F365704

General Info

Members Datasets Scaffolds Average Seq Length
255 137 511 220

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10127433|Ga0157372_101274333
Length 243
Sequence MSHKFYCFQLTAHSFYFDCFFIFSPMSHNFQNELKKEFQLERMILFSDAVFAIAITLLAIEIKVPDIAHNIVNDQLLAQKLGELIPKFIGFFISFMVIGIYWIVHHRMFGYVTNYNQRLLWLNLFFLLAVVLMPFSSGFYSEYVMRRMKIPVILYICNITFLGIMGLVIWNYISNPKRNLSEGITPEMSKYFRFRSLVPPSAFLLLGILYFINPEIAVYVPILIPVTLRLFQRFYFKPQLKSK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 0.39
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 26.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10127433 3300013307 Bacteria 2927
2 SwRhRL2b_contig_1523083 2162886007 Bacteria 1409
3 rootH1_10009173 3300003316 Bacteria 1358
4 rootH1_10009173 3300003323 Bacteria 27749
5 JGI25160J50197_1000239 3300003354 Bacteria 42596
6 Ga0065714_10097400 3300005288 Bacteria 1736
7 Ga0065704_10131053 3300005289 Bacteria 1628
8 Ga0065704_10133628 3300005289 Bacteria 1569
9 Ga0065712_10009365 3300005290 Bacteria 3927
10 Ga0065712_10032310 3300005290 Bacteria 1084
11 Ga0065712_10094946 3300005290 Bacteria 2210
12 Ga0065707_10102438 3300005295 Bacteria 2805
13 Ga0070658_10578936 3300005327 Bacteria 972
14 Ga0070676_10013825 3300005328 Unclassified 4428
15 Ga0070683_100121422 3300005329 Unclassified 2468
16 Ga0070690_100240228 3300005330 Bacteria 1277
17 Ga0070670_100075696 3300005331 Unclassified 2892
18 Ga0070670_100335092 3300005331 Unclassified 1327
19 Ga0070670_100348692 3300005331 Unclassified 1300
20 Ga0070670_100665953 3300005331 Bacteria 934
21 Ga0068869_100095779 3300005334 Bacteria 2240
22 Ga0070666_10122067 3300005335 Bacteria 1807
23 Ga0070682_100283493 3300005337 Bacteria 1208
24 Ga0068868_100087406 3300005338 Unclassified 2507
25 Ga0068868_100390507 3300005338 Bacteria 1199
26 Ga0070689_100016184 3300005340 Bacteria 5453
27 Ga0070687_100008161 3300005343 Bacteria 4416
28 Ga0070687_100025445 3300005343 Unclassified 2840
29 Ga0070692_10110852 3300005345 Bacteria 1517
30 Ga0070668_100590255 3300005347 Bacteria 971
31 Ga0070668_100749378 3300005347 Unclassified 864
32 Ga0070669_100144881 3300005353 Bacteria 1834
33 Ga0070675_100276275 3300005354 Bacteria 1475
34 Ga0070675_100490758 3300005354 Unclassified 1106
35 Ga0070671_100029041 3300005355 Unclassified 4559
36 Ga0070671_100244432 3300005355 Bacteria 1524
37 Ga0070674_100187835 3300005356 Bacteria 1587
38 Ga0070673_100086681 3300005364 Bacteria 2551
39 Ga0070673_100471564 3300005364 Unclassified 1132
40 Ga0070673_100874624 3300005364 Bacteria 832
41 Ga0070688_100008958 3300005365 Bacteria 5451
42 Ga0070688_100274320 3300005365 Bacteria 1209
43 Ga0070688_100362379 3300005365 Unclassified 1064
44 Ga0070688_100440700 3300005365 Bacteria 972
45 Ga0070701_10011972 3300005438 Bacteria 3896
46 Ga0070663_100109368 3300005455 Bacteria 2075
47 Ga0070678_100262097 3300005456 Bacteria 1454
48 Ga0070678_100682295 3300005456 Bacteria 924
49 Ga0070678_100783983 3300005456 Bacteria 864
