F365629

General Info

Members Datasets Scaffolds Average Seq Length
255 160 254 367

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10005878|Ga0105240_100058784
Length 399
Sequence MFPDVPKFRRLLTLAVGAKGVFLMKISRRNLIQTAGIAALASPAASAAGTMPENKFEGKDTPKICLAMGDSGTGQQDIKAQSRRLRQLGVDHVLGGGPRIPWEESRLKEQIAGLKENGITLGNLMISGFDSAIYARPNRDEDIAKVIASIQAAGKAGLPVVEYNWYAHRAMEGYFEEEGRAGAGWTGFDYERLVDDNGNKVPFKDLPALEREGAHTLDEMWSTITYFLKKVIPECEKAGVRLALHPNDPPAPVSRKSQQIMGTVDGWKKLIDIVKSPCNGITFDCGVTKEMGQDPVEVCRYFASRDRINHVHFRNVKVKKPYERYSEVFIDEGENNMFAVMRELVKNKYTRMIYPEHPRAIDYDRDRGKLGGYPGGGGYTAFAFNVGYTRAMMQAALTV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 4.71
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10082153 3300005290 Bacteria 2943
2 Ga0070658_10396740 3300005327 Unclassified 1185
3 Ga0070683_100001674 3300005329 Bacteria 17207
4 Ga0070683_100057315 3300005329 Bacteria 3619
5 Ga0070670_100002074 3300005331 Bacteria 16409
6 Ga0070670_100005663 3300005331 Bacteria 10544
7 Ga0070680_100016830 3300005336 Bacteria 5753
8 Ga0070680_100115753 3300005336 Bacteria 2234
9 Ga0070689_100051328 3300005340 Bacteria 3188
10 Ga0070661_100227157 3300005344 Unclassified 1433
11 Ga0070669_100034455 3300005353 Unclassified 3665
12 Ga0070669_100256567 3300005353 Bacteria 1394
13 Ga0070671_100360341 3300005355 Bacteria 1241
14 Ga0070673_100340825 3300005364 Bacteria 1328
15 Ga0070659_100107550 3300005366 Bacteria 2249
16 Ga0070659_100128089 3300005366 Bacteria 2060
17 Ga0070714_100246923 3300005435 Bacteria 1649
18 Ga0070713_100005443 3300005436 Bacteria 8700
19 Ga0070713_100081115 3300005436 Unclassified 2767
20 Ga0070711_100060412 3300005439 Bacteria 2635
21 Ga0070705_100058319 3300005440 Bacteria 2281
22 Ga0070708_100073686 3300005445 Bacteria 3078
23 Ga0070708_100206102 3300005445 Bacteria 1842
24 Ga0070708_100221907 3300005445 Bacteria 1773
25 Ga0070663_100019714 3300005455 Bacteria 4453
26 Ga0070678_100116930 3300005456 Bacteria 2096
27 Ga0070681_10010690 3300005458 Bacteria 9073
28 Ga0070681_10022035 3300005458 Bacteria 6393
29 Ga0070681_10069615 3300005458 Bacteria 3485
30 Ga0070681_10280813 3300005458 Bacteria 1576
31 Ga0070681_10317919 3300005458 Bacteria 1466
32 Ga0070706_100076846 3300005467 Bacteria 3090
33 Ga0070706_100200349 3300005467 Bacteria 1865
34 Ga0070707_100129071 3300005468 Unclassified 2457
35 Ga0070698_100313207 3300005471 Unclassified 1500
36 Ga0070679_100001698 3300005530 Bacteria 19852
37 Ga0070679_100035107 3300005530 Bacteria 4974
38 Ga0070684_100003840 3300005535 Bacteria 11360
39 Ga0070684_100261579 3300005535 Bacteria 1583
40 Ga0070695_100033596 3300005545 Bacteria 3210
41 Ga0070695_100105554 3300005545 Bacteria 1904
42 Ga0070696_100001479 3300005546 Bacteria 15380
43 Ga0070693_100054836 3300005547 Bacteria 2294
44 Ga0070665_100153246 3300005548 Bacteria 2307
45 Ga0068855_100007179 3300005563 Bacteria 13518
46 Ga0070664_100074192 3300005564 Bacteria 2920
47 Ga0068857_100016203 3300005577 Bacteria 6529
48 Ga0068857_100212677 3300005577 Bacteria 1765
49 Ga0068852_100061151 3300005616 Bacteria 3272
50 Ga0068852_100290095 3300005616 Unclassified 1580
51 Ga0068859_100068584 3300005617 Unclassified 3581
52 Ga0068864_100449433 3300005618 Unclassified 1232
53 Ga0068863_100167804 3300005841 Bacteria 2105
54 Ga0068858_100086927 3300005842 Bacteria 2908
55 Ga0068860_100013770 3300005843 Bacteria 7929
56 Ga0068862_100013103 3300005844 Bacteria 6857
57 Ga0068862_100092645 3300005844 Bacteria 2634
58 Ga0075368_10037568 3300006042 Bacteria 1894
59 Ga0075367_10060382 3300006178 Bacteria 2260
60 Ga0097621_100195722 3300006237 Bacteria 1752
61 Ga0075428_100048089 3300006844 Bacteria 4682
62 Ga0075430_100054472 3300006846 Unclassified 3365
63 Ga0075431_100070076 3300006847 Unclassified 3617
64 Ga0075431_100213657 3300006847 Bacteria 1970
