F365629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 160 | 254 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10005878|Ga0105240_100058784 |
| Length | 399 |
| Sequence | MFPDVPKFRRLLTLAVGAKGVFLMKISRRNLIQTAGIAALASPAASAAGTMPENKFEGKDTPKICLAMGDSGTGQQDIKAQSRRLRQLGVDHVLGGGPRIPWEESRLKEQIAGLKENGITLGNLMISGFDSAIYARPNRDEDIAKVIASIQAAGKAGLPVVEYNWYAHRAMEGYFEEEGRAGAGWTGFDYERLVDDNGNKVPFKDLPALEREGAHTLDEMWSTITYFLKKVIPECEKAGVRLALHPNDPPAPVSRKSQQIMGTVDGWKKLIDIVKSPCNGITFDCGVTKEMGQDPVEVCRYFASRDRINHVHFRNVKVKKPYERYSEVFIDEGENNMFAVMRELVKNKYTRMIYPEHPRAIDYDRDRGKLGGYPGGGGYTAFAFNVGYTRAMMQAALTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 148 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 160 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.18 |
| Nodule | 0 |
| Rhizoplane | 4.71 |
| Rhizosphere | 92.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10082153 | 3300005290 | Bacteria | 2943 |
| 2 | Ga0070658_10396740 | 3300005327 | Unclassified | 1185 |
| 3 | Ga0070683_100001674 | 3300005329 | Bacteria | 17207 |
| 4 | Ga0070683_100057315 | 3300005329 | Bacteria | 3619 |
| 5 | Ga0070670_100002074 | 3300005331 | Bacteria | 16409 |
| 6 | Ga0070670_100005663 | 3300005331 | Bacteria | 10544 |
| 7 | Ga0070680_100016830 | 3300005336 | Bacteria | 5753 |
| 8 | Ga0070680_100115753 | 3300005336 | Bacteria | 2234 |
| 9 | Ga0070689_100051328 | 3300005340 | Bacteria | 3188 |
| 10 | Ga0070661_100227157 | 3300005344 | Unclassified | 1433 |
| 11 | Ga0070669_100034455 | 3300005353 | Unclassified | 3665 |
| 12 | Ga0070669_100256567 | 3300005353 | Bacteria | 1394 |
| 13 | Ga0070671_100360341 | 3300005355 | Bacteria | 1241 |
| 14 | Ga0070673_100340825 | 3300005364 | Bacteria | 1328 |
| 15 | Ga0070659_100107550 | 3300005366 | Bacteria | 2249 |
| 16 | Ga0070659_100128089 | 3300005366 | Bacteria | 2060 |
| 17 | Ga0070714_100246923 | 3300005435 | Bacteria | 1649 |
| 18 | Ga0070713_100005443 | 3300005436 | Bacteria | 8700 |
| 19 | Ga0070713_100081115 | 3300005436 | Unclassified | 2767 |
| 20 | Ga0070711_100060412 | 3300005439 | Bacteria | 2635 |
| 21 | Ga0070705_100058319 | 3300005440 | Bacteria | 2281 |
| 22 | Ga0070708_100073686 | 3300005445 | Bacteria | 3078 |
| 23 | Ga0070708_100206102 | 3300005445 | Bacteria | 1842 |
| 24 | Ga0070708_100221907 | 3300005445 | Bacteria | 1773 |
| 25 | Ga0070663_100019714 | 3300005455 | Bacteria | 4453 |
| 26 | Ga0070678_100116930 | 3300005456 | Bacteria | 2096 |
| 27 | Ga0070681_10010690 | 3300005458 | Bacteria | 9073 |
| 28 | Ga0070681_10022035 | 3300005458 | Bacteria | 6393 |
| 29 | Ga0070681_10069615 | 3300005458 | Bacteria | 3485 |
| 30 | Ga0070681_10280813 | 3300005458 | Bacteria | 1576 |
| 31 | Ga0070681_10317919 | 3300005458 | Bacteria | 1466 |
| 32 | Ga0070706_100076846 | 3300005467 | Bacteria | 3090 |
| 33 | Ga0070706_100200349 | 3300005467 | Bacteria | 1865 |
| 34 | Ga0070707_100129071 | 3300005468 | Unclassified | 2457 |
| 35 | Ga0070698_100313207 | 3300005471 | Unclassified | 1500 |
| 36 | Ga0070679_100001698 | 3300005530 | Bacteria | 19852 |
| 37 | Ga0070679_100035107 | 3300005530 | Bacteria | 4974 |
| 38 | Ga0070684_100003840 | 3300005535 | Bacteria | 11360 |
| 39 | Ga0070684_100261579 | 3300005535 | Bacteria | 1583 |
| 40 | Ga0070695_100033596 | 3300005545 | Bacteria | 3210 |
| 41 | Ga0070695_100105554 | 3300005545 | Bacteria | 1904 |
| 42 | Ga0070696_100001479 | 3300005546 | Bacteria | 15380 |
| 43 | Ga0070693_100054836 | 3300005547 | Bacteria | 2294 |
| 44 | Ga0070665_100153246 | 3300005548 | Bacteria | 2307 |
| 45 | Ga0068855_100007179 | 3300005563 | Bacteria | 13518 |
| 46 | Ga0070664_100074192 | 3300005564 | Bacteria | 2920 |
| 47 | Ga0068857_100016203 | 3300005577 | Bacteria | 6529 |
| 48 | Ga0068857_100212677 | 3300005577 | Bacteria | 1765 |
| 49 | Ga0068852_100061151 | 3300005616 | Bacteria | 3272 |
| 50 | Ga0068852_100290095 | 3300005616 | Unclassified | 1580 |
| 51 | Ga0068859_100068584 | 3300005617 | Unclassified | 3581 |
| 52 | Ga0068864_100449433 | 3300005618 | Unclassified | 1232 |
| 53 | Ga0068863_100167804 | 3300005841 | Bacteria | 2105 |
| 54 | Ga0068858_100086927 | 3300005842 | Bacteria | 2908 |
| 55 | Ga0068860_100013770 | 3300005843 | Bacteria | 7929 |
| 56 | Ga0068862_100013103 | 3300005844 | Bacteria | 6857 |
| 57 | Ga0068862_100092645 | 3300005844 | Bacteria | 2634 |
| 58 | Ga0075368_10037568 | 3300006042 | Bacteria | 1894 |
| 59 | Ga0075367_10060382 | 3300006178 | Bacteria | 2260 |
| 60 | Ga0097621_100195722 | 3300006237 | Bacteria | 1752 |
| 61 | Ga0075428_100048089 | 3300006844 | Bacteria | 4682 |
| 62 | Ga0075430_100054472 | 3300006846 | Unclassified | 3365 |
