F365210

General Info

Members Datasets Scaffolds Average Seq Length
254 162 508 329

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0105119|Ga0501031_0105119_471_1568
Length 365
Sequence MRPHGLALGTGEERRLVAGASPCDDLAGEDRRVYAMTLRRQGSISSHPLDRVELRDPEPGRGEIRLRIRACAICRTDLHVIEGDLPPHRMPLVPGHQAVGVVDRLGPGCRRFHPGDRAGIAWLRGTCGACEFCRSGAENLCEASRYTGYDDDGGYAELAVVPEAFAYPIPAAFPDLDAAPLLCAGIIGYRALGRTELARGGRLGLYGFGSSAHVVLQIARHRGTEVFVATRGARHREFARRLGAAWVGDATATMPGRLDAAIVFAPAGEIVPPALRAVRKGGVVVLAGIHMSPIPAMEYGPHLFHEKTLRSVEANTRRDGDDLLREAAEIPIRPSVTTFPLEAANEALSDLKADRLDGTGVLVVA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.79
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0105119 3300049568 Bacteria 1842
2 Ga0058863_10077723 3300004799 Bacteria 2073
3 Ga0065714_10064424 3300005288 Bacteria 236118
4 Ga0065704_10004257 3300005289 Bacteria 3979
5 Ga0065715_10005443 3300005293 Bacteria 7010
6 Ga0070676_10171113 3300005328 Bacteria 1405
7 Ga0070683_100051857 3300005329 Bacteria 3800
8 Ga0070683_100195632 3300005329 Bacteria 1920
9 Ga0070690_100083584 3300005330 Bacteria 2092
10 Ga0070670_100124328 3300005331 Bacteria 2226
11 Ga0070670_100363861 3300005331 Bacteria 1272
12 Ga0068869_100373009 3300005334 Bacteria 1168
13 Ga0070680_100031584 3300005336 Bacteria 4259
14 Ga0070680_100204450 3300005336 Bacteria 1665
15 Ga0070682_100112132 3300005337 Bacteria 1819
16 Ga0068868_100013566 3300005338 Bacteria 5980
17 Ga0070661_100022523 3300005344 Bacteria 4511
18 Ga0070692_10020411 3300005345 Bacteria 3213
19 Ga0070669_100221671 3300005353 Bacteria 1495
20 Ga0070675_100006430 3300005354 Bacteria 9017
21 Ga0070659_100003969 3300005366 Bacteria 10532
22 Ga0070714_100002070 3300005435 Bacteria 14687
23 Ga0070694_100019978 3300005444 Unclassified 4267
24 Ga0070662_100077601 3300005457 Bacteria 2465
25 Ga0070681_10000075 3300005458 Bacteria 74042
26 Ga0070681_10162321 3300005458 Bacteria 2159
27 Ga0070707_100002810 3300005468 Bacteria 16549
28 Ga0070707_100088927 3300005468 Bacteria 2988
29 Ga0070707_100121634 3300005468 Bacteria 2535
30 Ga0070679_100000033 3300005530 Bacteria 104826
31 Ga0070679_100240057 3300005530 Bacteria 1770
32 Ga0070684_100152044 3300005535 Bacteria 2097
33 Ga0068853_100146221 3300005539 Bacteria 2124
34 Ga0070672_100195357 3300005543 Bacteria 1691
35 Ga0070695_100350747 3300005545 Unclassified 1105
36 Ga0070696_100024711 3300005546 Unclassified 4083
37 Ga0070664_100014293 3300005564 Bacteria 6473
38 Ga0068857_100004866 3300005577 Bacteria 11391
39 Ga0068857_100007275 3300005577 Bacteria 9535
40 Ga0068857_100009362 3300005577 Bacteria 8505
41 Ga0070702_100011062 3300005615 Bacteria 4476
42 Ga0070702_100145508 3300005615 Unclassified 1515
43 Ga0068859_100020665 3300005617 Bacteria 6607
44 Ga0068859_100124041 3300005617 Unclassified 2651
45 Ga0068859_100422847 3300005617 Unclassified 1429
46 Ga0068864_100026717 3300005618 Bacteria 4868