65 Ga0075433_10008951 3300006852 Bacteria 7993
66 Ga0075434_100005362 3300006871 Bacteria 11666
67 Ga0075434_100051735 3300006871 Bacteria 4081
68 Ga0075436_100012450 3300006914 Bacteria 5830
69 Ga0097620_100068584 3300006931 Unclassified 3581
70 Ga0105240_10000159 3300009093 Bacteria 137832
71 Ga0105240_10001026 3300009093 Bacteria 49581
72 Ga0105240_10005878 3300009093 Bacteria 18173
73 Ga0105240_10011874 3300009093 Bacteria 12085
74 Ga0105240_10030357 3300009093 Bacteria 7025
75 Ga0105240_10041033 3300009093 Bacteria 5912
76 Ga0111539_10029418 3300009094 Bacteria 6690
77 Ga0111539_10082160 3300009094 Bacteria 3789
78 Ga0111539_10171132 3300009094 Bacteria 2538
79 Ga0105245_10426811 3300009098 Bacteria 1330
80 Ga0114129_10005526 3300009147 Bacteria 17880
81 Ga0114129_10013486 3300009147 Bacteria 11646
82 Ga0114129_10013693 3300009147 Bacteria 11557
83 Ga0114129_10081841 3300009147 Bacteria 4488
84 Ga0114129_10219502 3300009147 Bacteria 2565
85 Ga0105248_10022956 3300009177 Bacteria 6928
86 Ga0105248_10102088 3300009177 Bacteria 3233
87 Ga0105248_10300227 3300009177 Unclassified 1808
88 Ga0105237_10023059 3300009545 Bacteria 6382
89 Ga0105237_10038922 3300009545 Bacteria 4802
90 Ga0105237_10270594 3300009545 Unclassified 1702
91 Ga0105249_10040143 3300009553 Bacteria 4250
92 Ga0105249_10183176 3300009553 Bacteria 2039
93 Ga0105249_10187878 3300009553 Unclassified 2014
94 Ga0105246_10029978 3300011119 Bacteria 3588
95 Ga0157370_10099450 3300013104 Bacteria 2726
96 Ga0157369_10001393 3300013105 Bacteria 29688
97 Ga0157369_10032546 3300013105 Bacteria 5733
98 Ga0157374_10012210 3300013296 Bacteria 7465
99 Ga0163162_10253472 3300013306 Unclassified 1892
100 Ga0157372_10077674 3300013307 Bacteria 3751
101 Ga0163163_10009305 3300014325 Bacteria 8763
102 Ga0163163_10045701 3300014325 Bacteria 4299
103 Ga0163163_10161255 3300014325 Bacteria 2288
104 Ga0157380_10025793 3300014326 Bacteria 4460
105 Ga0157380_10156508 3300014326 Bacteria 1976
106 Ga0157380_10222121 3300014326 Unclassified 1691
107 Ga0157376_10102668 3300014969 Bacteria 2502
108 Ga0157376_10254111 3300014969 Bacteria 1643
109 Ga0213876_10035445 3300021384 Unclassified 2631
110 Ga0207707_10021240 3300025912 Bacteria 5674
111 Ga0207707_10111654 3300025912 Bacteria 2390
112 Ga0207707_10226496 3300025912 Bacteria 1627
113 Ga0207695_10001048 3300025913 Bacteria 48552
114 Ga0207695_10012474 3300025913 Bacteria 10200
115 Ga0207695_10068555 3300025913 Bacteria 3634
116 Ga0207695_10144076 3300025913 Bacteria 2328
117 Ga0207695_10200021 3300025913 Bacteria 1912
118 Ga0207671_10065040 3300025914 Unclassified 2712
119 Ga0207663_10087273 3300025916 Unclassified 2060
120 Ga0207663_10153344 3300025916 Bacteria 1618
121 Ga0207660_10091019 3300025917 Bacteria 2261
122 Ga0207649_10061279 3300025920 Unclassified 2367
123 Ga0207652_10115409 3300025921 Bacteria 2385
124 Ga0207652_10406729 3300025921 Bacteria 1228
125 Ga0207646_10000723 3300025922 Bacteria 42789
126 Ga0207646_10001254 3300025922 Bacteria 31799
127 Ga0207646_10306671 3300025922 Unclassified 1434
128 Ga0207681_10107227 3300025923 Bacteria 2026
129 Ga0207681_10119327 3300025923 Bacteria 1932
130 Ga0207681_10274663 3300025923 Unclassified 1324
131 Ga0207650_10001523 3300025925 Bacteria 16583
132 Ga0207700_10039125 3300025928 Bacteria 3449
133 Ga0207700_10366921 3300025928 Bacteria 1256
134 Ga0207690_10077911 3300025932 Bacteria 2305
135 Ga0207670_10292654 3300025936 Bacteria 1272
136 Ga0207711_10103435 3300025941 Bacteria 2522
137 Ga0207711_10228173 3300025941 Unclassified 1705
138 Ga0207661_10002309 3300025944 Bacteria 13133
139 Ga0207667_10007094 3300025949 Bacteria 13529
140 Ga0207651_10077262 3300025960 Unclassified 2383
141 Ga0207712_10072369 3300025961 Unclassified 2482
142 Ga0207703_10100586 3300026035 Bacteria 2450
