 3300046559 Ga0495667_0004007 Ga0495667_0004007_5686_7275 397
223 3300047317 Ga0495604_0000845 Ga0495604_0000845_12622_14211 397
224 3300047322 Ga0495680_0001497 Ga0495680_0001497_20812_22401 397
225 3300048088 Ga0495602_0047388 Ga0495602_0047388_878_2467 397
226 3300050511 nmdc:mga08y16_31650_c1 nmdc:mga08y16_31650_c1_714_2348 397
227 3300025915 Ga0207693_10034980 Ga0207693_100349802 400
228 3300048904 Ga0496101_0106914 Ga0496101_0106914_142_1701 400
229 3300048907 Ga0496104_0014252 Ga0496104_0014252_3325_4884 400
230 3300048912 Ga0496109_0050662 Ga0496109_0050662_1073_2632 400
231 3300005338 Ga0068868_100142838 Ga0068868_1001428381 401
232 3300005455 Ga0070663_100035879 Ga0070663_1000358792 401
233 3300005840 Ga0068870_10008675 Ga0068870_100086754 401
234 3300005841 Ga0068863_100065979 Ga0068863_1000659791 401
235 3300005842 Ga0068858_100200351 Ga0068858_1002003511 401
236 3300009177 Ga0105248_10122214 Ga0105248_101222142 401
237 3300009553 Ga0105249_10055286 Ga0105249_100552861 401
238 3300014968 Ga0157379_10052925 Ga0157379_100529253 401
239 3300025321 Ga0207656_10030083 Ga0207656_100300831 401
240 3300025899 Ga0207642_10005278 Ga0207642_100052783 401
241 3300025907 Ga0207645_10030736 Ga0207645_100307363 401
242 3300025918 Ga0207662_10041386 Ga0207662_100413862 401
243 3300025919 Ga0207657_10177345 Ga0207657_101773451 401
244 3300025920 Ga0207649_10033645 Ga0207649_100336452 401
245 3300025940 Ga0207691_10046977 Ga0207691_100469771 401
246 3300025942 Ga0207689_10029019 Ga0207689_100290193 401
247 3300026067 Ga0207678_10034073 Ga0207678_100340733 401
248 3300026089 Ga0207648_10045729 Ga0207648_100457293 401
249 3300026116 Ga0207674_10096190 Ga0207674_100961901 401
250 3300026118 Ga0207675_100038591 Ga0207675_1000385912 401
251 3300046794 Ga0495589_0072894 Ga0495589_0072894_70_1632 401
252 3300048903 Ga0496100_0071374 Ga0496100_0071374_398_1960 401
253 3300048904 Ga0496101_0055890 Ga0496101_0055890_1273_2835 401
254 3300048914 Ga0496111_0039379 Ga0496111_0039379_1426_2988 401
255 3300048916 Ga0496113_0002500 Ga0496113_0002500_8687_10249 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

25

106

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irp-assembly1.cif.gz_X crystal structure of functional region of uafa from staphylococcus saprophyticus at 1.50 angstrom resolution 0.826 23 109
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8245 27 109
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8158 240 319
3mn8-assembly1.cif.gz_A structure of drosophila melanogaster carboxypeptidase d isoform 1b short 0.8155 27 109
5i1z-assembly6.cif.gz_P structure of nvpizza2-h16s58 0.8134 243 319
ID Description Score Start End Superfamily
af_D3ZSA9_396_1214_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8678 24 110 2.60.40.10
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8571 27 108 2.60.40.1120
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8532 27 109 2.60.40.1120
af_A0A0P0V1K7_70_148_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8423 26 102 2.60.40.10
af_I1JQT5_407_1195_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8388 25 108 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V8W0L9-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.9563 22 109 GO:0009279
GO:0015344
AF-A0A843RUA1-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.9516 22 109 GO:0009279
GO:0015344
AF-A0A2V8KJB6-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9494 22 109 GO:0009279
GO:0015344
AF-A0A1Q6XCP1-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9484 26 109 GO:0009279
GO:0015344
AF-Q01PD9-F1-model_v4 TonB-dependent receptor 0.9466 22 109 GO:0009279
GO:0015344

Feature Viewer

pLDDT pTM Quality
77.72 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map