| 63 | Ga0075431_100070076 | 3300006847 | Unclassified | 3617 |
| 64 | Ga0075431_100213657 | 3300006847 | Bacteria | 1970 |
| 65 | Ga0075433_10008951 | 3300006852 | Bacteria | 7993 |
| 66 | Ga0075434_100005362 | 3300006871 | Bacteria | 11666 |
| 67 | Ga0075434_100051735 | 3300006871 | Bacteria | 4081 |
| 68 | Ga0075436_100012450 | 3300006914 | Bacteria | 5830 |
| 69 | Ga0097620_100068584 | 3300006931 | Unclassified | 3581 |
| 70 | Ga0105240_10000159 | 3300009093 | Bacteria | 137832 |
| 71 | Ga0105240_10001026 | 3300009093 | Bacteria | 49581 |
| 72 | Ga0105240_10005878 | 3300009093 | Bacteria | 18173 |
| 73 | Ga0105240_10011874 | 3300009093 | Bacteria | 12085 |
| 74 | Ga0105240_10030357 | 3300009093 | Bacteria | 7025 |
| 75 | Ga0105240_10041033 | 3300009093 | Bacteria | 5912 |
| 76 | Ga0111539_10029418 | 3300009094 | Bacteria | 6690 |
| 77 | Ga0111539_10082160 | 3300009094 | Bacteria | 3789 |
| 78 | Ga0111539_10171132 | 3300009094 | Bacteria | 2538 |
| 79 | Ga0105245_10426811 | 3300009098 | Bacteria | 1330 |
| 80 | Ga0114129_10005526 | 3300009147 | Bacteria | 17880 |
| 81 | Ga0114129_10013486 | 3300009147 | Bacteria | 11646 |
| 82 | Ga0114129_10013693 | 3300009147 | Bacteria | 11557 |
| 83 | Ga0114129_10081841 | 3300009147 | Bacteria | 4488 |
| 84 | Ga0114129_10219502 | 3300009147 | Bacteria | 2565 |
| 85 | Ga0105248_10022956 | 3300009177 | Bacteria | 6928 |
| 86 | Ga0105248_10102088 | 3300009177 | Bacteria | 3233 |
| 87 | Ga0105248_10300227 | 3300009177 | Unclassified | 1808 |
| 88 | Ga0105237_10023059 | 3300009545 | Bacteria | 6382 |
| 89 | Ga0105237_10038922 | 3300009545 | Bacteria | 4802 |
| 90 | Ga0105237_10270594 | 3300009545 | Unclassified | 1702 |
| 91 | Ga0105249_10040143 | 3300009553 | Bacteria | 4250 |
| 92 | Ga0105249_10183176 | 3300009553 | Bacteria | 2039 |
| 93 | Ga0105249_10187878 | 3300009553 | Unclassified | 2014 |
| 94 | Ga0105246_10029978 | 3300011119 | Bacteria | 3588 |
| 95 | Ga0157370_10099450 | 3300013104 | Bacteria | 2726 |
| 96 | Ga0157369_10001393 | 3300013105 | Bacteria | 29688 |
| 97 | Ga0157369_10032546 | 3300013105 | Bacteria | 5733 |
| 98 | Ga0157374_10012210 | 3300013296 | Bacteria | 7465 |
| 99 | Ga0163162_10253472 | 3300013306 | Unclassified | 1892 |
| 100 | Ga0157372_10077674 | 3300013307 | Bacteria | 3751 |
| 101 | Ga0163163_10009305 | 3300014325 | Bacteria | 8763 |
| 102 | Ga0163163_10045701 | 3300014325 | Bacteria | 4299 |
| 103 | Ga0163163_10161255 | 3300014325 | Bacteria | 2288 |
| 104 | Ga0157380_10025793 | 3300014326 | Bacteria | 4460 |
| 105 | Ga0157380_10156508 | 3300014326 | Bacteria | 1976 |
| 106 | Ga0157380_10222121 | 3300014326 | Unclassified | 1691 |
| 107 | Ga0157376_10102668 | 3300014969 | Bacteria | 2502 |
| 108 | Ga0157376_10254111 | 3300014969 | Bacteria | 1643 |
| 109 | Ga0213876_10035445 | 3300021384 | Unclassified | 2631 |
| 110 | Ga0207707_10021240 | 3300025912 | Bacteria | 5674 |
| 111 | Ga0207707_10111654 | 3300025912 | Bacteria | 2390 |
| 112 | Ga0207707_10226496 | 3300025912 | Bacteria | 1627 |
| 113 | Ga0207695_10001048 | 3300025913 | Bacteria | 48552 |
| 114 | Ga0207695_10012474 | 3300025913 | Bacteria | 10200 |
| 115 | Ga0207695_10068555 | 3300025913 | Bacteria | 3634 |
| 116 | Ga0207695_10144076 | 3300025913 | Bacteria | 2328 |
| 117 | Ga0207695_10200021 | 3300025913 | Bacteria | 1912 |
| 118 | Ga0207671_10065040 | 3300025914 | Unclassified | 2712 |
| 119 | Ga0207663_10087273 | 3300025916 | Unclassified | 2060 |
| 120 | Ga0207663_10153344 | 3300025916 | Bacteria | 1618 |
| 121 | Ga0207660_10091019 | 3300025917 | Bacteria | 2261 |
| 122 | Ga0207649_10061279 | 3300025920 | Unclassified | 2367 |
| 123 | Ga0207652_10115409 | 3300025921 | Bacteria | 2385 |
| 124 | Ga0207652_10406729 | 3300025921 | Bacteria | 1228 |
| 125 | Ga0207646_10000723 | 3300025922 | Bacteria | 42789 |
| 126 | Ga0207646_10001254 | 3300025922 | Bacteria | 31799 |
| 127 | Ga0207646_10306671 | 3300025922 | Unclassified | 1434 |
| 128 | Ga0207681_10107227 | 3300025923 | Bacteria | 2026 |
| 129 | Ga0207681_10119327 | 3300025923 | Bacteria | 1932 |
| 130 | Ga0207681_10274663 | 3300025923 | Unclassified | 1324 |
| 131 | Ga0207650_10001523 | 3300025925 | Bacteria | 16583 |
| 132 | Ga0207700_10039125 | 3300025928 | Bacteria | 3449 |
| 133 | Ga0207700_10366921 | 3300025928 | Bacteria | 1256 |
| 134 | Ga0207690_10077911 | 3300025932 | Bacteria | 2305 |
| 135 | Ga0207670_10292654 | 3300025936 | Bacteria | 1272 |
| 136 | Ga0207711_10103435 | 3300025941 | Bacteria | 2522 |
| 137 | Ga0207711_10228173 | 3300025941 | Unclassified | 1705 |