143 Ga0207678_10047185 3300026067 Bacteria 3725
144 Ga0207674_10023997 3300026116 Bacteria 6522
145 Ga0207675_100071984 3300026118 Bacteria 3232
146 Ga0207675_100133867 3300026118 Bacteria 2351
147 Ga0207683_10303489 3300026121 Bacteria 1461
148 Ga0207698_10023197 3300026142 Bacteria 4330
149 Ga0209813_10021485 3300027866 Bacteria 1815
150 Ga0207428_10026988 3300027907 Bacteria 4785
151 Ga0268266_10250485 3300028379 Unclassified 1638
152 Ga0268265_10044978 3300028380 Bacteria 3291
153 Ga0268264_10014426 3300028381 Bacteria 6493
154 Ga0268264_10134768 3300028381 Bacteria 2194
155 Ga0265323_10000374 3300028653 Bacteria 25844
156 Ga0265338_10016277 3300028800 Bacteria 8103
157 Ga0265324_10011277 3300029957 Bacteria 3411
158 Ga0265320_10000657 3300031240 Bacteria 26403
159 Ga0265329_10037048 3300031242 Bacteria 1571
160 Ga0265331_10002399 3300031250 Bacteria 12696
161 Ga0265316_10002559 3300031344 Bacteria 18799
162 Ga0265316_10008536 3300031344 Bacteria 9499
163 Ga0265316_10047097 3300031344 Bacteria 3413
164 Ga0265314_10008601 3300031711 Bacteria 8731
165 Ga0265342_10023720 3300031712 Bacteria 3879
166 Ga0373927_0001131 3300035695 Bacteria 20194
167 Ga0373927_0292044 3300035695 Unclassified 1073
168 Ga0373947_0008060 3300035725 Bacteria 6076
169 Ga0373937_0108737 3300036401 Bacteria 2578
170 Ga0373937_0134037 3300036401 Bacteria 2315
171 Ga0373925_0000155 3300037068 Bacteria 73370
172 Ga0373925_0208389 3300037068 Unclassified 1557
173 Ga0373925_0216982 3300037068 Unclassified 1526
174 Ga0395900_0443847 3300037418 Unclassified 1255
175 Ga0436364_1369486 3300037853 Bacteria 15303
176 Ga0436365_1596896 3300039437 Unclassified 4895
177 Ga0436365_1688252 3300039437 Unclassified 2139
178 Ga0436362_0186296 3300039453 Bacteria 1366
179 Ga0451577_0259104 3300042876 Unclassified 1575
180 Ga0466963_0084404 3300044694 Bacteria 2155
181 Ga0466963_0227937 3300044694 Unclassified 1305
182 Ga0466957_0053785 3300044842 Bacteria 2456
183 Ga0466967_0081948 3300045976 Bacteria 2915
184 Ga0495592_0031727 3300046454 Bacteria 3991
185 Ga0495651_0011063 3300046462 Bacteria 6943
186 Ga0495580_0016674 3300046472 Bacteria 5513
187 Ga0495580_0027159 3300046472 Bacteria 4166
188 Ga0495662_0015390 3300046476 Bacteria 3715
189 Ga0495664_0002103 3300046477 Bacteria 10646
190 Ga0495628_0020108 3300046516 Bacteria 5509
191 Ga0495630_0026964 3300046517 Bacteria 4258
192 Ga0495652_0025042 3300046529 Bacteria 5280
193 Ga0495665_0036174 3300046531 Bacteria 2636
194 Ga0495640_0046353 3300046533 Bacteria 3012
195 Ga0495667_0027604 3300046559 Bacteria 3823
196 Ga0495667_0095045 3300046559 Bacteria 1930
197 Ga0495635_0156392 3300046663 Bacteria 1551
198 Ga0495599_0008353 3300046678 Bacteria 6292
199 Ga0495623_0066661 3300046679 Bacteria 2249
200 Ga0495613_0033217 3300046689 Bacteria 3834
201 Ga0495604_0084451 3300047317 Bacteria 2371
202 Ga0495674_0029767 3300047319 Bacteria 4968
203 Ga0495674_0041222 3300047319 Bacteria 4126
204 Ga0495672_0051453 3300047320 Unclassified 2426
205 Ga0495680_0128825 3300047322 Bacteria 1861
206 Ga0495675_0202892 3300047444 Bacteria 1206
207 Ga0495684_0025512 3300047471 Bacteria 4541
208 Ga0495684_0053306 3300047471 Bacteria 3086
209 Ga0495602_0052985 3300048088 Bacteria 3597
210 Ga0496102_0513170 3300048905 Bacteria 1121
211 Ga0496104_0002694 3300048907 Bacteria 15295
212 Ga0496106_0014130 3300048909 Bacteria 5899
213 Ga0496108_0003882 3300048911 Bacteria 11999
214 Ga0496109_0000478 3300048912 Bacteria 34020
215 Ga0496109_0247037 3300048912 Bacteria 1680
216 Ga0496110_0210280 3300048913 Unclassified 1768
217 Ga0496110_0265386 3300048913 Bacteria 1563
218 Ga0496111_0179375 3300048914 Bacteria 1574
219 Ga0496112_0001862 3300048915 Bacteria 16605
220 Ga0496112_0046313 3300048915 Bacteria 4265
221 Ga0496115_0021239 3300048918 Bacteria 5013
222 Ga0496126_0070785 3300048929 Bacteria 3107