50 Ga0068867_100095920 3300005459 Bacteria 2257
51 Ga0068867_100607096 3300005459 Unclassified 955
52 Ga0070685_10024392 3300005466 Unclassified 3321
53 Ga0070698_100001314 3300005471 Bacteria 27660
54 Ga0070698_100015839 3300005471 Bacteria 7962
55 Ga0070684_100076533 3300005535 Unclassified 2953
56 Ga0068853_100027229 3300005539 Unclassified 4802
57 Ga0068853_100316065 3300005539 Unclassified 1447
58 Ga0068853_100755997 3300005539 Bacteria 929
59 Ga0070672_100025499 3300005543 Unclassified 4386
60 Ga0070672_100088718 3300005543 Bacteria 2490
61 Ga0070686_100056459 3300005544 Unclassified 2519
62 Ga0070686_100862663 3300005544 Bacteria 734
63 Ga0070704_100095705 3300005549 Unclassified 2224
64 Ga0068855_100010889 3300005563 Bacteria 10978
65 Ga0070664_100001016 3300005564 Bacteria 22026
66 Ga0070664_100426296 3300005564 Unclassified 1215
67 Ga0070664_100443600 3300005564 Bacteria 1191
68 Ga0068857_100036932 3300005577 Bacteria 4327
69 Ga0068857_100096053 3300005577 Bacteria 2656
70 Ga0068854_100662928 3300005578 Bacteria 897
71 Ga0068856_100023122 3300005614 Bacteria 6046
72 Ga0068852_100333510 3300005616 Unclassified 1476
73 Ga0068859_100240782 3300005617 Bacteria 1898
74 Ga0068859_100286000 3300005617 Bacteria 1742
75 Ga0068859_100301345 3300005617 Unclassified 1696
76 Ga0068864_100085917 3300005618 Unclassified 2767
77 Ga0068864_100099860 3300005618 Bacteria 2572
78 Ga0068864_100378918 3300005618 Bacteria 1340
79 Ga0068864_100477956 3300005618 Bacteria 1196
80 Ga0068861_100500138 3300005719 Bacteria 1099
81 Ga0068851_10112845 3300005834 Unclassified 1453
82 Ga0068870_10039496 3300005840 Bacteria 2442
83 Ga0068863_100024759 3300005841 Bacteria 5725
84 Ga0068863_100099178 3300005841 Bacteria 2767
85 Ga0068863_100254669 3300005841 Bacteria 1696
86 Ga0068858_100435293 3300005842 Bacteria 1262
87 Ga0068858_100935083 3300005842 Bacteria 848
88 Ga0068860_100000691 3300005843 Bacteria 38802
89 Ga0068860_100174130 3300005843 Bacteria 2079
90 Ga0068860_100995633 3300005843 Bacteria 856
91 Ga0068862_100254148 3300005844 Bacteria 1602
92 Ga0068862_100341949 3300005844 Unclassified 1386
93 Ga0068862_101010377 3300005844 Bacteria 823
94 Ga0075366_10099479 3300006195 Bacteria 1745
95 Ga0097621_100411253 3300006237 Bacteria 1213
96 Ga0097621_100652864 3300006237 Bacteria 965
97 Ga0068871_100161252 3300006358 Bacteria 1918
98 Ga0068871_100182934 3300006358 Unclassified 1802
99 Ga0068871_100193751 3300006358 Bacteria 1752
100 Ga0068871_100556258 3300006358 Bacteria 1040
101 Ga0068871_100763210 3300006358 Bacteria 890
102 Ga0075428_100639625 3300006844 Bacteria 1135
103 Ga0068865_100113370 3300006881 Bacteria 2004
104 Ga0068865_100253754 3300006881 Bacteria 1389
105 Ga0068865_100464511 3300006881 Unclassified 1049
106 Ga0097620_100240769 3300006931 Bacteria 1898
107 Ga0097620_100286003 3300006931 Bacteria 1742
108 Ga0097620_100301367 3300006931 Unclassified 1696