| 138 | Ga0207661_10002309 | 3300025944 | Bacteria | 13133 |
| 139 | Ga0207667_10007094 | 3300025949 | Bacteria | 13529 |
| 140 | Ga0207651_10077262 | 3300025960 | Unclassified | 2383 |
| 141 | Ga0207712_10072369 | 3300025961 | Unclassified | 2482 |
| 142 | Ga0207703_10100586 | 3300026035 | Bacteria | 2450 |
| 143 | Ga0207678_10047185 | 3300026067 | Bacteria | 3725 |
| 144 | Ga0207674_10023997 | 3300026116 | Bacteria | 6522 |
| 145 | Ga0207675_100071984 | 3300026118 | Bacteria | 3232 |
| 146 | Ga0207675_100133867 | 3300026118 | Bacteria | 2351 |
| 147 | Ga0207683_10303489 | 3300026121 | Bacteria | 1461 |
| 148 | Ga0207698_10023197 | 3300026142 | Bacteria | 4330 |
| 149 | Ga0209813_10021485 | 3300027866 | Bacteria | 1815 |
| 150 | Ga0207428_10026988 | 3300027907 | Bacteria | 4785 |
| 151 | Ga0268266_10250485 | 3300028379 | Unclassified | 1638 |
| 152 | Ga0268265_10044978 | 3300028380 | Bacteria | 3291 |
| 153 | Ga0268264_10014426 | 3300028381 | Bacteria | 6493 |
| 154 | Ga0268264_10134768 | 3300028381 | Bacteria | 2194 |
| 155 | Ga0265323_10000374 | 3300028653 | Bacteria | 25844 |
| 156 | Ga0265338_10016277 | 3300028800 | Bacteria | 8103 |
| 157 | Ga0265324_10011277 | 3300029957 | Bacteria | 3411 |
| 158 | Ga0265320_10000657 | 3300031240 | Bacteria | 26403 |
| 159 | Ga0265329_10037048 | 3300031242 | Bacteria | 1571 |
| 160 | Ga0265331_10002399 | 3300031250 | Bacteria | 12696 |
| 161 | Ga0265316_10002559 | 3300031344 | Bacteria | 18799 |
| 162 | Ga0265316_10008536 | 3300031344 | Bacteria | 9499 |
| 163 | Ga0265316_10047097 | 3300031344 | Bacteria | 3413 |
| 164 | Ga0265314_10008601 | 3300031711 | Bacteria | 8731 |
| 165 | Ga0265342_10023720 | 3300031712 | Bacteria | 3879 |
| 166 | Ga0373927_0001131 | 3300035695 | Bacteria | 20194 |
| 167 | Ga0373927_0292044 | 3300035695 | Unclassified | 1073 |
| 168 | Ga0373947_0008060 | 3300035725 | Bacteria | 6076 |
| 169 | Ga0373937_0108737 | 3300036401 | Bacteria | 2578 |
| 170 | Ga0373937_0134037 | 3300036401 | Bacteria | 2315 |
| 171 | Ga0373925_0000155 | 3300037068 | Bacteria | 73370 |
| 172 | Ga0373925_0208389 | 3300037068 | Unclassified | 1557 |
| 173 | Ga0373925_0216982 | 3300037068 | Unclassified | 1526 |
| 174 | Ga0395900_0443847 | 3300037418 | Unclassified | 1255 |
| 175 | Ga0436364_1369486 | 3300037853 | Bacteria | 15303 |
| 176 | Ga0436365_1596896 | 3300039437 | Unclassified | 4895 |
| 177 | Ga0436365_1688252 | 3300039437 | Unclassified | 2139 |
| 178 | Ga0436362_0186296 | 3300039453 | Bacteria | 1366 |
| 179 | Ga0451577_0259104 | 3300042876 | Unclassified | 1575 |
| 180 | Ga0466963_0084404 | 3300044694 | Bacteria | 2155 |
| 181 | Ga0466963_0227937 | 3300044694 | Unclassified | 1305 |
| 182 | Ga0466957_0053785 | 3300044842 | Bacteria | 2456 |
| 183 | Ga0466967_0081948 | 3300045976 | Bacteria | 2915 |
| 184 | Ga0495592_0031727 | 3300046454 | Bacteria | 3991 |
| 185 | Ga0495651_0011063 | 3300046462 | Bacteria | 6943 |
| 186 | Ga0495580_0016674 | 3300046472 | Bacteria | 5513 |
| 187 | Ga0495580_0027159 | 3300046472 | Bacteria | 4166 |
| 188 | Ga0495662_0015390 | 3300046476 | Bacteria | 3715 |
| 189 | Ga0495664_0002103 | 3300046477 | Bacteria | 10646 |
| 190 | Ga0495628_0020108 | 3300046516 | Bacteria | 5509 |
| 191 | Ga0495630_0026964 | 3300046517 | Bacteria | 4258 |
| 192 | Ga0495652_0025042 | 3300046529 | Bacteria | 5280 |
| 193 | Ga0495665_0036174 | 3300046531 | Bacteria | 2636 |
| 194 | Ga0495640_0046353 | 3300046533 | Bacteria | 3012 |
| 195 | Ga0495667_0027604 | 3300046559 | Bacteria | 3823 |
| 196 | Ga0495667_0095045 | 3300046559 | Bacteria | 1930 |
| 197 | Ga0495635_0156392 | 3300046663 | Bacteria | 1551 |
| 198 | Ga0495599_0008353 | 3300046678 | Bacteria | 6292 |
| 199 | Ga0495623_0066661 | 3300046679 | Bacteria | 2249 |
| 200 | Ga0495613_0033217 | 3300046689 | Bacteria | 3834 |
| 201 | Ga0495604_0084451 | 3300047317 | Bacteria | 2371 |
| 202 | Ga0495674_0029767 | 3300047319 | Bacteria | 4968 |
| 203 | Ga0495674_0041222 | 3300047319 | Bacteria | 4126 |
| 204 | Ga0495672_0051453 | 3300047320 | Unclassified | 2426 |
| 205 | Ga0495680_0128825 | 3300047322 | Bacteria | 1861 |
| 206 | Ga0495675_0202892 | 3300047444 | Bacteria | 1206 |
| 207 | Ga0495684_0025512 | 3300047471 | Bacteria | 4541 |
| 208 | Ga0495684_0053306 | 3300047471 | Bacteria | 3086 |
| 209 | Ga0495602_0052985 | 3300048088 | Bacteria | 3597 |
| 210 | Ga0496102_0513170 | 3300048905 | Bacteria | 1121 |
| 211 | Ga0496104_0002694 | 3300048907 | Bacteria | 15295 |
| 212 | Ga0496106_0014130 | 3300048909 | Bacteria | 5899 |
| 213 | Ga0496108_0003882 | 3300048911 | Bacteria | 11999 |