223 Ga0501034_0168208 3300049571 Bacteria 2160
224 Ga0501043_0022760 3300049579 Bacteria 4914
225 Ga0501069_0133379 3300049585 Bacteria 1423
226 Ga0501257_043497 3300049686 Bacteria 1107
227 Ga0501035_0027550 3300049822 Bacteria 5193
228 Ga0501044_0025057 3300049823 Bacteria 6326
229 Ga0501044_0050729 3300049823 Bacteria 4280
230 nmdc:mga05p37_128172_c1 3300050507 Bacteria 3115
231 nmdc:mga05p37_151485_c1 3300050507 Bacteria 2836
232 nmdc:mga05p37_495933_c1 3300050507 Bacteria 1403
233 nmdc:mga05p37_50613_c1 3300050507 Bacteria 5109
234 nmdc:mga05p37_538204_c1 3300050507 Bacteria 1332
235 nmdc:mga05p37_58313_c1 3300050507 Bacteria 4755
236 nmdc:mga05p37_7551_c1 3300050507 Bacteria 12171
237 nmdc:mga06r32_15925_c1 3300050510 Bacteria 6842
238 nmdc:mga06r32_194416_c1 3300050510 Bacteria 2016
239 nmdc:mga08y16_104060_c1 3300050511 Bacteria 2955
240 nmdc:mga08y16_182595_c1 3300050511 Bacteria 2178
241 nmdc:mga08y16_46455_c1 3300050511 Bacteria 4546
242 nmdc:mga0n895_1278_c1 3300050512 Bacteria 18592
243 nmdc:mga0n895_13372_c1 3300050512 Bacteria 7400
244 nmdc:mga0n895_481394_c1 3300050512 Bacteria 1251
245 nmdc:mga0n895_8410_c1 3300050512 Bacteria 8934
246 nmdc:mga08x19_139877_c1 3300050514 Bacteria 1634
247 nmdc:mga08x19_15252_c1 3300050514 Unclassified 4673
248 nmdc:mga08x19_196781_c1 3300050514 Unclassified 1380
249 nmdc:mga08x19_572_c1 3300050514 Bacteria 24032
250 nmdc:mga0a205_135416_c1 3300050515 Unclassified 2364
251 nmdc:mga0a205_23719_c1 3300050515 Bacteria 5820
252 nmdc:mga0a205_327260_c1 3300050515 Unclassified 1402
253 nmdc:mga0a205_84590_c1 3300050515 Bacteria 3064
254 nmdc:mga0a205_99478_c1 3300050515 Bacteria 2806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0292044 Ga0373927_0292044_47_1012 291
2 3300037068 Ga0373925_0208389 Ga0373925_0208389_475_1440 291
3 3300049686 Ga0501257_043497 Ga0501257_043497_31_954 296
4 3300014325 Ga0163163_10045701 Ga0163163_100457014 299
5 3300005564 Ga0070664_100074192 Ga0070664_1000741922 306
6 3300026142 Ga0207698_10023197 Ga0207698_100231971 321
7 3300009093 Ga0105240_10011874 Ga0105240_1001187414 322
8 3300009147 Ga0114129_10219502 Ga0114129_102195021 322
9 3300013104 Ga0157370_10099450 Ga0157370_100994502 322
10 3300025913 Ga0207695_10068555 Ga0207695_100685554 322
11 3300050507 nmdc:mga05p37_128172_c1 nmdc:mga05p37_128172_c1_2016_3014 322
12 3300028653 Ga0265323_10000374 Ga0265323_100003743 323
13 3300050507 nmdc:mga05p37_495933_c1 nmdc:mga05p37_495933_c1_238_1344 324
14 3300031242 Ga0265329_10037048 Ga0265329_100370482 327
15 3300031240 Ga0265320_10000657 Ga0265320_100006571 328
16 3300035695 Ga0373927_0001131 Ga0373927_0001131_18891_20075 328
17 3300035725 Ga0373947_0008060 Ga0373947_0008060_3791_4975 328
18 3300037068 Ga0373925_0000155 Ga0373925_0000155_12322_13506 328
19 3300028800 Ga0265338_10016277 Ga0265338_1001627712 332
20 3300029957 Ga0265324_10011277 Ga0265324_100112771 332
21 3300031250 Ga0265331_10002399 Ga0265331_1000239916 332
22 3300031344 Ga0265316_10008536 Ga0265316_100085361 332
23 3300031712 Ga0265342_10023720 Ga0265342_100237201 332
24 3300005355 Ga0070671_100360341 Ga0070671_1003603411 334
25 3300006871 Ga0075434_100005362 Ga0075434_1000053622 334
26 3300006914 Ga0075436_100012450 Ga0075436_1000124503 334
27 3300048912 Ga0496109_0247037 Ga0496109_0247037_100_1200 334
28 3300050512 nmdc:mga0n895_8410_c1 nmdc:mga0n895_8410_c1_747_1838 334
29 3300050514 nmdc:mga08x19_15252_c1 nmdc:mga08x19_15252_c1_3602_4660 334
30 3300005458 Ga0070681_10317919 Ga0070681_103179192 335
31 3300009553 Ga0105249_10187878 Ga0105249_101878782 335
32 3300050515 nmdc:mga0a205_135416_c1 nmdc:mga0a205_135416_c1_585_1679 335
33 3300025923 Ga0207681_10119327 Ga0207681_101193271 336
34 3300005456 Ga0070678_100116930 Ga0070678_1001169302 337