109 Ga0105240_10378127 3300009093 Unclassified 1600
110 Ga0111539_10121684 3300009094 Bacteria 3058
111 Ga0111539_10685229 3300009094 Bacteria 1193
112 Ga0105247_10001033 3300009101 Bacteria 20949
113 Ga0114129_10013112 3300009147 Bacteria 11805
114 Ga0105242_10034241 3300009176 Bacteria 4072
115 Ga0105242_10116112 3300009176 Unclassified 2289
116 Ga0105242_10425187 3300009176 Bacteria 1246
117 Ga0105242_10511891 3300009176 Unclassified 1143
118 Ga0105237_10028357 3300009545 Bacteria 5703
119 Ga0105249_10006402 3300009553 Bacteria 10239
120 Ga0105249_10033020 3300009553 Unclassified 4685
121 Ga0105249_10276535 3300009553 Bacteria 1675
122 Ga0105249_10761030 3300009553 Bacteria 1031
123 Ga0105246_10694370 3300011119 Bacteria 891
124 Ga0157371_10020910 3300013102 Bacteria 4813
125 Ga0157371_10300141 3300013102 Bacteria 1163
126 Ga0157370_10391122 3300013104 Bacteria 1280
127 Ga0157370_10853774 3300013104 Bacteria 827
128 Ga0157370_10948095 3300013104 Bacteria 780
129 Ga0157374_10082226 3300013296 Unclassified 3057
130 Ga0157374_10110081 3300013296 Bacteria 2649
131 Ga0157374_10154996 3300013296 Unclassified 2229
132 Ga0157378_10067398 3300013297 Unclassified 3207
133 Ga0163162_10038153 3300013306 Bacteria 4795
134 Ga0163162_10092605 3300013306 Bacteria 3106
135 Ga0163162_10473335 3300013306 Bacteria 1384
136 Ga0163162_11124093 3300013306 Bacteria 890
137 Ga0157372_10002594 3300013307 Bacteria 19562
138 Ga0157372_10153094 3300013307 Bacteria 2662
139 Ga0157372_10222669 3300013307 Bacteria 2187
140 Ga0157372_10567657 3300013307 Bacteria 1323
141 Ga0157372_11256203 3300013307 Bacteria 855
142 Ga0157375_10067265 3300013308 Unclassified 3580
143 Ga0157375_10234770 3300013308 Unclassified 1993
144 Ga0157375_10714637 3300013308 Bacteria 1155
145 Ga0157375_11016370 3300013308 Unclassified 968
146 Ga0163163_10006337 3300014325 Bacteria 10331
147 Ga0163163_10122703 3300014325 Unclassified 2633
148 Ga0163163_10158819 3300014325 Bacteria 2306
149 Ga0157380_10001704 3300014326 Bacteria 14521
150 Ga0157380_10059942 3300014326 Bacteria 3039
151 Ga0157380_10792217 3300014326 Bacteria 964
152 Ga0157377_10002237 3300014745 Bacteria 8502
153 Ga0157377_10030349 3300014745 Unclassified 2928
154 Ga0157377_10264485 3300014745 Unclassified 1120
155 Ga0157379_10117812 3300014968 Unclassified 2389
156 Ga0157376_11085467 3300014969 Bacteria 826
157 Ga0163161_10200104 3300017792 Bacteria 1539
158 Ga0207426_1000052 3300025302 Bacteria 389825
159 Ga0207656_10028237 3300025321 Unclassified 2301
160 Ga0207656_10058265 3300025321 Bacteria 1687
161 Ga0207682_10007081 3300025893 Bacteria 4493
162 Ga0207682_10056221 3300025893 Unclassified 1638
163 Ga0207710_10002139 3300025900 Bacteria 9322
164 Ga0207688_10013017 3300025901 Unclassified 4523
165 Ga0207680_10042847 3300025903 Bacteria 2651
166 Ga0207645_10016092 3300025907 Unclassified 4952
167 Ga0207645_10156038 3300025907 Bacteria 1491
168 Ga0207643_10003543 3300025908 Bacteria 8404