| 214 | Ga0496109_0000478 | 3300048912 | Bacteria | 34020 |
| 215 | Ga0496109_0247037 | 3300048912 | Bacteria | 1680 |
| 216 | Ga0496110_0210280 | 3300048913 | Unclassified | 1768 |
| 217 | Ga0496110_0265386 | 3300048913 | Bacteria | 1563 |
| 218 | Ga0496111_0179375 | 3300048914 | Bacteria | 1574 |
| 219 | Ga0496112_0001862 | 3300048915 | Bacteria | 16605 |
| 220 | Ga0496112_0046313 | 3300048915 | Bacteria | 4265 |
| 221 | Ga0496115_0021239 | 3300048918 | Bacteria | 5013 |
| 222 | Ga0496126_0070785 | 3300048929 | Bacteria | 3107 |
| 223 | Ga0501034_0168208 | 3300049571 | Bacteria | 2160 |
| 224 | Ga0501043_0022760 | 3300049579 | Bacteria | 4914 |
| 225 | Ga0501069_0133379 | 3300049585 | Bacteria | 1423 |
| 226 | Ga0501257_043497 | 3300049686 | Bacteria | 1107 |
| 227 | Ga0501035_0027550 | 3300049822 | Bacteria | 5193 |
| 228 | Ga0501044_0025057 | 3300049823 | Bacteria | 6326 |
| 229 | Ga0501044_0050729 | 3300049823 | Bacteria | 4280 |
| 230 | nmdc:mga05p37_128172_c1 | 3300050507 | Bacteria | 3115 |
| 231 | nmdc:mga05p37_151485_c1 | 3300050507 | Bacteria | 2836 |
| 232 | nmdc:mga05p37_495933_c1 | 3300050507 | Bacteria | 1403 |
| 233 | nmdc:mga05p37_50613_c1 | 3300050507 | Bacteria | 5109 |
| 234 | nmdc:mga05p37_538204_c1 | 3300050507 | Bacteria | 1332 |
| 235 | nmdc:mga05p37_58313_c1 | 3300050507 | Bacteria | 4755 |
| 236 | nmdc:mga05p37_7551_c1 | 3300050507 | Bacteria | 12171 |
| 237 | nmdc:mga06r32_15925_c1 | 3300050510 | Bacteria | 6842 |
| 238 | nmdc:mga06r32_194416_c1 | 3300050510 | Bacteria | 2016 |
| 239 | nmdc:mga08y16_104060_c1 | 3300050511 | Bacteria | 2955 |
| 240 | nmdc:mga08y16_182595_c1 | 3300050511 | Bacteria | 2178 |
| 241 | nmdc:mga08y16_46455_c1 | 3300050511 | Bacteria | 4546 |
| 242 | nmdc:mga0n895_1278_c1 | 3300050512 | Bacteria | 18592 |
| 243 | nmdc:mga0n895_13372_c1 | 3300050512 | Bacteria | 7400 |
| 244 | nmdc:mga0n895_481394_c1 | 3300050512 | Bacteria | 1251 |
| 245 | nmdc:mga0n895_8410_c1 | 3300050512 | Bacteria | 8934 |
| 246 | nmdc:mga08x19_139877_c1 | 3300050514 | Bacteria | 1634 |
| 247 | nmdc:mga08x19_15252_c1 | 3300050514 | Unclassified | 4673 |
| 248 | nmdc:mga08x19_196781_c1 | 3300050514 | Unclassified | 1380 |
| 249 | nmdc:mga08x19_572_c1 | 3300050514 | Bacteria | 24032 |
| 250 | nmdc:mga0a205_135416_c1 | 3300050515 | Unclassified | 2364 |
| 251 | nmdc:mga0a205_23719_c1 | 3300050515 | Bacteria | 5820 |
| 252 | nmdc:mga0a205_327260_c1 | 3300050515 | Unclassified | 1402 |
| 253 | nmdc:mga0a205_84590_c1 | 3300050515 | Bacteria | 3064 |
| 254 | nmdc:mga0a205_99478_c1 | 3300050515 | Bacteria | 2806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0292044 | Ga0373927_0292044_47_1012 | 291 |
| 2 | 3300037068 | Ga0373925_0208389 | Ga0373925_0208389_475_1440 | 291 |
| 3 | 3300049686 | Ga0501257_043497 | Ga0501257_043497_31_954 | 296 |
| 4 | 3300014325 | Ga0163163_10045701 | Ga0163163_100457014 | 299 |
| 5 | 3300005564 | Ga0070664_100074192 | Ga0070664_1000741922 | 306 |
| 6 | 3300026142 | Ga0207698_10023197 | Ga0207698_100231971 | 321 |
| 7 | 3300009093 | Ga0105240_10011874 | Ga0105240_1001187414 | 322 |
| 8 | 3300009147 | Ga0114129_10219502 | Ga0114129_102195021 | 322 |
| 9 | 3300013104 | Ga0157370_10099450 | Ga0157370_100994502 | 322 |
| 10 | 3300025913 | Ga0207695_10068555 | Ga0207695_100685554 | 322 |
| 11 | 3300050507 | nmdc:mga05p37_128172_c1 | nmdc:mga05p37_128172_c1_2016_3014 | 322 |
| 12 | 3300028653 | Ga0265323_10000374 | Ga0265323_100003743 | 323 |
| 13 | 3300050507 | nmdc:mga05p37_495933_c1 | nmdc:mga05p37_495933_c1_238_1344 | 324 |
| 14 | 3300031242 | Ga0265329_10037048 | Ga0265329_100370482 | 327 |
| 15 | 3300031240 | Ga0265320_10000657 | Ga0265320_100006571 | 328 |
| 16 | 3300035695 | Ga0373927_0001131 | Ga0373927_0001131_18891_20075 | 328 |
| 17 | 3300035725 | Ga0373947_0008060 | Ga0373947_0008060_3791_4975 | 328 |
| 18 | 3300037068 | Ga0373925_0000155 | Ga0373925_0000155_12322_13506 | 328 |
| 19 | 3300028800 | Ga0265338_10016277 | Ga0265338_1001627712 | 332 |
| 20 | 3300029957 | Ga0265324_10011277 | Ga0265324_100112771 | 332 |
| 21 | 3300031250 | Ga0265331_10002399 | Ga0265331_1000239916 | 332 |
| 22 | 3300031344 | Ga0265316_10008536 | Ga0265316_100085361 | 332 |
| 23 | 3300031712 | Ga0265342_10023720 | Ga0265342_100237201 | 332 |
| 24 | 3300005355 | Ga0070671_100360341 | Ga0070671_1003603411 | 334 |
| 25 | 3300006871 | Ga0075434_100005362 | Ga0075434_1000053622 | 334 |
| 26 | 3300006914 | Ga0075436_100012450 | Ga0075436_1000124503 | 334 |
| 27 | 3300048912 | Ga0496109_0247037 | Ga0496109_0247037_100_1200 | 334 |