35 3300006844 Ga0075428_100048089 Ga0075428_1000480893 337
36 3300006847 Ga0075431_100213657 Ga0075431_1002136571 337
37 3300014325 Ga0163163_10009305 Ga0163163_100093054 337
38 3300014969 Ga0157376_10254111 Ga0157376_102541112 337
39 3300021384 Ga0213876_10035445 Ga0213876_100354452 337
40 3300039437 Ga0436365_1596896 Ga0436365_1596896_3056_4114 337
41 3300039453 Ga0436362_0186296 Ga0436362_0186296_283_1341 337
42 3300050512 nmdc:mga0n895_481394_c1 nmdc:mga0n895_481394_c1_165_1241 337
43 3300009093 Ga0105240_10000159 Ga0105240_1000015954 338
44 3300025913 Ga0207695_10001048 Ga0207695_100010483 338
45 3300042876 Ga0451577_0259104 Ga0451577_0259104_160_1263 338
46 3300005458 Ga0070681_10069615 Ga0070681_100696152 339
47 3300025912 Ga0207707_10111654 Ga0207707_101116542 339
48 3300037068 Ga0373925_0216982 Ga0373925_0216982_151_1221 339
49 3300046472 Ga0495580_0016674 Ga0495580_0016674_911_1981 339
50 3300048929 Ga0496126_0070785 Ga0496126_0070785_1371_2429 339
51 3300005548 Ga0070665_100153246 Ga0070665_1001532462 340
52 3300031344 Ga0265316_10002559 Ga0265316_100025596 340
53 3300031711 Ga0265314_10008601 Ga0265314_100086014 340
54 3300050514 nmdc:mga08x19_196781_c1 nmdc:mga08x19_196781_c1_233_1339 341
55 3300005336 Ga0070680_100115753 Ga0070680_1001157532 342
56 3300005530 Ga0070679_100035107 Ga0070679_1000351073 342
57 3300005535 Ga0070684_100261579 Ga0070684_1002615792 342
58 3300005841 Ga0068863_100167804 Ga0068863_1001678042 342
59 3300025917 Ga0207660_10091019 Ga0207660_100910192 342
60 3300025921 Ga0207652_10115409 Ga0207652_101154092 342
61 3300037418 Ga0395900_0443847 Ga0395900_0443847_124_1200 342
62 3300037853 Ga0436364_1369486 Ga0436364_1369486_2595_3674 342
63 3300044694 Ga0466963_0227937 Ga0466963_0227937_170_1252 342
64 3300050514 nmdc:mga08x19_572_c1 nmdc:mga08x19_572_c1_8773_9852 342
65 3300050515 nmdc:mga0a205_84590_c1 nmdc:mga0a205_84590_c1_1856_2965 342
66 3300025961 Ga0207712_10072369 Ga0207712_100723692 343
67 3300050514 nmdc:mga08x19_139877_c1 nmdc:mga08x19_139877_c1_495_1577 343
68 3300005331 Ga0070670_100002074 Ga0070670_1000020743 344
69 3300005340 Ga0070689_100051328 Ga0070689_1000513283 344
70 3300005366 Ga0070659_100128089 Ga0070659_1001280892 344
71 3300005436 Ga0070713_100081115 Ga0070713_1000811152 344
72 3300005458 Ga0070681_10280813 Ga0070681_102808131 344
73 3300005563 Ga0068855_100007179 Ga0068855_10000717910 344
74 3300005577 Ga0068857_100016203 Ga0068857_1000162032 344
75 3300005617 Ga0068859_100068584 Ga0068859_1000685842 344
76 3300006042 Ga0075368_10037568 Ga0075368_100375682 344
77 3300006237 Ga0097621_100195722 Ga0097621_1001957222 344
78 3300006931 Ga0097620_100068584 Ga0097620_1000685842 344
79 3300013105 Ga0157369_10001393 Ga0157369_100013935 344
80 3300013296 Ga0157374_10012210 Ga0157374_100122102 344
81 3300013306 Ga0163162_10253472 Ga0163162_102534721 344
82 3300025912 Ga0207707_10226496 Ga0207707_102264962 344
83 3300025925 Ga0207650_10001523 Ga0207650_100015233 344
84 3300025928 Ga0207700_10366921 Ga0207700_103669211 344
85 3300025936 Ga0207670_10292654 Ga0207670_102926541 344
86 3300025949 Ga0207667_10007094 Ga0207667_1000709410 344
87 3300026116 Ga0207674_10023997 Ga0207674_100239972 344
88 3300027866 Ga0209813_10021485 Ga0209813_100214852 344
89 3300036401 Ga0373937_0108737 Ga0373937_0108737_1427_2527 344
90 3300046454 Ga0495592_0031727 Ga0495592_0031727_380_1480 344
91 3300046462 Ga0495651_0011063 Ga0495651_0011063_2848_3948 344
92 3300046476 Ga0495662_0015390 Ga0495662_0015390_2405_3505 344
93 3300046477 Ga0495664_0002103 Ga0495664_0002103_9394_10494 344
94 3300046516 Ga0495628_0020108 Ga0495628_0020108_3057_4157 344
95 3300046517 Ga0495630_0026964 Ga0495630_0026964_2429_3529 344
96 3300046529 Ga0495652_0025042 Ga0495652_0025042_2171_3271 344
97 3300046531 Ga0495665_0036174 Ga0495665_0036174_935_2035 344
98 3300046533 Ga0495640_0046353 Ga0495640_0046353_1335_2435 344
99 3300046559 Ga0495667_0027604 Ga0495667_0027604_2331_3431 344
100 3300046663 Ga0495635_0156392 Ga0495635_0156392_38_1138 344
101 3300046678 Ga0495599_0008353 Ga0495599_0008353_124_1224 344
102 3300046679 Ga0495623_0066661 Ga0495623_0066661_192_1292 344
103 3300046689 Ga0495613_0033217 Ga0495613_0033217_228_1328 344
104 3300047317 Ga0495604_0084451 Ga0495604_0084451_340_1440 344
105 3300047319 Ga0495674_0029767 Ga0495674_0029767_931_2031 344
106 3300047322 Ga0495680_0128825 Ga0495680_0128825_64_1164 344
107 3300047444 Ga0495675_0202892 Ga0495675_0202892_22_1122 344
108 3300047471 Ga0495684_0025512 Ga0495684_0025512_749_1849 344
109 3300048905 Ga0496102_0513170 Ga0496102_0513170_10_1095 344
110 3300048918 Ga0496115_0021239 Ga0496115_0021239_2828_3913 344
111 3300005616 Ga0068852_100290095 Ga0068852_1002900952 345
112 3300046559 Ga0495667_0095045 Ga0495667_0095045_98_1249 345
113 3300048909 Ga0496106_0014130 Ga0496106_0014130_3520_4632 345
114 3300048913 Ga0496110_0265386 Ga0496110_0265386_283_1395 345
115 3300048915 Ga0496112_0046313 Ga0496112_0046313_602_1714 345
116 3300050512 nmdc:mga0n895_13372_c1 nmdc:mga0n895_13372_c1_2818_3906 345
117 3300050515 nmdc:mga0a205_327260_c1 nmdc:mga0a205_327260_c1_41_1108 345
118 3300005842 Ga0068858_100086927 Ga0068858_1000869272 346
119 3300009098 Ga0105245_10426811 Ga0105245_104268111 346
120 3300025913 Ga0207695_10144076 Ga0207695_101440763 346
121 3300026035 Ga0207703_10100586 Ga0207703_101005862 346
122 3300005336 Ga0070680_100016830 Ga0070680_1000168302 347
123 3300005445 Ga0070708_100073686 Ga0070708_1000736862 347
124 3300005458 Ga0070681_10022035 Ga0070681_100220354 347
125 3300005467 Ga0070706_100200349 Ga0070706_1002003492 347
126 3300005530 Ga0070679_100001698 Ga0070679_10000169815 347
127 3300005616 Ga0068852_100061151 Ga0068852_1000611512 347
128 3300009147 Ga0114129_10005526 Ga0114129_1000552611 347
129 3300013105 Ga0157369_10032546 Ga0157369_100325466 347
130 3300013307 Ga0157372_10077674 Ga0157372_100776743 347
131 3300036401 Ga0373937_0134037 Ga0373937_0134037_768_1868 347
132 3300050507 nmdc:mga05p37_58313_c1 nmdc:mga05p37_58313_c1_1577_2716 347
133 3300005329 Ga0070683_100001674 Ga0070683_10000167410 348
134 3300005331 Ga0070670_100005663 Ga0070670_1000056632 348
135 3300005344 Ga0070661_100227157 Ga0070661_1002271572 348
136 3300005364 Ga0070673_100340825 Ga0070673_1003408251 348
137 3300005366 Ga0070659_100107550 Ga0070659_1001075502 348
138 3300005436 Ga0070713_100005443 Ga0070713_1000054435 348
139 3300005455 Ga0070663_100019714 Ga0070663_1000197144 348
140 3300005458 Ga0070681_10010690 Ga0070681_100106907 348
141 3300005535 Ga0070684_100003840 Ga0070684_1000038409 348
142 3300005547 Ga0070693_100054836 Ga0070693_1000548362 348
143 3300009094 Ga0111539_10082160 Ga0111539_100821602 348
144 3300009177 Ga0105248_10022956 Ga0105248_100229567 348
145 3300025912 Ga0207707_10021240 Ga0207707_100212401 348
146 3300025928 Ga0207700_10039125 Ga0207700_100391253 348
147 3300025932 Ga0207690_10077911 Ga0207690_100779112 348
148 3300025941 Ga0207711_10103435 Ga0207711_101034352 348
149 3300025944 Ga0207661_10002309 Ga0207661_100023098 348
150 3300025960 Ga0207651_10077262 Ga0207651_100772621 348
151 3300026067 Ga0207678_10047185 Ga0207678_100471852 348
152 3300028379 Ga0268266_10250485 Ga0268266_102504852 348
153 3300048907 Ga0496104_0002694 Ga0496104_0002694_9719_10834 348
154 3300048911 Ga0496108_0003882 Ga0496108_0003882_10238_11353 348
155 3300048912 Ga0496109_0000478 Ga0496109_0000478_3959_5074 348
156 3300048913 Ga0496110_0210280 Ga0496110_0210280_617_1732 348
157 3300048914 Ga0496111_0179375 Ga0496111_0179375_332_1447 348
158 3300048915 Ga0496112_0001862 Ga0496112_0001862_9089_10204 348
159 3300050511 nmdc:mga08y16_182595_c1 nmdc:mga08y16_182595_c1_803_1915 348
160 3300050515 nmdc:mga0a205_99478_c1 nmdc:mga0a205_99478_c1_238_1347 348
161 3300005435 Ga0070714_100246923 Ga0070714_1002469231 349
162 3300005439 Ga0070711_100060412 Ga0070711_1000604122 349
163 3300005445 Ga0070708_100206102 Ga0070708_1002061021 349
164 3300005545 Ga0070695_100105554 Ga0070695_1001055541 349
165 3300025916 Ga0207663_10087273 Ga0207663_100872733 349
166 3300005471 Ga0070698_100313207 Ga0070698_1003132072 350
167 3300005546 Ga0070696_100001479 Ga0070696_1000014793 350
168 3300009093 Ga0105240_10001026 Ga0105240_1000102617 350
169 3300009545 Ga0105237_10023059 Ga0105237_100230595 350
170 3300025920 Ga0207649_10061279 Ga0207649_100612792 350
171 3300025922 Ga0207646_10000723 Ga0207646_100007232 350
172 3300025922 Ga0207646_10001254 Ga0207646_1000125412 350
173 3300047319 Ga0495674_0041222 Ga0495674_0041222_1272_2381 350
174 3300005327 Ga0070658_10396740 Ga0070658_103967401 351
175 3300006847 Ga0075431_100070076 Ga0075431_1000700762 351
176 3300014969 Ga0157376_10102668 Ga0157376_101026681 351
177 3300025921 Ga0207652_10406729 Ga0207652_104067291 351
178 3300044694 Ga0466963_0084404 Ga0466963_0084404_505_1596 351
179 3300045976 Ga0466967_0081948 Ga0466967_0081948_573_1664 351
180 3300046472 Ga0495580_0027159 Ga0495580_0027159_1008_2237 351
181 3300050510 nmdc:mga06r32_15925_c1 nmdc:mga06r32_15925_c1_4256_5395 351
182 3300006871 Ga0075434_100051735 Ga0075434_1000517352 352
183 3300049585 Ga0501069_0133379 Ga0501069_0133379_72_1190 352
184 3300005329 Ga0070683_100057315 Ga0070683_1000573152 353
185 3300005353 Ga0070669_100034455 Ga0070669_1000344553 353
186 3300009093 Ga0105240_10005878 Ga0105240_100058784 353
187 3300009093 Ga0105240_10041033 Ga0105240_100410332 353
188 3300009147 Ga0114129_10013486 Ga0114129_100134868 353
189 3300009147 Ga0114129_10081841 Ga0114129_100818414 353
190 3300009177 Ga0105248_10102088 Ga0105248_101020883 353
191 3300009545 Ga0105237_10038922 Ga0105237_100389224 353
192 3300014326 Ga0157380_10222121 Ga0157380_102221211 353
193 3300025913 Ga0207695_10012474 Ga0207695_100124745 353
194 3300025913 Ga0207695_10200021 Ga0207695_102000212 353
195 3300025914 Ga0207671_10065040 Ga0207671_100650402 353
196 3300031344 Ga0265316_10047097 Ga0265316_100470972 353
197 3300044842 Ga0466957_0053785 Ga0466957_0053785_832_1992 353
198 3300050507 nmdc:mga05p37_151485_c1 nmdc:mga05p37_151485_c1_1366_2493 353
199 3300050507 nmdc:mga05p37_7551_c1 nmdc:mga05p37_7551_c1_797_1918 353
200 3300005440 Ga0070705_100058319 Ga0070705_1000583191 354
201 3300005467 Ga0070706_100076846 Ga0070706_1000768462 354
202 3300005468 Ga0070707_100129071 Ga0070707_1001290712 354
203 3300005545 Ga0070695_100033596 Ga0070695_1000335961 354
204 3300005844 Ga0068862_100092645 Ga0068862_1000926451 354
205 3300009093 Ga0105240_10030357 Ga0105240_100303574 354
206 3300009177 Ga0105248_10300227 Ga0105248_103002271 354
207 3300009545 Ga0105237_10270594 Ga0105237_102705941 354
208 3300009553 Ga0105249_10183176 Ga0105249_101831762 354
209 3300025922 Ga0207646_10306671 Ga0207646_103066712 354
210 3300026118 Ga0207675_100071984 Ga0207675_1000719843 354
211 3300039437 Ga0436365_1688252 Ga0436365_1688252_957_2084 354
212 3300047471 Ga0495684_0053306 Ga0495684_0053306_1082_2308 354
213 3300048088 Ga0495602_0052985 Ga0495602_0052985_1954_3180 354
214 3300049571 Ga0501034_0168208 Ga0501034_0168208_925_2052 354
215 3300049579 Ga0501043_0022760 Ga0501043_0022760_3318_4445 354
216 3300049822 Ga0501035_0027550 Ga0501035_0027550_254_1381 354
217 3300049823 Ga0501044_0025057 Ga0501044_0025057_3570_4697 354
218 3300005353 Ga0070669_100256567 Ga0070669_1002565671 355
219 3300005618 Ga0068864_100449433 Ga0068864_1004494331 355
220 3300005844 Ga0068862_100013103 Ga0068862_1000131033 355