47 Ga0068864_100051094 3300005618 Bacteria 3559
48 Ga0068861_100145019 3300005719 Bacteria 1942
49 Ga0068870_10034631 3300005840 Bacteria 2585
50 Ga0068858_100244407 3300005842 Unclassified 1704
51 Ga0068858_100334717 3300005842 Bacteria 1448
52 Ga0068860_100315320 3300005843 Bacteria 1534
53 Ga0068862_100192056 3300005844 Bacteria 1838
54 Ga0070717_10014761 3300006028 Bacteria 6009
55 Ga0070717_10047137 3300006028 Bacteria 3529
56 Ga0070715_10000017 3300006163 Bacteria 132686
57 Ga0075428_100124540 3300006844 Bacteria 2805
58 Ga0075431_100243353 3300006847 Bacteria 1829
59 Ga0075434_100027947 3300006871 Bacteria 5538
60 Ga0075434_100270613 3300006871 Unclassified 1718
61 Ga0075429_100052100 3300006880 Bacteria 3560
62 Ga0097620_100020664 3300006931 Bacteria 6607
63 Ga0097620_100422845 3300006931 Unclassified 1429
64 Ga0075435_100012184 3300007076 Bacteria 6359
65 Ga0075435_100113353 3300007076 Unclassified 2256
66 Ga0111539_10005277 3300009094 Bacteria 16731
67 Ga0111539_10010219 3300009094 Bacteria 11826
68 Ga0111539_10218897 3300009094 Bacteria 2218
69 Ga0105245_10038654 3300009098 Bacteria 4246
70 Ga0114129_10001497 3300009147 Bacteria 31616
71 Ga0114129_10024294 3300009147 Bacteria 8586
72 Ga0114129_10112347 3300009147 Bacteria 3757
73 Ga0114129_10197902 3300009147 Bacteria 2724
74 Ga0105237_10351782 3300009545 Unclassified 1478
75 Ga0105238_10057227 3300009551 Bacteria 3910
76 Ga0105239_10021269 3300010375 Bacteria 7152
77 Ga0105246_10025847 3300011119 Unclassified 3829
78 Ga0157346_1000550 3300012480 Bacteria 1606
79 Ga0157369_10350461 3300013105 Bacteria 1533
80 Ga0157378_10020533 3300013297 Bacteria 5807
81 Ga0157372_10152283 3300013307 Bacteria 2670
82 Ga0157375_10041492 3300013308 Bacteria 4443
83 Ga0157375_10268538 3300013308 Bacteria 1868
84 Ga0157375_10380731 3300013308 Bacteria 1578
85 Ga0163163_10001479 3300014325 Bacteria 19898
86 Ga0163163_10018184 3300014325 Bacteria 6572
87 Ga0163163_10023160 3300014325 Bacteria 5892
88 Ga0157377_10019264 3300014745 Bacteria 3563
89 Ga0213875_10060855 3300021388 Bacteria 1766
90 Ga0207685_10000017 3300025905 Bacteria 146902
91 Ga0207643_10022259 3300025908 Bacteria 3487
92 Ga0207707_10000003 3300025912 Bacteria 642592
93 Ga0207707_10163270 3300025912 Bacteria 1947
94 Ga0207660_10027755 3300025917 Bacteria 3866
95 Ga0207660_10281535 3300025917 Bacteria 1320
96 Ga0207649_10132974 3300025920 Bacteria 1692
97 Ga0207652_10000024 3300025921 Bacteria 157748
98 Ga0207652_10283526 3300025921 Bacteria 1494
99 Ga0207659_10008087 3300025926 Bacteria 6510
100 Ga0207687_10024414 3300025927 Bacteria 4039
101 Ga0207700_10000532 3300025928 Bacteria 22353
102 Ga0207664_10004681 3300025929 Bacteria 9285
103 Ga0207690_10113137 3300025932 Bacteria 1958
104 Ga0207706_10004793 3300025933 Bacteria 12671
105 Ga0207665_10091736 3300025939 Bacteria 2106
106 Ga0207665_10190481 3300025939 Bacteria 1490
107 Ga0207689_10005253 3300025942 Bacteria 11618