| 28 | 3300050512 | nmdc:mga0n895_8410_c1 | nmdc:mga0n895_8410_c1_747_1838 | 334 |
| 29 | 3300050514 | nmdc:mga08x19_15252_c1 | nmdc:mga08x19_15252_c1_3602_4660 | 334 |
| 30 | 3300005458 | Ga0070681_10317919 | Ga0070681_103179192 | 335 |
| 31 | 3300009553 | Ga0105249_10187878 | Ga0105249_101878782 | 335 |
| 32 | 3300050515 | nmdc:mga0a205_135416_c1 | nmdc:mga0a205_135416_c1_585_1679 | 335 |
| 33 | 3300025923 | Ga0207681_10119327 | Ga0207681_101193271 | 336 |
| 34 | 3300005456 | Ga0070678_100116930 | Ga0070678_1001169302 | 337 |
| 35 | 3300006844 | Ga0075428_100048089 | Ga0075428_1000480893 | 337 |
| 36 | 3300006847 | Ga0075431_100213657 | Ga0075431_1002136571 | 337 |
| 37 | 3300014325 | Ga0163163_10009305 | Ga0163163_100093054 | 337 |
| 38 | 3300014969 | Ga0157376_10254111 | Ga0157376_102541112 | 337 |
| 39 | 3300021384 | Ga0213876_10035445 | Ga0213876_100354452 | 337 |
| 40 | 3300039437 | Ga0436365_1596896 | Ga0436365_1596896_3056_4114 | 337 |
| 41 | 3300039453 | Ga0436362_0186296 | Ga0436362_0186296_283_1341 | 337 |
| 42 | 3300050512 | nmdc:mga0n895_481394_c1 | nmdc:mga0n895_481394_c1_165_1241 | 337 |
| 43 | 3300009093 | Ga0105240_10000159 | Ga0105240_1000015954 | 338 |
| 44 | 3300025913 | Ga0207695_10001048 | Ga0207695_100010483 | 338 |
| 45 | 3300042876 | Ga0451577_0259104 | Ga0451577_0259104_160_1263 | 338 |
| 46 | 3300005458 | Ga0070681_10069615 | Ga0070681_100696152 | 339 |
| 47 | 3300025912 | Ga0207707_10111654 | Ga0207707_101116542 | 339 |
| 48 | 3300037068 | Ga0373925_0216982 | Ga0373925_0216982_151_1221 | 339 |
| 49 | 3300046472 | Ga0495580_0016674 | Ga0495580_0016674_911_1981 | 339 |
| 50 | 3300048929 | Ga0496126_0070785 | Ga0496126_0070785_1371_2429 | 339 |
| 51 | 3300005548 | Ga0070665_100153246 | Ga0070665_1001532462 | 340 |
| 52 | 3300031344 | Ga0265316_10002559 | Ga0265316_100025596 | 340 |
| 53 | 3300031711 | Ga0265314_10008601 | Ga0265314_100086014 | 340 |
| 54 | 3300050514 | nmdc:mga08x19_196781_c1 | nmdc:mga08x19_196781_c1_233_1339 | 341 |
| 55 | 3300005336 | Ga0070680_100115753 | Ga0070680_1001157532 | 342 |
| 56 | 3300005530 | Ga0070679_100035107 | Ga0070679_1000351073 | 342 |
| 57 | 3300005535 | Ga0070684_100261579 | Ga0070684_1002615792 | 342 |
| 58 | 3300005841 | Ga0068863_100167804 | Ga0068863_1001678042 | 342 |
| 59 | 3300025917 | Ga0207660_10091019 | Ga0207660_100910192 | 342 |
| 60 | 3300025921 | Ga0207652_10115409 | Ga0207652_101154092 | 342 |
| 61 | 3300037418 | Ga0395900_0443847 | Ga0395900_0443847_124_1200 | 342 |
| 62 | 3300037853 | Ga0436364_1369486 | Ga0436364_1369486_2595_3674 | 342 |
| 63 | 3300044694 | Ga0466963_0227937 | Ga0466963_0227937_170_1252 | 342 |
| 64 | 3300050514 | nmdc:mga08x19_572_c1 | nmdc:mga08x19_572_c1_8773_9852 | 342 |
| 65 | 3300050515 | nmdc:mga0a205_84590_c1 | nmdc:mga0a205_84590_c1_1856_2965 | 342 |
| 66 | 3300025961 | Ga0207712_10072369 | Ga0207712_100723692 | 343 |
| 67 | 3300050514 | nmdc:mga08x19_139877_c1 | nmdc:mga08x19_139877_c1_495_1577 | 343 |
| 68 | 3300005331 | Ga0070670_100002074 | Ga0070670_1000020743 | 344 |
| 69 | 3300005340 | Ga0070689_100051328 | Ga0070689_1000513283 | 344 |
| 70 | 3300005366 | Ga0070659_100128089 | Ga0070659_1001280892 | 344 |
| 71 | 3300005436 | Ga0070713_100081115 | Ga0070713_1000811152 | 344 |
| 72 | 3300005458 | Ga0070681_10280813 | Ga0070681_102808131 | 344 |
| 73 | 3300005563 | Ga0068855_100007179 | Ga0068855_10000717910 | 344 |
| 74 | 3300005577 | Ga0068857_100016203 | Ga0068857_1000162032 | 344 |
| 75 | 3300005617 | Ga0068859_100068584 | Ga0068859_1000685842 | 344 |
| 76 | 3300006042 | Ga0075368_10037568 | Ga0075368_100375682 | 344 |
| 77 | 3300006237 | Ga0097621_100195722 | Ga0097621_1001957222 | 344 |
| 78 | 3300006931 | Ga0097620_100068584 | Ga0097620_1000685842 | 344 |
| 79 | 3300013105 | Ga0157369_10001393 | Ga0157369_100013935 | 344 |
| 80 | 3300013296 | Ga0157374_10012210 | Ga0157374_100122102 | 344 |
| 81 | 3300013306 | Ga0163162_10253472 | Ga0163162_102534721 | 344 |
| 82 | 3300025912 | Ga0207707_10226496 | Ga0207707_102264962 | 344 |
| 83 | 3300025925 | Ga0207650_10001523 | Ga0207650_100015233 | 344 |
| 84 | 3300025928 | Ga0207700_10366921 | Ga0207700_103669211 | 344 |
| 85 | 3300025936 | Ga0207670_10292654 | Ga0207670_102926541 | 344 |
| 86 | 3300025949 | Ga0207667_10007094 | Ga0207667_1000709410 | 344 |
| 87 | 3300026116 | Ga0207674_10023997 | Ga0207674_100239972 | 344 |
| 88 | 3300027866 | Ga0209813_10021485 | Ga0209813_100214852 | 344 |
| 89 | 3300036401 | Ga0373937_0108737 | Ga0373937_0108737_1427_2527 | 344 |
| 90 | 3300046454 | Ga0495592_0031727 | Ga0495592_0031727_380_1480 | 344 |