169 Ga0207643_10054981 3300025908 Bacteria 2263
170 Ga0207695_10386025 3300025913 Unclassified 1285
171 Ga0207662_10004557 3300025918 Bacteria 7300
172 Ga0207662_10047614 3300025918 Bacteria 2539
173 Ga0207681_10073239 3300025923 Bacteria 2395
174 Ga0207681_10428473 3300025923 Bacteria 1073
175 Ga0207650_10000886 3300025925 Bacteria 22639
176 Ga0207650_10025239 3300025925 Bacteria 4233
177 Ga0207650_10272781 3300025925 Unclassified 1375
178 Ga0207659_10004093 3300025926 Bacteria 8796
179 Ga0207644_10027678 3300025931 Unclassified 3918
180 Ga0207644_10050707 3300025931 Bacteria 2976
181 Ga0207686_10000566 3300025934 Bacteria 23556
182 Ga0207686_10263998 3300025934 Bacteria 1263
183 Ga0207686_10405453 3300025934 Bacteria 1039
184 Ga0207686_10546783 3300025934 Unclassified 905
185 Ga0207670_10004939 3300025936 Bacteria 7259
186 Ga0207704_10287119 3300025938 Bacteria 1253
187 Ga0207691_10006510 3300025940 Bacteria 11271
188 Ga0207691_10007698 3300025940 Bacteria 10369
189 Ga0207691_10040067 3300025940 Bacteria 4331
190 Ga0207691_10049604 3300025940 Bacteria 3846
191 Ga0207691_10051553 3300025940 Bacteria 3762
192 Ga0207691_10526443 3300025940 Bacteria 1003
193 Ga0207689_10098793 3300025942 Bacteria 2398
194 Ga0207689_10478732 3300025942 Bacteria 1042
195 Ga0207679_10094144 3300025945 Unclassified 2325
196 Ga0207667_10017427 3300025949 Bacteria 8085
197 Ga0207651_10070039 3300025960 Unclassified 2479
198 Ga0207651_10080697 3300025960 Bacteria 2342
199 Ga0207712_10006003 3300025961 Bacteria 7665
200 Ga0207712_10023142 3300025961 Bacteria 4097
201 Ga0207712_10043864 3300025961 Bacteria 3087
202 Ga0207712_10094581 3300025961 Unclassified 2208
203 Ga0207640_10645229 3300025981 Unclassified 901
204 Ga0207639_10006367 3300026041 Bacteria 8018
205 Ga0207639_10090305 3300026041 Bacteria 2450
206 Ga0207639_10485706 3300026041 Unclassified 1126
207 Ga0207639_11020967 3300026041 Bacteria 775
208 Ga0207708_10194066 3300026075 Bacteria 1618
209 Ga0207702_10024542 3300026078 Bacteria 5003
210 Ga0207641_10005426 3300026088 Bacteria 10884
211 Ga0207641_10152787 3300026088 Bacteria 2092
212 Ga0207641_10633237 3300026088 Bacteria 1049
213 Ga0207648_10142597 3300026089 Unclassified 2112
214 Ga0207676_10028637 3300026095 Bacteria 4163
215 Ga0207676_10205347 3300026095 Unclassified 1744
216 Ga0207676_10588394 3300026095 Bacteria 1067
217 Ga0207674_10020171 3300026116 Bacteria 7209
218 Ga0207674_10074285 3300026116 Bacteria 3412
219 Ga0207675_100033929 3300026118 Bacteria 4756
220 Ga0207675_100182408 3300026118 Unclassified 2010
221 Ga0207675_100750699 3300026118 Bacteria 987
222 Ga0207683_10148913 3300026121 Bacteria 2112
223 Ga0207683_10155353 3300026121 Unclassified 2066
224 Ga0207683_10406434 3300026121 Bacteria 1253
225 Ga0207698_10276363 3300026142 Bacteria 1551
226 Ga0207698_10366375 3300026142 Bacteria 1366
227 Ga0207428_10030792 3300027907 Unclassified 4433
228 Ga0268265_10643157 3300028380 Bacteria 1019