108 Ga0207689_10230372 3300025942 Unclassified 1531
109 Ga0207661_10166624 3300025944 Bacteria 1915
110 Ga0207679_10075541 3300025945 Unclassified 2557
111 Ga0207712_10349834 3300025961 Bacteria 1228
112 Ga0207668_10062578 3300025972 Bacteria 2621
113 Ga0207640_10434181 3300025981 Unclassified 1078
114 Ga0207658_10226059 3300025986 Bacteria 1577
115 Ga0207677_10084144 3300026023 Bacteria 2292
116 Ga0207703_10307411 3300026035 Bacteria 1448
117 Ga0207639_10134237 3300026041 Bacteria 2053
118 Ga0207676_10030570 3300026095 Bacteria 4044
119 Ga0207676_10114996 3300026095 Bacteria 2258
120 Ga0207674_10000886 3300026116 Bacteria 39131
121 Ga0207674_10002129 3300026116 Bacteria 25025
122 Ga0207675_100044425 3300026118 Bacteria 4152
123 Ga0207675_100096019 3300026118 Bacteria 2790
124 Ga0209998_10018248 3300027717 Bacteria 1489
125 Ga0207428_10015828 3300027907 Bacteria 6509
126 Ga0207428_10080174 3300027907 Bacteria 2551
127 Ga0268265_10036645 3300028380 Bacteria 3594
128 Ga0268264_10274599 3300028381 Bacteria 1576
129 Ga0265316_10027901 3300031344 Unclassified 4667
130 Ga0316577_10061757 3300031733 Bacteria 2091
131 Ga0307406_10168670 3300031901 Bacteria 1582
132 Ga0307415_100069277 3300032126 Bacteria 2473
133 Ga0373926_0001094 3300035083 Bacteria 7999
134 Ga0373944_0013288 3300035089 Bacteria 2281
135 Ga0373945_0001811 3300035116 Bacteria 6603
136 Ga0373954_0016503 3300035118 Bacteria 3306
137 Ga0373943_0005023 3300035170 Bacteria 5968
138 Ga0373946_0032275 3300035171 Bacteria 2102
139 Ga0373924_0003520 3300035410 Bacteria 5399
140 Ga0373935_0084173 3300035692 Bacteria 2071
141 Ga0373935_0210845 3300035692 Bacteria 1346
142 Ga0373927_0008248 3300035695 Bacteria 7012
143 Ga0373933_0046849 3300035724 Bacteria 2569
144 Ga0373947_0004171 3300035725 Bacteria 8490
145 Ga0373937_0119319 3300036401 Bacteria 2457
146 Ga0316582_0004041 3300036647 Bacteria 7330
147 Ga0316584_0037680 3300036712 Bacteria 3594
148 Ga0373925_0022015 3300037068 Bacteria 4645
149 Ga0373925_0246011 3300037068 Bacteria 1433
150 Ga0316581_0058304 3300037588 Bacteria 1184
151 Ga0400489_54243 3300039093 Bacteria 7995
152 Ga0436365_1333002 3300039437 Unclassified 1514
153 Ga0436362_1045680 3300039453 Unclassified 2095
154 Ga0439456_033723 3300042013 Bacteria 1102
155 Ga0466957_0000055 3300044842 Bacteria 42244
156 Ga0466958_0099439 3300045836 Unclassified 1807
157 Ga0495582_0125130 3300046473 Bacteria 1450
158 Ga0495608_0102195 3300046511 Bacteria 1848
159 Ga0495630_0089267 3300046517 Bacteria 2328
160 Ga0495667_0084404 3300046559 Bacteria 2062
161 Ga0495635_0192517 3300046663 Bacteria 1384
162 Ga0495604_0174460 3300047317 Bacteria 1509
163 Ga0496112_0003394 3300048915 Bacteria 13156
164 Ga0496113_0008128 3300048916 Bacteria 6812
165 Ga0501032_0039561 3300049569 Bacteria 3207
166 Ga0501032_0118236 3300049569 Bacteria 1753
167 Ga0501033_0030370 3300049570 Bacteria 4062
168 Ga0501033_0101153 3300049570 Bacteria 2103
169 Ga0501036_0011682 3300049572 Bacteria 7277
170 Ga0501036_0036152 3300049572 Bacteria 4179
171 Ga0501038_0002451 3300049574 Bacteria 17280
172 Ga0501038_0009398 3300049574 Bacteria 8972
173 Ga0501038_0028443 3300049574 Unclassified 4967
174 Ga0501038_0135551 3300049574 Bacteria 2018
175 Ga0501039_0025436 3300049575 Bacteria 4549
176 Ga0501039_0029256 3300049575 Bacteria 4242
177 Ga0501039_0056441 3300049575 Bacteria 3042
178 Ga0501040_0000693 3300049576 Bacteria 20769
179 Ga0501040_0275203 3300049576 Bacteria 1202
180 Ga0501041_0000202 3300049577 Bacteria 27560
181 Ga0501041_0089833 3300049577 Bacteria 1896
182 Ga0501041_0092531 3300049577 Bacteria 1867
183 Ga0501041_0254047 3300049577 Bacteria 1105
184 Ga0501042_0003597 3300049578 Bacteria 9773
185 Ga0501042_0009510 3300049578 Bacteria 6481
186 Ga0501042_0023515 3300049578 Bacteria 4313
187 Ga0501043_0005282 3300049579 Bacteria 10442
188 Ga0501043_0126505 3300049579 Bacteria 2004
189 Ga0501046_0002966 3300049580 Bacteria 15699
190 Ga0501046_0173575 3300049580 Bacteria 1616
191 Ga0501048_0001191 3300049582 Bacteria 19694
192 Ga0501048_0011845 3300049582 Bacteria 6502
193 Ga0501048_0019136 3300049582 Bacteria 5029
194 Ga0501048_0128399 3300049582 Unclassified 1793
195 Ga0501068_0104622 3300049584 Bacteria 1756
196 Ga0501069_0060664 3300049585 Bacteria 2112
197 Ga0501070_0216279 3300049586 Bacteria 1572
198 Ga0501070_0320477 3300049586 Unclassified 1261
199 Ga0501071_0039185 3300049587 Bacteria 3389
200 Ga0501071_0059975 3300049587 Bacteria 2753
201 Ga0501072_0001364 3300049588 Bacteria 18342
202 Ga0501072_0012831 3300049588 Bacteria 6406
203 Ga0501072_0051721 3300049588 Bacteria 3234
204 Ga0501072_0074449 3300049588 Bacteria 2685
205 Ga0501074_0010751 3300049590 Bacteria 6649
206 Ga0501074_0241524 3300049590 Bacteria 1285
207 Ga0501075_0000010 3300049591 Bacteria 87481
208 Ga0501075_0040352 3300049591 Bacteria 3495
209 Ga0501075_0192899 3300049591 Bacteria 1554
210 Ga0501076_0000027 3300049592 Bacteria 78077
211 Ga0501076_0002029 3300049592 Bacteria 13858
212 Ga0501076_0027064 3300049592 Bacteria 4447
213 Ga0501077_0001321 3300049593 Bacteria 14976
214 Ga0501077_0398127 3300049593 Bacteria 880
215 Ga0501079_0001812 3300049741 Bacteria 15267
216 Ga0501079_0012818 3300049741 Bacteria 6400
217 Ga0501079_0051630 3300049741 Bacteria 3175
218 Ga0501080_0001316 3300049742 Bacteria 20671
219 Ga0501080_0056975 3300049742 Bacteria 3639
220 Ga0501080_0255275 3300049742 Bacteria 1598
221 Ga0501081_0002198 3300049743 Bacteria 12264
222 Ga0501081_0013429 3300049743 Bacteria 5386
223 Ga0501083_0048984 3300049744 Bacteria 2850
224 Ga0501083_0105252 3300049744 Bacteria 1858
225 Ga0501035_0006000 3300049822 Bacteria 11441
226 Ga0501035_0212649 3300049822 Bacteria 1654
227 Ga0501044_0042883 3300049823 Bacteria 4703
228 Ga0501044_0079855 3300049823 Bacteria 3314