221 3300006852 Ga0075433_10008951 Ga0075433_100089513 355
222 3300009094 Ga0111539_10029418 Ga0111539_100294183 355
223 3300009094 Ga0111539_10171132 Ga0111539_101711322 355
224 3300009553 Ga0105249_10040143 Ga0105249_100401434 355
225 3300011119 Ga0105246_10029978 Ga0105246_100299782 355
226 3300025916 Ga0207663_10153344 Ga0207663_101533442 355
227 3300025923 Ga0207681_10274663 Ga0207681_102746631 355
228 3300026118 Ga0207675_100133867 Ga0207675_1001338672 355
229 3300026121 Ga0207683_10303489 Ga0207683_103034892 355
230 3300027907 Ga0207428_10026988 Ga0207428_100269882 355
231 3300028380 Ga0268265_10044978 Ga0268265_100449783 355
232 3300050510 nmdc:mga06r32_194416_c1 nmdc:mga06r32_194416_c1_35_1171 355
233 3300050511 nmdc:mga08y16_104060_c1 nmdc:mga08y16_104060_c1_849_1985 355
234 3300050511 nmdc:mga08y16_46455_c1 nmdc:mga08y16_46455_c1_3155_4291 355
235 3300050512 nmdc:mga0n895_1278_c1 nmdc:mga0n895_1278_c1_17396_18514 355
236 3300050515 nmdc:mga0a205_23719_c1 nmdc:mga0a205_23719_c1_3591_4727 355
237 3300005445 Ga0070708_100221907 Ga0070708_1002219072 356
238 3300005577 Ga0068857_100212677 Ga0068857_1002126772 356
239 3300006846 Ga0075430_100054472 Ga0075430_1000544722 356
240 3300009147 Ga0114129_10013693 Ga0114129_100136939 356
241 3300050507 nmdc:mga05p37_50613_c1 nmdc:mga05p37_50613_c1_3400_4503 356
242 3300050507 nmdc:mga05p37_538204_c1 nmdc:mga05p37_538204_c1_151_1257 356
243 3300006178 Ga0075367_10060382 Ga0075367_100603822 357
244 3300049823 Ga0501044_0050729 Ga0501044_0050729_252_1415 357
245 iso_pu_bacteria 8055588893 8055592145 361
246 3300005843 Ga0068860_100013770 Ga0068860_1000137702 362
247 3300025923 Ga0207681_10107227 Ga0207681_101072271 362
248 3300025941 Ga0207711_10228173 Ga0207711_102281732 362
249 3300028381 Ga0268264_10134768 Ga0268264_101347682 362
250 3300047320 Ga0495672_0051453 Ga0495672_0051453_813_1958 362
251 3300028381 Ga0268264_10014426 Ga0268264_100144267 376
252 3300014326 Ga0157380_10156508 Ga0157380_101565083 377
253 3300005290 Ga0065712_10082153 Ga0065712_100821532 378
254 3300014325 Ga0163163_10161255 Ga0163163_101612552 378
255 3300014326 Ga0157380_10025793 Ga0157380_100257931 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03786

UxuA

D-mannonate dehydratase (UxuA)

68

397

0.81

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

82

370

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.856 55 376
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.8404 55 376
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.8334 54 376
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.808 56 378
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.7904 55 376
ID Description Score Start End Superfamily
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8823 202 376 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8487 55 376 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8334 54 376 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8208 55 376 3.20.20.150
1tz9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7841 56 378 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9GB46-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9851 199 288 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A7C5I8R0-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.983 98 377 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A7X3VGW6-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9766 137 378 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A5N9D0B8-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9745 199 377 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2V9GB46-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9744 199 288 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Feature Viewer

pLDDT pTM Quality
87.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map