| 91 | 3300046462 | Ga0495651_0011063 | Ga0495651_0011063_2848_3948 | 344 |
| 92 | 3300046476 | Ga0495662_0015390 | Ga0495662_0015390_2405_3505 | 344 |
| 93 | 3300046477 | Ga0495664_0002103 | Ga0495664_0002103_9394_10494 | 344 |
| 94 | 3300046516 | Ga0495628_0020108 | Ga0495628_0020108_3057_4157 | 344 |
| 95 | 3300046517 | Ga0495630_0026964 | Ga0495630_0026964_2429_3529 | 344 |
| 96 | 3300046529 | Ga0495652_0025042 | Ga0495652_0025042_2171_3271 | 344 |
| 97 | 3300046531 | Ga0495665_0036174 | Ga0495665_0036174_935_2035 | 344 |
| 98 | 3300046533 | Ga0495640_0046353 | Ga0495640_0046353_1335_2435 | 344 |
| 99 | 3300046559 | Ga0495667_0027604 | Ga0495667_0027604_2331_3431 | 344 |
| 100 | 3300046663 | Ga0495635_0156392 | Ga0495635_0156392_38_1138 | 344 |
| 101 | 3300046678 | Ga0495599_0008353 | Ga0495599_0008353_124_1224 | 344 |
| 102 | 3300046679 | Ga0495623_0066661 | Ga0495623_0066661_192_1292 | 344 |
| 103 | 3300046689 | Ga0495613_0033217 | Ga0495613_0033217_228_1328 | 344 |
| 104 | 3300047317 | Ga0495604_0084451 | Ga0495604_0084451_340_1440 | 344 |
| 105 | 3300047319 | Ga0495674_0029767 | Ga0495674_0029767_931_2031 | 344 |
| 106 | 3300047322 | Ga0495680_0128825 | Ga0495680_0128825_64_1164 | 344 |
| 107 | 3300047444 | Ga0495675_0202892 | Ga0495675_0202892_22_1122 | 344 |
| 108 | 3300047471 | Ga0495684_0025512 | Ga0495684_0025512_749_1849 | 344 |
| 109 | 3300048905 | Ga0496102_0513170 | Ga0496102_0513170_10_1095 | 344 |
| 110 | 3300048918 | Ga0496115_0021239 | Ga0496115_0021239_2828_3913 | 344 |
| 111 | 3300005616 | Ga0068852_100290095 | Ga0068852_1002900952 | 345 |
| 112 | 3300046559 | Ga0495667_0095045 | Ga0495667_0095045_98_1249 | 345 |
| 113 | 3300048909 | Ga0496106_0014130 | Ga0496106_0014130_3520_4632 | 345 |
| 114 | 3300048913 | Ga0496110_0265386 | Ga0496110_0265386_283_1395 | 345 |
| 115 | 3300048915 | Ga0496112_0046313 | Ga0496112_0046313_602_1714 | 345 |
| 116 | 3300050512 | nmdc:mga0n895_13372_c1 | nmdc:mga0n895_13372_c1_2818_3906 | 345 |
| 117 | 3300050515 | nmdc:mga0a205_327260_c1 | nmdc:mga0a205_327260_c1_41_1108 | 345 |
| 118 | 3300005842 | Ga0068858_100086927 | Ga0068858_1000869272 | 346 |
| 119 | 3300009098 | Ga0105245_10426811 | Ga0105245_104268111 | 346 |
| 120 | 3300025913 | Ga0207695_10144076 | Ga0207695_101440763 | 346 |
| 121 | 3300026035 | Ga0207703_10100586 | Ga0207703_101005862 | 346 |
| 122 | 3300005336 | Ga0070680_100016830 | Ga0070680_1000168302 | 347 |
| 123 | 3300005445 | Ga0070708_100073686 | Ga0070708_1000736862 | 347 |
| 124 | 3300005458 | Ga0070681_10022035 | Ga0070681_100220354 | 347 |
| 125 | 3300005467 | Ga0070706_100200349 | Ga0070706_1002003492 | 347 |
| 126 | 3300005530 | Ga0070679_100001698 | Ga0070679_10000169815 | 347 |
| 127 | 3300005616 | Ga0068852_100061151 | Ga0068852_1000611512 | 347 |
| 128 | 3300009147 | Ga0114129_10005526 | Ga0114129_1000552611 | 347 |
| 129 | 3300013105 | Ga0157369_10032546 | Ga0157369_100325466 | 347 |
| 130 | 3300013307 | Ga0157372_10077674 | Ga0157372_100776743 | 347 |
| 131 | 3300036401 | Ga0373937_0134037 | Ga0373937_0134037_768_1868 | 347 |
| 132 | 3300050507 | nmdc:mga05p37_58313_c1 | nmdc:mga05p37_58313_c1_1577_2716 | 347 |
| 133 | 3300005329 | Ga0070683_100001674 | Ga0070683_10000167410 | 348 |
| 134 | 3300005331 | Ga0070670_100005663 | Ga0070670_1000056632 | 348 |
| 135 | 3300005344 | Ga0070661_100227157 | Ga0070661_1002271572 | 348 |
| 136 | 3300005364 | Ga0070673_100340825 | Ga0070673_1003408251 | 348 |
| 137 | 3300005366 | Ga0070659_100107550 | Ga0070659_1001075502 | 348 |
| 138 | 3300005436 | Ga0070713_100005443 | Ga0070713_1000054435 | 348 |
| 139 | 3300005455 | Ga0070663_100019714 | Ga0070663_1000197144 | 348 |
| 140 | 3300005458 | Ga0070681_10010690 | Ga0070681_100106907 | 348 |
| 141 | 3300005535 | Ga0070684_100003840 | Ga0070684_1000038409 | 348 |
| 142 | 3300005547 | Ga0070693_100054836 | Ga0070693_1000548362 | 348 |
| 143 | 3300009094 | Ga0111539_10082160 | Ga0111539_100821602 | 348 |
| 144 | 3300009177 | Ga0105248_10022956 | Ga0105248_100229567 | 348 |
| 145 | 3300025912 | Ga0207707_10021240 | Ga0207707_100212401 | 348 |
| 146 | 3300025928 | Ga0207700_10039125 | Ga0207700_100391253 | 348 |
| 147 | 3300025932 | Ga0207690_10077911 | Ga0207690_100779112 | 348 |
| 148 | 3300025941 | Ga0207711_10103435 | Ga0207711_101034352 | 348 |
| 149 | 3300025944 | Ga0207661_10002309 | Ga0207661_100023098 | 348 |
| 150 | 3300025960 | Ga0207651_10077262 | Ga0207651_100772621 | 348 |
| 151 | 3300026067 | Ga0207678_10047185 | Ga0207678_100471852 | 348 |
| 152 | 3300028379 | Ga0268266_10250485 | Ga0268266_102504852 | 348 |