229 Ga0501045_0000713 3300049824 Bacteria 21161
230 Ga0501045_0000945 3300049824 Bacteria 19005
231 Ga0501045_0029667 3300049824 Bacteria 3955
232 nmdc:mga05p37_123984_c1 3300050507 Bacteria 3174
233 nmdc:mga05p37_33835_c1 3300050507 Bacteria 6260
234 nmdc:mga05p37_389589_c1 3300050507 Bacteria 1630
235 nmdc:mga05p37_474699_c1 3300050507 Bacteria 1442
236 nmdc:mga05p37_476620_c1 3300050507 Bacteria 1438
237 nmdc:mga05p37_83033_c1 3300050507 Bacteria 3947
238 nmdc:mga0qj67_410655_c1 3300050509 Bacteria 1092
239 nmdc:mga06r32_597386_c1 3300050510 Bacteria 1075
240 nmdc:mga08y16_26672_c1 3300050511 Bacteria 6089
241 nmdc:mga0n895_65916_c1 3300050512 Unclassified 3585
242 nmdc:mga0a205_219720_c1 3300050515 Bacteria 1786
243 nmdc:mga0a205_309747_c1 3300050515 Bacteria 1451
244 nmdc:mga0a205_341228_c1 3300050515 Bacteria 1366
245 nmdc:mga0a205_430849_c1 3300050515 Bacteria 1180
246 Ga0501084_0021484 3300054114 Bacteria 5380
247 Ga0501084_0104230 3300054114 Bacteria 2382
248 Ga0501082_0000780 3300060353 Bacteria 27961
249 Ga0501082_0007251 3300060353 Bacteria 9563
250 Ga0501082_0154481 3300060353 Bacteria 1994
251 Ga0530510_0000010 3300061734 Bacteria 155647
252 Ga0530510_0001114 3300061734 Bacteria 17856
253 Ga0530510_0001611 3300061734 Bacteria 15227
254 Ga0530510_0305103 3300061734 Bacteria 1192
255 Ga0501031_0105119
256 Ga0058863_10077723
257 Ga0065714_10064424
258 Ga0065704_10004257
259 Ga0065715_10005443
260 Ga0070676_10171113
261 Ga0070683_100051857
262 Ga0070683_100195632
263 Ga0070690_100083584
264 Ga0070670_100124328
265 Ga0070670_100363861
266 Ga0068869_100373009
267 Ga0070680_100031584
268 Ga0070680_100204450
269 Ga0070682_100112132
270 Ga0068868_100013566
271 Ga0070661_100022523
272 Ga0070692_10020411
273 Ga0070669_100221671
274 Ga0070675_100006430
275 Ga0070659_100003969
276 Ga0070714_100002070
277 Ga0070694_100019978
278 Ga0070662_100077601
279 Ga0070681_10000075
280 Ga0070681_10162321
281 Ga0070707_100002810
282 Ga0070707_100088927
283 Ga0070707_100121634
284 Ga0070679_100000033
285 Ga0070679_100240057
286 Ga0070684_100152044
287 Ga0068853_100146221
288 Ga0070672_100195357
289 Ga0070695_100350747
290 Ga0070696_100024711
291 Ga0070664_100014293
292 Ga0068857_100004866
293 Ga0068857_100007275
294 Ga0068857_100009362
295 Ga0070702_100011062
296 Ga0070702_100145508
297 Ga0068859_100020665
298 Ga0068859_100124041
299 Ga0068859_100422847
300 Ga0068864_100026717
301 Ga0068864_100051094
302 Ga0068861_100145019
303 Ga0068870_10034631
304 Ga0068858_100244407
305 Ga0068858_100334717
306 Ga0068860_100315320
307 Ga0068862_100192056
308 Ga0070717_10014761
309 Ga0070717_10047137
310 Ga0070715_10000017
311 Ga0075428_100124540
312 Ga0075431_100243353
313 Ga0075434_100027947
314 Ga0075434_100270613
315 Ga0075429_100052100
316 Ga0097620_100020664
317 Ga0097620_100422845
318 Ga0075435_100012184
319 Ga0075435_100113353
320 Ga0111539_10005277
321 Ga0111539_10010219
322 Ga0111539_10218897
323 Ga0105245_10038654
324 Ga0114129_10001497
325 Ga0114129_10024294
326 Ga0114129_10112347
327 Ga0114129_10197902
328 Ga0105237_10351782
329 Ga0105238_10057227
330 Ga0105239_10021269
331 Ga0105246_10025847
332 Ga0157346_1000550
333 Ga0157369_10350461
334 Ga0157378_10020533
335 Ga0157372_10152283
336 Ga0157375_10041492
337 Ga0157375_10268538
338 Ga0157375_10380731
339 Ga0163163_10001479
340 Ga0163163_10018184
341 Ga0163163_10023160
342 Ga0157377_10019264
343 Ga0213875_10060855
344 Ga0207685_10000017
345 Ga0207643_10022259
346 Ga0207707_10000003
347 Ga0207707_10163270
348 Ga0207660_10027755
349 Ga0207660_10281535
350 Ga0207649_10132974
351 Ga0207652_10000024
352 Ga0207652_10283526
353 Ga0207659_10008087
354 Ga0207687_10024414
355 Ga0207700_10000532
356 Ga0207664_10004681
357 Ga0207690_10113137
358 Ga0207706_10004793
359 Ga0207665_10091736
360 Ga0207665_10190481
361 Ga0207689_10005253
362 Ga0207689_10230372
363 Ga0207661_10166624
364 Ga0207679_10075541
365 Ga0207712_10349834
366 Ga0207668_10062578
367 Ga0207640_10434181
368 Ga0207658_10226059
369 Ga0207677_10084144
370 Ga0207703_10307411
371 Ga0207639_10134237
372 Ga0207676_10030570
373 Ga0207676_10114996
374 Ga0207674_10000886
375 Ga0207674_10002129
376 Ga0207675_100044425
377 Ga0207675_100096019
378 Ga0209998_10018248
379 Ga0207428_10015828
380 Ga0207428_10080174
381 Ga0268265_10036645
382 Ga0268264_10274599
383 Ga0265316_10027901
384 Ga0316577_10061757
385 Ga0307406_10168670
386 Ga0307415_100069277
387 Ga0373926_0001094
388 Ga0373944_0013288
389 Ga0373945_0001811
390 Ga0373954_0016503
391 Ga0373943_0005023
392 Ga0373946_0032275
393 Ga0373924_0003520
394 Ga0373935_0084173
395 Ga0373935_0210845
396 Ga0373927_0008248
397 Ga0373933_0046849
398 Ga0373947_0004171
399 Ga0373937_0119319
400 Ga0316582_0004041
401 Ga0316584_0037680
402 Ga0373925_0022015
403 Ga0373925_0246011
404 Ga0316581_0058304
405 Ga0400489_54243
406 Ga0436365_1333002
407 Ga0436362_1045680
408 Ga0439456_033723
409 Ga0466957_0000055
410 Ga0466958_0099439
411 Ga0495582_0125130
412 Ga0495608_0102195
413 Ga0495630_0089267
414 Ga0495667_0084404
415 Ga0495635_0192517
416 Ga0495604_0174460
417 Ga0496112_0003394
418 Ga0496113_0008128
419 Ga0501032_0039561
420 Ga0501032_0118236
421 Ga0501033_0030370
422 Ga0501033_0101153
423 Ga0501036_0011682
424 Ga0501036_0036152
425 Ga0501038_0002451
426 Ga0501038_0009398
427 Ga0501038_0028443
428 Ga0501038_0135551
429 Ga0501039_0025436
430 Ga0501039_0029256
431 Ga0501039_0056441
432 Ga0501040_0000693
433 Ga0501040_0275203
434 Ga0501041_0000202
435 Ga0501041_0089833
436 Ga0501041_0092531
437 Ga0501041_0254047
438 Ga0501042_0003597
439 Ga0501042_0009510
440 Ga0501042_0023515
441 Ga0501043_0005282
442 Ga0501043_0126505
443 Ga0501046_0002966
444 Ga0501046_0173575
445 Ga0501048_0001191
446 Ga0501048_0011845
447 Ga0501048_0019136
448 Ga0501048_0128399
449 Ga0501068_0104622
450 Ga0501069_0060664
451 Ga0501070_0216279
452 Ga0501070_0320477
453 Ga0501071_0039185
454 Ga0501071_0059975
455 Ga0501072_0001364
456 Ga0501072_0012831
457 Ga0501072_0051721
458 Ga0501072_0074449
459 Ga0501074_0010751
460 Ga0501074_0241524
461 Ga0501075_0000010
462 Ga0501075_0040352
463 Ga0501075_0192899
464 Ga0501076_0000027
465 Ga0501076_0002029
466 Ga0501076_0027064
467 Ga0501077_0001321
468 Ga0501077_0398127
469 Ga0501079_0001812
470 Ga0501079_0012818
471 Ga0501079_0051630
472 Ga0501080_0001316
473 Ga0501080_0056975
474 Ga0501080_0255275
475 Ga0501081_0002198
476 Ga0501081_0013429
477 Ga0501083_0048984
478 Ga0501083_0105252
479 Ga0501035_0006000
480 Ga0501035_0212649
481 Ga0501044_0042883
482 Ga0501044_0079855
483 Ga0501045_0000713
484 Ga0501045_0000945
485 Ga0501045_0029667
486 nmdc:mga05p37_123984_c1
487 nmdc:mga05p37_33835_c1
488 nmdc:mga05p37_389589_c1
489 nmdc:mga05p37_474699_c1
490 nmdc:mga05p37_476620_c1
491 nmdc:mga05p37_83033_c1
492 nmdc:mga0qj67_410655_c1
493 nmdc:mga06r32_597386_c1
494 nmdc:mga08y16_26672_c1
495 nmdc:mga0n895_65916_c1
496 nmdc:mga0a205_219720_c1
497 nmdc:mga0a205_309747_c1
498 nmdc:mga0a205_341228_c1
499 nmdc:mga0a205_430849_c1
500 Ga0501084_0021484
501 Ga0501084_0104230
502 Ga0501082_0000780
503 Ga0501082_0007251
504 Ga0501082_0154481
505 Ga0530510_0000010
506 Ga0530510_0001114
507 Ga0530510_0001611
508 Ga0530510_0305103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

60

171

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

212

329

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9436 1 331
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.9436 1 330
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9433 1 331
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9414 1 334
7kc2-assembly1.cif.gz_A symmetry in yeast alcohol dehydrogenase 1 -closed form with nadh 0.9317 2 330
ID Description Score Start End Superfamily
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9845 151 278 3.40.50.720
af_P9WQC1_8_164_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9824 1 150 3.90.180.10
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 151 278 3.40.50.720
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.951 2 151 3.90.180.10
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9478 1 332 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A2V9U0Z8-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.992 1 330 GO:0004022
GO:0005737
AF-A0A7V4DEN2-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein (EC 1.-.-.-) 0.9909 1 331 GO:0004022
GO:0005737
AF-A0A7V4DEN2-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein (EC 1.-.-.-) 0.9879 1 331 GO:0004022
GO:0005737
AF-A0A7X8AQ86-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9876 1 331 GO:0004022
GO:0005737
AF-A0A239NS91-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9869 1 330 GO:0004022
GO:0005737
GO:0008270

Map