229 Ga0268264_10001799 3300028381 Bacteria 19596
230 Ga0268264_10409516 3300028381 Bacteria 1305
231 Ga0268264_10955924 3300028381 Bacteria 862
232 Ga0307509_10062664 3300031507 Bacteria 3920
233 Ga0373925_0724506 3300037068 Unclassified 820
234 Ga0451802_0670374 3300041460 Unclassified 1725
235 Ga0451839_0149080 3300041496 Unclassified 827
236 Ga0451851_0013138 3300041507 Bacteria 1473
237 Ga0451843_1174679 3300041509 Bacteria 901
238 Ga0451853_3270649 3300041512 Unclassified 1255
239 Ga0466972_0000080 3300044658 Bacteria 89226
240 Ga0466972_0027589 3300044658 Bacteria 2808
241 Ga0466957_0016317 3300044842 Bacteria 4344
242 Ga0495638_0120904 3300046460 Bacteria 1548
243 Ga0495632_0083404 3300046519 Bacteria 1522
244 Ga0495672_0014024 3300047320 Bacteria 5506
245 Ga0495672_0030459 3300047320 Bacteria 3384
246 Ga0495686_0296962 3300047472 Unclassified 893
247 Ga0501043_0157381 3300049579 Bacteria 1777
248 Ga0501047_0063468 3300049581 Bacteria 3563
249 nmdc:mga0k408_95511_c1 3300050493 Bacteria 1749
250 nmdc:mga05p37_3268_c1 3300050507 Bacteria 18878
251 nmdc:mga08y16_1103269_c1 3300050511 Bacteria 768
252 nmdc:mga08y16_160859_c1 3300050511 Unclassified 2333
253 Ga0500583_0000001 3300053092 Bacteria 241642
254 Ga0500583_0000611 3300053092 Bacteria 10635
255 Ga0500651_0307700 3300053093 Bacteria 908
256 Ga0500603_038738 3300053150 Unclassified 1263
257 Ga0157372_10127433
258 SwRhRL2b_contig_1523083
259 rootH1_10009173
260 JGI25160J50197_1000239
261 Ga0065714_10097400
262 Ga0065704_10131053
263 Ga0065704_10133628
264 Ga0065712_10009365
265 Ga0065712_10032310
266 Ga0065712_10094946
267 Ga0065707_10102438
268 Ga0070658_10578936
269 Ga0070676_10013825
270 Ga0070683_100121422
271 Ga0070690_100240228
272 Ga0070670_100075696
273 Ga0070670_100335092
274 Ga0070670_100348692
275 Ga0070670_100665953
276 Ga0068869_100095779
277 Ga0070666_10122067
278 Ga0070682_100283493
279 Ga0068868_100087406
280 Ga0068868_100390507
281 Ga0070689_100016184
282 Ga0070687_100008161
283 Ga0070687_100025445
284 Ga0070692_10110852
285 Ga0070668_100590255
286 Ga0070668_100749378
287 Ga0070669_100144881
288 Ga0070675_100276275
289 Ga0070675_100490758
290 Ga0070671_100029041
291 Ga0070671_100244432
292 Ga0070674_100187835
293 Ga0070673_100086681
294 Ga0070673_100471564
295 Ga0070673_100874624
296 Ga0070688_100008958
297 Ga0070688_100274320
298 Ga0070688_100362379
299 Ga0070688_100440700
300 Ga0070701_10011972
301 Ga0070663_100109368
302 Ga0070678_100262097
303 Ga0070678_100682295
304 Ga0070678_100783983
305 Ga0068867_100095920
306 Ga0068867_100607096
307 Ga0070685_10024392
308 Ga0070698_100001314
309 Ga0070698_100015839
310 Ga0070684_100076533
311 Ga0068853_100027229
312 Ga0068853_100316065
313 Ga0068853_100755997
314 Ga0070672_100025499
315 Ga0070672_100088718
316 Ga0070686_100056459
317 Ga0070686_100862663
318 Ga0070704_100095705
319 Ga0068855_100010889
320 Ga0070664_100001016
321 Ga0070664_100426296
322 Ga0070664_100443600
323 Ga0068857_100036932
324 Ga0068857_100096053
325 Ga0068854_100662928
326 Ga0068856_100023122
327 Ga0068852_100333510
328 Ga0068859_100240782
329 Ga0068859_100286000
330 Ga0068859_100301345
331 Ga0068864_100085917
332 Ga0068864_100099860
333 Ga0068864_100378918
334 Ga0068864_100477956
335 Ga0068861_100500138
336 Ga0068851_10112845
337 Ga0068870_10039496
338 Ga0068863_100024759
339 Ga0068863_100099178
340 Ga0068863_100254669
341 Ga0068858_100435293
342 Ga0068858_100935083
343 Ga0068860_100000691
344 Ga0068860_100174130
345 Ga0068860_100995633
346 Ga0068862_100254148
347 Ga0068862_100341949
348 Ga0068862_101010377
349 Ga0075366_10099479
350 Ga0097621_100411253
351 Ga0097621_100652864
352 Ga0068871_100161252
353 Ga0068871_100182934
354 Ga0068871_100193751
355 Ga0068871_100556258
356 Ga0068871_100763210
357 Ga0075428_100639625
358 Ga0068865_100113370
359 Ga0068865_100253754
360 Ga0068865_100464511
361 Ga0097620_100240769
362 Ga0097620_100286003
363 Ga0097620_100301367
364 Ga0105240_10378127
365 Ga0111539_10121684
366 Ga0111539_10685229
367 Ga0105247_10001033
368 Ga0114129_10013112
369 Ga0105242_10034241
370 Ga0105242_10116112
371 Ga0105242_10425187
372 Ga0105242_10511891
373 Ga0105237_10028357
374 Ga0105249_10006402
375 Ga0105249_10033020
376 Ga0105249_10276535
377 Ga0105249_10761030
378 Ga0105246_10694370
379 Ga0157371_10020910
380 Ga0157371_10300141
381 Ga0157370_10391122
382 Ga0157370_10853774
383 Ga0157370_10948095
384 Ga0157374_10082226
385 Ga0157374_10110081
386 Ga0157374_10154996
387 Ga0157378_10067398
388 Ga0163162_10038153
389 Ga0163162_10092605
390 Ga0163162_10473335
391 Ga0163162_11124093
392 Ga0157372_10002594
393 Ga0157372_10153094
394 Ga0157372_10222669
395 Ga0157372_10567657
396 Ga0157372_11256203
397 Ga0157375_10067265
398 Ga0157375_10234770
399 Ga0157375_10714637
400 Ga0157375_11016370
401 Ga0163163_10006337
402 Ga0163163_10122703
403 Ga0163163_10158819
404 Ga0157380_10001704
405 Ga0157380_10059942
406 Ga0157380_10792217
407 Ga0157377_10002237
408 Ga0157377_10030349
409 Ga0157377_10264485
410 Ga0157379_10117812
411 Ga0157376_11085467
412 Ga0163161_10200104
413 Ga0207426_1000052
414 Ga0207656_10028237
415 Ga0207656_10058265
416 Ga0207682_10007081
417 Ga0207682_10056221
418 Ga0207710_10002139
419 Ga0207688_10013017
420 Ga0207680_10042847
421 Ga0207645_10016092
422 Ga0207645_10156038
423 Ga0207643_10003543
424 Ga0207643_10054981
425 Ga0207695_10386025
426 Ga0207662_10004557
427 Ga0207662_10047614
428 Ga0207681_10073239
429 Ga0207681_10428473
430 Ga0207650_10000886
431 Ga0207650_10025239
432 Ga0207650_10272781
433 Ga0207659_10004093
434 Ga0207644_10027678
435 Ga0207644_10050707
436 Ga0207686_10000566
437 Ga0207686_10263998
438 Ga0207686_10405453
439 Ga0207686_10546783
440 Ga0207670_10004939
441 Ga0207704_10287119
442 Ga0207691_10006510
443 Ga0207691_10007698
444 Ga0207691_10040067
445 Ga0207691_10049604
446 Ga0207691_10051553
447 Ga0207691_10526443
448 Ga0207689_10098793
449 Ga0207689_10478732
450 Ga0207679_10094144
451 Ga0207667_10017427
452 Ga0207651_10070039
453 Ga0207651_10080697
454 Ga0207712_10006003
455 Ga0207712_10023142
456 Ga0207712_10043864
457 Ga0207712_10094581
458 Ga0207640_10645229
459 Ga0207639_10006367
460 Ga0207639_10090305
461 Ga0207639_10485706
462 Ga0207639_11020967
463 Ga0207708_10194066
464 Ga0207702_10024542
465 Ga0207641_10005426
466 Ga0207641_10152787
467 Ga0207641_10633237
468 Ga0207648_10142597
469 Ga0207676_10028637
470 Ga0207676_10205347
471 Ga0207676_10588394
472 Ga0207674_10020171
473 Ga0207674_10074285
474 Ga0207675_100033929
475 Ga0207675_100182408
476 Ga0207675_100750699
477 Ga0207683_10148913
478 Ga0207683_10155353
479 Ga0207683_10406434
480 Ga0207698_10276363
481 Ga0207698_10366375
482 Ga0207428_10030792
483 Ga0268265_10643157
484 Ga0268264_10001799
485 Ga0268264_10409516
486 Ga0268264_10955924
487 Ga0307509_10062664
488 Ga0373925_0724506
489 Ga0451802_0670374
490 Ga0451839_0149080
491 Ga0451851_0013138
492 Ga0451843_1174679
493 Ga0451853_3270649
494 Ga0466972_0000080
495 Ga0466972_0027589
496 Ga0466957_0016317
497 Ga0495638_0120904
498 Ga0495632_0083404
499 Ga0495672_0014024
500 Ga0495672_0030459
501 Ga0495686_0296962
502 Ga0501043_0157381
503 Ga0501047_0063468
504 nmdc:mga0k408_95511_c1
505 nmdc:mga05p37_3268_c1
506 nmdc:mga08y16_1103269_c1
507 nmdc:mga08y16_160859_c1
508 Ga0500583_0000001
509 Ga0500583_0000611
510 Ga0500651_0307700
511 Ga0500603_038738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

42

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8551 12 184
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.7623 16 206
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.7565 12 184
8fyf-assembly1.cif.gz_B human tmem175-lamp1 transmembrane domain only complex 0.7429 16 176
6w8p-assembly1.cif.gz_A structure of membrane protein with ions 0.7394 16 210
ID Description Score Start End Superfamily
af_Q9CXY1_32_121_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8399 18 109 1.20.1300.10
af_Q9CXY1_32_121_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8236 18 109 1.20.1300.10
af_Q9BSA9_260_356_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7909 18 106 1.20.1300.10
af_Q9BSA9_260_356_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.722 18 106 1.20.1300.10
af_E1JH38_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6144 67 190 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7Y7NFV5-F1-model_v4 DUF1211 domain-containing protein 0.959 15 147 GO:0005267
GO:0015252
GO:0016020
AF-A0A536QAK8-F1-model_v4 DUF1211 domain-containing protein 0.9511 16 145 GO:0005267
GO:0015252
GO:0016020
AF-A0A534IGJ0-F1-model_v4 DUF1211 domain-containing protein 0.9469 15 184 GO:0005267
GO:0015252
GO:0016020
AF-A0A523UDF1-F1-model_v4 DUF1211 domain-containing protein 0.9434 15 168 GO:0005267
GO:0015252
GO:0016020
AF-A0A7C6V869-F1-model_v4 DUF1211 domain-containing protein 0.9432 16 187 GO:0005267
GO:0015252
GO:0016020

Map