| 153 | 3300048907 | Ga0496104_0002694 | Ga0496104_0002694_9719_10834 | 348 |
| 154 | 3300048911 | Ga0496108_0003882 | Ga0496108_0003882_10238_11353 | 348 |
| 155 | 3300048912 | Ga0496109_0000478 | Ga0496109_0000478_3959_5074 | 348 |
| 156 | 3300048913 | Ga0496110_0210280 | Ga0496110_0210280_617_1732 | 348 |
| 157 | 3300048914 | Ga0496111_0179375 | Ga0496111_0179375_332_1447 | 348 |
| 158 | 3300048915 | Ga0496112_0001862 | Ga0496112_0001862_9089_10204 | 348 |
| 159 | 3300050511 | nmdc:mga08y16_182595_c1 | nmdc:mga08y16_182595_c1_803_1915 | 348 |
| 160 | 3300050515 | nmdc:mga0a205_99478_c1 | nmdc:mga0a205_99478_c1_238_1347 | 348 |
| 161 | 3300005435 | Ga0070714_100246923 | Ga0070714_1002469231 | 349 |
| 162 | 3300005439 | Ga0070711_100060412 | Ga0070711_1000604122 | 349 |
| 163 | 3300005445 | Ga0070708_100206102 | Ga0070708_1002061021 | 349 |
| 164 | 3300005545 | Ga0070695_100105554 | Ga0070695_1001055541 | 349 |
| 165 | 3300025916 | Ga0207663_10087273 | Ga0207663_100872733 | 349 |
| 166 | 3300005471 | Ga0070698_100313207 | Ga0070698_1003132072 | 350 |
| 167 | 3300005546 | Ga0070696_100001479 | Ga0070696_1000014793 | 350 |
| 168 | 3300009093 | Ga0105240_10001026 | Ga0105240_1000102617 | 350 |
| 169 | 3300009545 | Ga0105237_10023059 | Ga0105237_100230595 | 350 |
| 170 | 3300025920 | Ga0207649_10061279 | Ga0207649_100612792 | 350 |
| 171 | 3300025922 | Ga0207646_10000723 | Ga0207646_100007232 | 350 |
| 172 | 3300025922 | Ga0207646_10001254 | Ga0207646_1000125412 | 350 |
| 173 | 3300047319 | Ga0495674_0041222 | Ga0495674_0041222_1272_2381 | 350 |
| 174 | 3300005327 | Ga0070658_10396740 | Ga0070658_103967401 | 351 |
| 175 | 3300006847 | Ga0075431_100070076 | Ga0075431_1000700762 | 351 |
| 176 | 3300014969 | Ga0157376_10102668 | Ga0157376_101026681 | 351 |
| 177 | 3300025921 | Ga0207652_10406729 | Ga0207652_104067291 | 351 |
| 178 | 3300044694 | Ga0466963_0084404 | Ga0466963_0084404_505_1596 | 351 |
| 179 | 3300045976 | Ga0466967_0081948 | Ga0466967_0081948_573_1664 | 351 |
| 180 | 3300046472 | Ga0495580_0027159 | Ga0495580_0027159_1008_2237 | 351 |
| 181 | 3300050510 | nmdc:mga06r32_15925_c1 | nmdc:mga06r32_15925_c1_4256_5395 | 351 |
| 182 | 3300006871 | Ga0075434_100051735 | Ga0075434_1000517352 | 352 |
| 183 | 3300049585 | Ga0501069_0133379 | Ga0501069_0133379_72_1190 | 352 |
| 184 | 3300005329 | Ga0070683_100057315 | Ga0070683_1000573152 | 353 |
| 185 | 3300005353 | Ga0070669_100034455 | Ga0070669_1000344553 | 353 |
| 186 | 3300009093 | Ga0105240_10005878 | Ga0105240_100058784 | 353 |
| 187 | 3300009093 | Ga0105240_10041033 | Ga0105240_100410332 | 353 |
| 188 | 3300009147 | Ga0114129_10013486 | Ga0114129_100134868 | 353 |
| 189 | 3300009147 | Ga0114129_10081841 | Ga0114129_100818414 | 353 |
| 190 | 3300009177 | Ga0105248_10102088 | Ga0105248_101020883 | 353 |
| 191 | 3300009545 | Ga0105237_10038922 | Ga0105237_100389224 | 353 |
| 192 | 3300014326 | Ga0157380_10222121 | Ga0157380_102221211 | 353 |
| 193 | 3300025913 | Ga0207695_10012474 | Ga0207695_100124745 | 353 |
| 194 | 3300025913 | Ga0207695_10200021 | Ga0207695_102000212 | 353 |
| 195 | 3300025914 | Ga0207671_10065040 | Ga0207671_100650402 | 353 |
| 196 | 3300031344 | Ga0265316_10047097 | Ga0265316_100470972 | 353 |
| 197 | 3300044842 | Ga0466957_0053785 | Ga0466957_0053785_832_1992 | 353 |
| 198 | 3300050507 | nmdc:mga05p37_151485_c1 | nmdc:mga05p37_151485_c1_1366_2493 | 353 |
| 199 | 3300050507 | nmdc:mga05p37_7551_c1 | nmdc:mga05p37_7551_c1_797_1918 | 353 |
| 200 | 3300005440 | Ga0070705_100058319 | Ga0070705_1000583191 | 354 |
| 201 | 3300005467 | Ga0070706_100076846 | Ga0070706_1000768462 | 354 |
| 202 | 3300005468 | Ga0070707_100129071 | Ga0070707_1001290712 | 354 |
| 203 | 3300005545 | Ga0070695_100033596 | Ga0070695_1000335961 | 354 |
| 204 | 3300005844 | Ga0068862_100092645 | Ga0068862_1000926451 | 354 |
| 205 | 3300009093 | Ga0105240_10030357 | Ga0105240_100303574 | 354 |
| 206 | 3300009177 | Ga0105248_10300227 | Ga0105248_103002271 | 354 |
| 207 | 3300009545 | Ga0105237_10270594 | Ga0105237_102705941 | 354 |
| 208 | 3300009553 | Ga0105249_10183176 | Ga0105249_101831762 | 354 |
| 209 | 3300025922 | Ga0207646_10306671 | Ga0207646_103066712 | 354 |
| 210 | 3300026118 | Ga0207675_100071984 | Ga0207675_1000719843 | 354 |
| 211 | 3300039437 | Ga0436365_1688252 | Ga0436365_1688252_957_2084 | 354 |
| 212 | 3300047471 | Ga0495684_0053306 | Ga0495684_0053306_1082_2308 | 354 |
| 213 | 3300048088 | Ga0495602_0052985 | Ga0495602_0052985_1954_3180 | 354 |
| 214 | 3300049571 | Ga0501034_0168208 | Ga0501034_0168208_925_2052 | 354 |
| 215 | 3300049579 | Ga0501043_0022760 | Ga0501043_0022760_3318_4445 | 354 |
| 216 | 3300049822 | Ga0501035_0027550 | Ga0501035_0027550_254_1381 | 354 |
| 217 | 3300049823 | Ga0501044_0025057 | Ga0501044_0025057_3570_4697 | 354 |
| 218 | 3300005353 | Ga0070669_100256567 | Ga0070669_1002565671 | 355 |
| 219 | 3300005618 | Ga0068864_100449433 | Ga0068864_1004494331 | 355 |
| 220 | 3300005844 | Ga0068862_100013103 | Ga0068862_1000131033 | 355 |
| 221 | 3300006852 | Ga0075433_10008951 | Ga0075433_100089513 | 355 |
| 222 | 3300009094 | Ga0111539_10029418 | Ga0111539_100294183 | 355 |
| 223 | 3300009094 | Ga0111539_10171132 | Ga0111539_101711322 | 355 |
| 224 | 3300009553 | Ga0105249_10040143 | Ga0105249_100401434 | 355 |
| 225 | 3300011119 | Ga0105246_10029978 | Ga0105246_100299782 | 355 |
| 226 | 3300025916 | Ga0207663_10153344 | Ga0207663_101533442 | 355 |
| 227 | 3300025923 | Ga0207681_10274663 | Ga0207681_102746631 | 355 |
| 228 | 3300026118 | Ga0207675_100133867 | Ga0207675_1001338672 | 355 |
| 229 | 3300026121 | Ga0207683_10303489 | Ga0207683_103034892 | 355 |
| 230 | 3300027907 | Ga0207428_10026988 | Ga0207428_100269882 | 355 |
| 231 | 3300028380 | Ga0268265_10044978 | Ga0268265_100449783 | 355 |
| 232 | 3300050510 | nmdc:mga06r32_194416_c1 | nmdc:mga06r32_194416_c1_35_1171 | 355 |
| 233 | 3300050511 | nmdc:mga08y16_104060_c1 | nmdc:mga08y16_104060_c1_849_1985 | 355 |
| 234 | 3300050511 | nmdc:mga08y16_46455_c1 | nmdc:mga08y16_46455_c1_3155_4291 | 355 |
| 235 | 3300050512 | nmdc:mga0n895_1278_c1 | nmdc:mga0n895_1278_c1_17396_18514 | 355 |
| 236 | 3300050515 | nmdc:mga0a205_23719_c1 | nmdc:mga0a205_23719_c1_3591_4727 | 355 |
| 237 | 3300005445 | Ga0070708_100221907 | Ga0070708_1002219072 | 356 |
| 238 | 3300005577 | Ga0068857_100212677 | Ga0068857_1002126772 | 356 |
| 239 | 3300006846 | Ga0075430_100054472 | Ga0075430_1000544722 | 356 |
| 240 | 3300009147 | Ga0114129_10013693 | Ga0114129_100136939 | 356 |
| 241 | 3300050507 | nmdc:mga05p37_50613_c1 | nmdc:mga05p37_50613_c1_3400_4503 | 356 |
| 242 | 3300050507 | nmdc:mga05p37_538204_c1 | nmdc:mga05p37_538204_c1_151_1257 | 356 |
| 243 | 3300006178 | Ga0075367_10060382 | Ga0075367_100603822 | 357 |
| 244 | 3300049823 | Ga0501044_0050729 | Ga0501044_0050729_252_1415 | 357 |
| 245 | iso_pu_bacteria | 8055588893 | 8055592145 | 361 |
| 246 | 3300005843 | Ga0068860_100013770 | Ga0068860_1000137702 | 362 |
| 247 | 3300025923 | Ga0207681_10107227 | Ga0207681_101072271 | 362 |
| 248 | 3300025941 | Ga0207711_10228173 | Ga0207711_102281732 | 362 |
| 249 | 3300028381 | Ga0268264_10134768 | Ga0268264_101347682 | 362 |
| 250 | 3300047320 | Ga0495672_0051453 | Ga0495672_0051453_813_1958 | 362 |
| 251 | 3300028381 | Ga0268264_10014426 | Ga0268264_100144267 | 376 |
| 252 | 3300014326 | Ga0157380_10156508 | Ga0157380_101565083 | 377 |
| 253 | 3300005290 | Ga0065712_10082153 | Ga0065712_100821532 | 378 |
| 254 | 3300014325 | Ga0163163_10161255 | Ga0163163_101612552 | 378 |
| 255 | 3300014326 | Ga0157380_10025793 | Ga0157380_100257931 | 378 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.856 | 55 | 376 |
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.8404 | 55 | 376 |
| 3ban-assembly1.cif.gz_B | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.8334 | 54 | 376 |
| 1tz9-assembly1.cif.gz_B | crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 | 0.808 | 56 | 378 |
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.7904 | 55 | 376 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8823 | 202 | 376 | 3.20.20.150 |
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8487 | 55 | 376 | 3.20.20.150 |
| 3banB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8334 | 54 | 376 | 3.20.20.150 |
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8208 | 55 | 376 | 3.20.20.150 |
| 1tz9A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7841 | 56 | 378 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9GB46-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9851 | 199 | 288 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A7C5I8R0-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.983 | 98 | 377 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A7X3VGW6-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9766 | 137 | 378 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A5N9D0B8-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9745 | 199 | 377 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A2V9GB46-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9744 | 199 | 288 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar