F364666

General Info

Members Datasets Scaffolds Average Seq Length
254 169 254 591

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100042700|Ga0070714_1000427003
Length 623
Sequence VSEPVKAEDVSAASVKAGAGLGKRLRPDAPPLRGNTYRDAWCGQVLADRVDSEVRVAGWVHRRRDHGGLIFIDLRDRTGIVQLVFNPDRSGASFELAHQLRAEDVLSASGTVVRRSAETVNPELATGEVELLVSAAGRLADAETPPFQIEGFSGEVGEDTRLRYRYLDLRREQMQQALALRHRVVAAMREFLGAEGFLDVETPVLTRSTPEGARDFLVPSRQQQGSFYALPQSPQLFKQLLMISGLERYFQIARCFRDEATRADRQAEFTQLDVEMSFVNGEDVIEVNERLLAHVFAQVGGPQVEVPMQRMCYDEAMGRFGTDRPDLRFGLELVDLSDALRETEFKVFRSVLEGGGAIRGLNAGRRELPRSELDGLISRAQDLGAKGLVWAFREGDGWRSPTAKFLSAEELADLNGRLGAEEGDLLLLVADKRPVTDAVLGQLRLDLGEKFGLIDENEHRLVWIVDWPLLDWNEDEQRWDAMHHPFTAPAGEFDPDNPGAARAQAYDVVWNGQELGGGSIRIHDAGTQEQVFAALGIDRETAEARFGFLLEALRYGAPPHGGIAYGVDRIVQRLSGAETIRDVIAFPKTASGFDLLTGAPAPVDQIQLRELGVAVHKPELPGH

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 11.81
Rhizosphere 76.77
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000436 3300001977 Bacteria 6227
2 JGI24740J21852_10005534 3300001979 Bacteria 5324
3 JGI25407J50210_10001130 3300003373 Bacteria 5879
4 Ga0070658_10014357 3300005327 Bacteria 6354
5 Ga0070658_10135481 3300005327 Bacteria 2054
6 Ga0070683_100001171 3300005329 Bacteria 19865
7 Ga0070682_100000011 3300005337 Bacteria 266253
8 Ga0068868_100000453 3300005338 Bacteria 27329
9 Ga0068868_100004287 3300005338 Bacteria 9988
10 Ga0068868_100022420 3300005338 Bacteria 4765
11 Ga0068868_100028183 3300005338 Bacteria 4292
12 Ga0070660_100013872 3300005339 Bacteria 5797
13 Ga0070660_100015463 3300005339 Bacteria 5512
14 Ga0070660_100024067 3300005339 Bacteria 4518
15 Ga0070691_10000002 3300005341 Bacteria 90686
16 Ga0070691_10018823 3300005341 Bacteria 3184
17 Ga0070661_100000145 3300005344 Bacteria 58346
18 Ga0070675_100000776 3300005354 Bacteria 22323
19 Ga0070675_100031138 3300005354 Bacteria 4311
20 Ga0070674_100000007 3300005356 Bacteria 145531
21 Ga0070688_100000169 3300005365 Bacteria 35241
22 Ga0070688_100002791 3300005365 Bacteria 8876
23 Ga0070659_100007047 3300005366 Bacteria 8142
24 Ga0070667_100018885 3300005367 Bacteria 5715
25 Ga0070714_100042700 3300005435 Bacteria 3832
26 Ga0070713_100001073 3300005436 Bacteria 17481
27 Ga0070711_100001686 3300005439 Bacteria 12237
28 Ga0070678_100094560 3300005456 Bacteria 2301
29 Ga0070662_100000002 3300005457 Bacteria 253208
30 Ga0068867_100000750 3300005459 Bacteria 21786
31 Ga0070685_10000013 3300005466 Bacteria 120875
32 Ga0070685_10000019 3300005466 Bacteria 105881
33 Ga0068853_100077446 3300005539 Bacteria 2905
34 Ga0070672_100000001 3300005543 Bacteria 204624
35 Ga0070693_100000215 3300005547 Bacteria 26935
36 Ga0070665_100008785 3300005548 Bacteria 10223
37 Ga0070665_100074806 3300005548 Bacteria 3393
38 Ga0070704_100074352 3300005549 Bacteria 2478
39 Ga0068854_100000113 3300005578 Bacteria 55436
40 Ga0068856_100001668 3300005614 Bacteria 23239
41 Ga0070702_100003734 3300005615 Bacteria 6866
42 Ga0068852_100000002 3300005616 Bacteria 268221
43 Ga0068852_100024813 3300005616 Bacteria 4850
44 Ga0068866_10000003 3300005718 Bacteria 281675
45 Ga0068851_10004719 3300005834 Bacteria 6167
46 Ga0068851_10007522 3300005834 Bacteria 5006
47 Ga0068858_100000120 3300005842 Bacteria 81766
48 Ga0068860_100002215 3300005843 Bacteria 20454
49 Ga0081538_10008449 3300005981 Bacteria 8735
50 Ga0075365_10000891 3300006038 Bacteria 12493
51 Ga0075363_100017854 3300006048 Bacteria 3526
52 Ga0070715_10000029 3300006163 Bacteria 88994
53 Ga0068865_100000094 3300006881 Bacteria 46651
54 Ga0068865_100011062 3300006881 Bacteria 5635
55 Ga0105245_10000026 3300009098 Bacteria 163660
56 Ga0105245_10002028 3300009098 Bacteria 18364
57 Ga0105245_10010880 3300009098 Bacteria 7913
58 Ga0105247_10000347 3300009101 Bacteria 40377
59 Ga0114129_10115786 3300009147 Bacteria 3694
60 Ga0105243_10008253 3300009148 Bacteria 8000
61 Ga0105243_10023590 3300009148 Bacteria 4688
62 Ga0105242_10001472 3300009176 Bacteria 18524
63 Ga0105248_10000020 3300009177 Bacteria 284637
64 Ga0105248_10255686 3300009177 Bacteria 1972
65 Ga0105238_10000048 3300009551 Bacteria 146322
66 Ga0105249_10008485 3300009553 Bacteria 8954
67 Ga0157371_10040163 3300013102 Bacteria 3344
68 Ga0157369_10000014 3300013105 Bacteria 266411
69 Ga0157378_10013876 3300013297 Bacteria 7047
70 Ga0157378_10028598 3300013297 Bacteria 4919
71 Ga0157372_10000060 3300013307 Bacteria 122372
72 Ga0157375_10000171 3300013308 Bacteria 61181
73 Ga0157375_10002318 3300013308 Bacteria 16436
74 Ga0157380_10000439 3300014326 Bacteria 25370
75 Ga0157380_10001547 3300014326 Bacteria 15125
76 Ga0157379_10032002 3300014968 Bacteria 4688
77 Ga0157376_10017167 3300014969 Bacteria 5513
78 Ga0163161_10000022 3300017792 Bacteria 207890
79 Ga0213874_10004520 3300021377 Bacteria 3185
80 Ga0213876_10007095 3300021384 Bacteria 6105
81 Ga0213876_10020088 3300021384 Bacteria 3529
82 Ga0213876_10030021 3300021384 Bacteria 2866
83 Ga0213876_10047700 3300021384 Bacteria 2264
84 Ga0213875_10003337 3300021388 Bacteria 9161
85 Ga0213875_10005185 3300021388 Bacteria 7048
86 Ga0207642_10000002 3300025899 Bacteria 658166
87 Ga0207710_10000631 3300025900 Bacteria 20232
88 Ga0207688_10010455 3300025901 Bacteria 5051
89 Ga0207685_10000031 3300025905 Bacteria 77451
90 Ga0207643_10011475 3300025908 Bacteria 4785
91 Ga0207663_10003958 3300025916 Bacteria 7329
92 Ga0207657_10006667 3300025919 Bacteria 11945
93 Ga0207657_10011239 3300025919 Bacteria 8897
94 Ga0207649_10000003 3300025920 Bacteria 388908
95 Ga0207694_10000056 3300025924 Bacteria 146908
96 Ga0207659_10000013 3300025926 Bacteria 172742
97 Ga0207659_10035949 3300025926 Bacteria 3428
98 Ga0207687_10000017 3300025927 Bacteria 237310
99 Ga0207687_10028367 3300025927 Bacteria 3761
100 Ga0207700_10000033 3300025928 Bacteria 123113
101 Ga0207706_10000001 3300025933 Bacteria 423014
102 Ga0207686_10000888 3300025934 Bacteria 18054
103 Ga0207709_10005406 3300025935 Bacteria 7264
104 Ga0207669_10000001 3300025937 Bacteria 377747
105 Ga0207669_10053645 3300025937 Bacteria 2430
106 Ga0207704_10000088 3300025938 Bacteria 53926
107 Ga0207704_10009618 3300025938 Bacteria 4673
108 Ga0207691_10000017 3300025940 Bacteria 134441
109 Ga0207711_10000006 3300025941 Bacteria 792692
110 Ga0207661_10000220 3300025944 Bacteria 37288
111 Ga0207661_10015873 3300025944 Bacteria 5548
112 Ga0207661_10067239 3300025944 Bacteria 2914
113 Ga0207712_10005524 3300025961 Bacteria 7975
114 Ga0207668_10010578 3300025972 Bacteria 5580
115 Ga0207668_10031550 3300025972 Bacteria 3491
116 Ga0207668_10071545 3300025972 Bacteria 2478
117 Ga0207640_10000401 3300025981 Bacteria 27504
118 Ga0207640_10027841 3300025981 Bacteria 3448
119 Ga0207658_10004106 3300025986 Bacteria 10155
120 Ga0207677_10000203 3300026023 Bacteria 47885
121 Ga0207677_10000379 3300026023 Bacteria 30693
122 Ga0207677_10084247 3300026023 Bacteria 2291
123 Ga0207703_10000018 3300026035 Bacteria 271377
124 Ga0207639_10102261 3300026041 Bacteria 2319
125 Ga0207678_10048458 3300026067 Bacteria 3673
126 Ga0207702_10000076 3300026078 Bacteria 112300
127 Ga0207702_10069275 3300026078 Bacteria 3033
128 Ga0207648_10001987 3300026089 Bacteria 22343
129 Ga0207683_10058973 3300026121 Bacteria 3371
130 Ga0207698_10000004 3300026142 Bacteria 313614
131 Ga0268266_10000376 3300028379 Bacteria 68245
132 Ga0268266_10032580 3300028379 Bacteria 4428
133 Ga0268266_10104120 3300028379 Bacteria 2505
134 Ga0268265_10000985 3300028380 Bacteria 25857
135 Ga0268264_10001600 3300028381 Bacteria 20943
136 Ga0268264_10059909 3300028381 Bacteria 3190
137 Ga0265319_1000014 3300028563 Bacteria 177623
138 Ga0265338_10000185 3300028800 Bacteria 116333
139 Ga0265325_10014095 3300031241 Bacteria 4528
140 Ga0307415_100000776 3300032126 Bacteria 14456
141 Ga0436364_1060681 3300037853 Bacteria 10442
142 Ga0436364_1135545 3300037853 Bacteria 45062
143 Ga0436364_1272494 3300037853 Bacteria 6765
144 Ga0400485_02102 3300038735 Bacteria 7467
145 Ga0436365_0050161 3300039437 Bacteria 5216
146 Ga0436365_0330393 3300039437 Bacteria 4614
147 Ga0436365_0337423 3300039437 Bacteria 38026
148 Ga0436365_0410951 3300039437 Bacteria 5095
149 Ga0436365_1193523 3300039437 Bacteria 8327
150 Ga0436365_1301997 3300039437 Bacteria 12608
151 Ga0436365_1569230 3300039437 Bacteria 4819
152 Ga0436363_1162705 3300039450 Bacteria 8347
153 Ga0436363_1370309 3300039450 Bacteria 5506
154 Ga0436363_1603373 3300039450 Bacteria 5457
155 Ga0466963_0018867 3300044694 Bacteria 4320
156 Ga0466971_0009797 3300044719 Bacteria 4183
157 Ga0466957_0001578 3300044842 Bacteria 11997
158 Ga0466960_0031988 3300044901 Bacteria 2431
159 Ga0466959_0054501 3300045049 Bacteria 2921
160 Ga0466967_0000001 3300045976 Bacteria 229823
161 Ga0466967_0142180 3300045976 Bacteria 2236
162 Ga0495592_0000078 3300046454 Bacteria 85591
163 Ga0495629_0000106 3300046459 Bacteria 74178
164 Ga0495638_0046513 3300046460 Bacteria 2726
165 Ga0495653_0017050 3300046463 Bacteria 5909
166 Ga0495662_0000001 3300046476 Bacteria 179185
167 Ga0495594_0000045 3300046499 Bacteria 54326
168 Ga0495606_0000040 3300046507 Bacteria 223500
169 Ga0495608_0000007 3300046511 Bacteria 313495
170 Ga0495608_0000240 3300046511 Bacteria 39700
171 Ga0495618_0000014 3300046514 Bacteria 163136
172 Ga0495628_0000808 3300046516 Bacteria 28939
173 Ga0495628_0002953 3300046516 Bacteria 15246
174 Ga0495628_0025385 3300046516 Bacteria 4841
175 Ga0495630_0000014 3300046517 Bacteria 217229
176 Ga0495652_0000010 3300046529 Bacteria 261584
177 Ga0495587_0002896 3300046536 Bacteria 11489
178 Ga0495598_0000644 3300046537 Bacteria 6562
179 Ga0495622_0000201 3300046557 Bacteria 47462
180 Ga0495633_0012646 3300046558 Bacteria 4480
181 Ga0495634_0000045 3300046642 Bacteria 99087
182 Ga0495635_0000031 3300046663 Bacteria 110244
183 Ga0495588_0000203 3300046674 Bacteria 59454
184 Ga0495657_0000001 3300046675 Bacteria 445641
185 Ga0495647_0001309 3300046681 Bacteria 7654
186 Ga0495647_0006939 3300046681 Bacteria 3772
187 Ga0495613_0000005 3300046689 Bacteria 222558
188 Ga0495613_0000032 3300046689 Bacteria 139806
189 Ga0495624_0016933 3300046690 Bacteria 4902
190 Ga0495600_0017375 3300046809 Bacteria 4576
191 Ga0495604_0000067 3300047317 Bacteria 90345
192 Ga0495604_0000577 3300047317 Bacteria 32087
193 Ga0495604_0005265 3300047317 Bacteria 10255
194 Ga0495674_0000010 3300047319 Bacteria 285794
195 Ga0495676_0000186 3300047321 Bacteria 49054
196 Ga0495676_0011737 3300047321 Bacteria 7902
197 Ga0495680_0000114 3300047322 Bacteria 76486
198 Ga0495680_0017955 3300047322 Bacteria 6017
199 Ga0495675_0000017 3300047444 Bacteria 123394
200 Ga0495602_0000007 3300048088 Bacteria 273212
201 Ga0495602_0000775 3300048088 Bacteria 30490
202 Ga0496100_0000001 3300048903 Bacteria 530179
203 Ga0496100_0057219 3300048903 Bacteria 2553
204 Ga0496101_0000004 3300048904 Bacteria 331599
205 Ga0496101_0017243 3300048904 Bacteria 4895
206 Ga0496102_0033579 3300048905 Bacteria 4611
207 Ga0496102_0095960 3300048905 Bacteria 2749
208 Ga0496104_0000015 3300048907 Bacteria 374530
209 Ga0496105_0000004 3300048908 Bacteria 475798
210 Ga0496106_0000056 3300048909 Bacteria 90682
211 Ga0496107_0000005 3300048910 Bacteria 281747
212 Ga0496107_0027516 3300048910 Bacteria 4037
213 Ga0496108_0000288 3300048911 Bacteria 43361
214 Ga0496108_0000295 3300048911 Bacteria 42820
215 Ga0496108_0014098 3300048911 Bacteria 6520
216 Ga0496108_0020734 3300048911 Bacteria 5403
217 Ga0496109_0000012 3300048912 Bacteria 229699
218 Ga0496109_0000056 3300048912 Bacteria 120835
219 Ga0496109_0000371 3300048912 Bacteria 41026
220 Ga0496110_0000114 3300048913 Bacteria 44437
221 Ga0496111_0000008 3300048914 Bacteria 96148
222 Ga0496111_0026153 3300048914 Bacteria 4120
223 Ga0496112_0000006 3300048915 Bacteria 365227
224 Ga0496112_0001447 3300048915 Bacteria 18224
225 Ga0496113_0000099 3300048916 Bacteria 36270
226 Ga0496113_0043902 3300048916 Bacteria 3310
227 Ga0496114_0000171 3300048917 Bacteria 46036
228 Ga0496114_0023959 3300048917 Bacteria 4980
229 Ga0496115_0000011 3300048918 Bacteria 222529
230 Ga0496115_0002021 3300048918 Bacteria 14499
231 Ga0496115_0017768 3300048918 Bacteria 5445
232 Ga0496116_0000367 3300048919 Bacteria 69349
233 Ga0496118_0000790 3300048921 Bacteria 50676
234 Ga0496119_0003161 3300048922 Bacteria 17290
235 Ga0496119_0009992 3300048922 Bacteria 8037
236 Ga0496120_0002463 3300048923 Bacteria 18648
237 Ga0496121_0058451 3300048924 Bacteria 3188
238 Ga0501070_0024224 3300049586 Bacteria 5090
239 Ga0501075_0001056 3300049591 Bacteria 17694
240 Ga0501076_0027300 3300049592 Bacteria 4427
241 Ga0501076_0096917 3300049592 Bacteria 2376
242 Ga0501076_0117963 3300049592 Bacteria 2148
243 nmdc:mga0qj67_2962_c1 3300050509 Bacteria 12177
244 nmdc:mga0a205_5033_c1 3300050515 Bacteria 11906
245 Ga0495601_0000038 3300053077 Bacteria 81122
246 Ga0495612_0000110 3300053078 Bacteria 34644
247 Ga0495612_0001018 3300053078 Bacteria 11500
248 Ga0495655_0000543 3300053083 Bacteria 6195
249 Ga0495595_0000002 3300053084 Bacteria 445641
250 Ga0495595_0000157 3300053084 Bacteria 26977
251 Ga0495595_0001559 3300053084 Bacteria 8940
252 Ga0495619_0000053 3300053085 Bacteria 98761
253 Ga0495619_0000081 3300053085 Bacteria 72034
254 Ga0495619_0002559 3300053085 Bacteria 11897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1301997 Ga0436365_1301997_475_2139 536
2 3300039437 Ga0436365_1193523 Ga0436365_1193523_5319_7031 553
3 3300049592 Ga0501076_0117963 Ga0501076_0117963_441_2105 554
4 3300005339 Ga0070660_100013872 Ga0070660_1000138724 564
5 3300039450 Ga0436363_1162705 Ga0436363_1162705_1038_2798 564
6 3300046537 Ga0495598_0000644 Ga0495598_0000644_3186_4982 564
7 3300045049 Ga0466959_0054501 Ga0466959_0054501_1081_2841 565
8 3300046511 Ga0495608_0000007 Ga0495608_0000007_230006_231847 565
9 3300046675 Ga0495657_0000001 Ga0495657_0000001_362152_363993 565
10 3300047444 Ga0495675_0000017 Ga0495675_0000017_81655_83496 565
11 3300053084 Ga0495595_0000002 Ga0495595_0000002_81649_83490 565
12 3300053085 Ga0495619_0000053 Ga0495619_0000053_35307_37148 565
13 3300021384 Ga0213876_10007095 Ga0213876_100070952 567
14 3300021388 Ga0213875_10003337 Ga0213875_100033376 567
15 3300037853 Ga0436364_1135545 Ga0436364_1135545_39377_41137 567
16 3300039437 Ga0436365_0337423 Ga0436365_0337423_31403_33163 567
17 3300039450 Ga0436363_1370309 Ga0436363_1370309_2218_3978 567
18 3300005365 Ga0070688_100000169 Ga0070688_10000016925 568
19 3300005367 Ga0070667_100018885 Ga0070667_1000188855 568
20 3300005466 Ga0070685_10000019 Ga0070685_100000192 568
21 3300009553 Ga0105249_10008485 Ga0105249_100084853 568
22 3300014968 Ga0157379_10032002 Ga0157379_100320022 568
23 3300021384 Ga0213876_10030021 Ga0213876_100300212 568
24 3300025961 Ga0207712_10005524 Ga0207712_100055241 568
25 3300025972 Ga0207668_10031550 Ga0207668_100315503 568
26 3300025986 Ga0207658_10004106 Ga0207658_100041065 568
27 3300028380 Ga0268265_10000985 Ga0268265_1000098523 568
28 3300028381 Ga0268264_10059909 Ga0268264_100599092 568
29 3300037853 Ga0436364_1272494 Ga0436364_1272494_2848_4611 568
30 3300039450 Ga0436363_1603373 Ga0436363_1603373_2513_4273 568
31 3300005344 Ga0070661_100000145 Ga0070661_10000014519 570
32 3300025920 Ga0207649_10000003 Ga0207649_10000003382 570
33 3300006038 Ga0075365_10000891 Ga0075365_1000089111 571
34 3300028379 Ga0268266_10032580 Ga0268266_100325802 571
35 3300048911 Ga0496108_0000288 Ga0496108_0000288_3943_5742 571
36 3300048912 Ga0496109_0000012 Ga0496109_0000012_116562_118361 571
37 3300049591 Ga0501075_0001056 Ga0501075_0001056_354_2150 571
38 3300021384 Ga0213876_10020088 Ga0213876_100200882 572
39 3300039437 Ga0436365_0050161 Ga0436365_0050161_2063_3823 572
40 3300044719 Ga0466971_0009797 Ga0466971_0009797_714_2474 572
41 3300014326 Ga0157380_10000439 Ga0157380_1000043919 573
42 3300046454 Ga0495592_0000078 Ga0495592_0000078_52026_53822 573
43 3300046516 Ga0495628_0002953 Ga0495628_0002953_3153_4949 573
44 3300009101 Ga0105247_10000347 Ga0105247_1000034713 574
45 3300013297 Ga0157378_10013876 Ga0157378_100138765 574
46 3300013308 Ga0157375_10000171 Ga0157375_1000017147 574
47 3300017792 Ga0163161_10000022 Ga0163161_1000002284 574
48 3300046536 Ga0495587_0002896 Ga0495587_0002896_5791_7515 574
49 3300053083 Ga0495655_0000543 Ga0495655_0000543_3757_5670 574
50 3300046476 Ga0495662_0000001 Ga0495662_0000001_95514_97310 575
51 3300046511 Ga0495608_0000240 Ga0495608_0000240_14326_16122 575
52 3300053084 Ga0495595_0000157 Ga0495595_0000157_8627_10423 575
53 3300053084 Ga0495595_0001559 Ga0495595_0001559_37_1827 575
54 3300005338 Ga0068868_100004287 Ga0068868_1000042876 576
55 3300005354 Ga0070675_100000776 Ga0070675_10000077612 576
56 3300014969 Ga0157376_10017167 Ga0157376_100171674 576
57 3300025926 Ga0207659_10000013 Ga0207659_10000013170 576
58 3300026023 Ga0207677_10000379 Ga0207677_100003795 576
59 3300028563 Ga0265319_1000014 Ga0265319_1000014120 576
60 3300028800 Ga0265338_10000185 Ga0265338_10000185118 576
61 3300031241 Ga0265325_10014095 Ga0265325_100140952 576
62 3300046514 Ga0495618_0000014 Ga0495618_0000014_22279_24075 576
63 3300046663 Ga0495635_0000031 Ga0495635_0000031_23522_25318 576
64 3300046681 Ga0495647_0001309 Ga0495647_0001309_2769_4565 576
65 3300046689 Ga0495613_0000005 Ga0495613_0000005_189396_191192 576
66 3300046689 Ga0495613_0000032 Ga0495613_0000032_45074_46948 576
67 3300046809 Ga0495600_0017375 Ga0495600_0017375_585_2420 576
68 3300053077 Ga0495601_0000038 Ga0495601_0000038_72499_74373 576
69 3300005436 Ga0070713_100001073 Ga0070713_10000107314 577
70 3300009098 Ga0105245_10000026 Ga0105245_1000002699 577
71 3300025927 Ga0207687_10000017 Ga0207687_1000001783 577
72 3300025928 Ga0207700_10000033 Ga0207700_10000033120 577
73 3300032126 Ga0307415_100000776 Ga0307415_1000007764 577
74 3300046690 Ga0495624_0016933 Ga0495624_0016933_2352_4148 577
75 3300047322 Ga0495680_0000114 Ga0495680_0000114_23355_25151 577
76 3300001979 JGI24740J21852_10005534 JGI24740J21852_100055345 578
77 3300009177 Ga0105248_10000020 Ga0105248_10000020233 578
78 3300009551 Ga0105238_10000048 Ga0105238_1000004833 578
79 3300025924 Ga0207694_10000056 Ga0207694_1000005633 578
80 3300025941 Ga0207711_10000006 Ga0207711_10000006145 578
81 3300046463 Ga0495653_0017050 Ga0495653_0017050_924_2720 578
82 3300047317 Ga0495604_0000577 Ga0495604_0000577_22659_24533 578
83 3300047317 Ga0495604_0005265 Ga0495604_0005265_6840_8714 578
84 3300048088 Ga0495602_0000007 Ga0495602_0000007_51620_53494 578
85 3300005329 Ga0070683_100001171 Ga0070683_10000117121 579
86 3300005339 Ga0070660_100024067 Ga0070660_1000240672 579
87 3300005365 Ga0070688_100002791 Ga0070688_1000027917 579
88 3300005466 Ga0070685_10000013 Ga0070685_100000135 579
89 3300013105 Ga0157369_10000014 Ga0157369_1000001430 579
90 3300013297 Ga0157378_10028598 Ga0157378_100285983 579
91 3300025919 Ga0207657_10011239 Ga0207657_100112394 579
92 3300025944 Ga0207661_10000220 Ga0207661_1000022018 579
93 3300044842 Ga0466957_0001578 Ga0466957_0001578_7817_9619 579
94 3300046674 Ga0495588_0000203 Ga0495588_0000203_54706_56505 579
95 3300048922 Ga0496119_0009992 Ga0496119_0009992_1794_3533 579
96 3300005543 Ga0070672_100000001 Ga0070672_100000001203 581
97 3300013102 Ga0157371_10040163 Ga0157371_100401632 581
98 3300025940 Ga0207691_10000017 Ga0207691_10000017128 581
99 3300005548 Ga0070665_100008785 Ga0070665_1000087854 582
100 3300028379 Ga0268266_10104120 Ga0268266_101041201 582
101 3300038735 Ga0400485_02102 Ga0400485_02102_1447_3222 582
102 3300009147 Ga0114129_10115786 Ga0114129_101157863 583
103 3300005539 Ga0068853_100077446 Ga0068853_1000774462 584
104 3300014326 Ga0157380_10001547 Ga0157380_100015478 584
105 3300026041 Ga0207639_10102261 Ga0207639_101022612 584
106 3300005616 Ga0068852_100000002 Ga0068852_100000002118 585
107 3300021377 Ga0213874_10004520 Ga0213874_100045202 585
108 3300021384 Ga0213876_10047700 Ga0213876_100477002 585
109 3300021388 Ga0213875_10005185 Ga0213875_100051852 585
110 3300026142 Ga0207698_10000004 Ga0207698_10000004167 585
111 3300037853 Ga0436364_1060681 Ga0436364_1060681_3533_5293 585
112 3300039437 Ga0436365_0330393 Ga0436365_0330393_2158_3918 585
113 3300039437 Ga0436365_0410951 Ga0436365_0410951_11_1771 585
114 3300039437 Ga0436365_1569230 Ga0436365_1569230_114_1874 585
115 3300046558 Ga0495633_0012646 Ga0495633_0012646_117_1913 585
116 3300050509 nmdc:mga0qj67_2962_c1 nmdc:mga0qj67_2962_c1_1819_3576 585
117 3300005981 Ga0081538_10008449 Ga0081538_100084492 586
118 3300003373 JGI25407J50210_10001130 JGI25407J50210_100011305 587
119 3300005842 Ga0068858_100000120 Ga0068858_1000001209 587
120 3300026035 Ga0207703_10000018 Ga0207703_10000018242 587
121 3300044694 Ga0466963_0018867 Ga0466963_0018867_1851_3617 587
122 3300045976 Ga0466967_0142180 Ga0466967_0142180_285_2057 588
123 3300005338 Ga0068868_100022420 Ga0068868_1000224202 589
124 3300053085 Ga0495619_0002559 Ga0495619_0002559_3015_4811 589
125 3300044901 Ga0466960_0031988 Ga0466960_0031988_335_2119 592
126 3300005843 Ga0068860_100002215 Ga0068860_10000221511 593
127 3300009148 Ga0105243_10023590 Ga0105243_100235902 593
128 3300025935 Ga0207709_10005406 Ga0207709_100054062 593
129 3300025944 Ga0207661_10015873 Ga0207661_100158733 593
130 3300025944 Ga0207661_10067239 Ga0207661_100672392 593
131 3300025972 Ga0207668_10010578 Ga0207668_100105785 593
132 3300028381 Ga0268264_10001600 Ga0268264_1000160011 593
133 3300049592 Ga0501076_0027300 Ga0501076_0027300_2395_4188 593
134 3300049592 Ga0501076_0096917 Ga0501076_0096917_502_2295 593
135 3300005327 Ga0070658_10014357 Ga0070658_100143576 594
136 3300005338 Ga0068868_100028183 Ga0068868_1000281835 594
137 3300005339 Ga0070660_100015463 Ga0070660_1000154634 594
138 3300005341 Ga0070691_10018823 Ga0070691_100188232 594
139 3300005354 Ga0070675_100031138 Ga0070675_1000311382 594
140 3300005366 Ga0070659_100007047 Ga0070659_1000070476 594
141 3300005456 Ga0070678_100094560 Ga0070678_1000945601 594
142 3300005615 Ga0070702_100003734 Ga0070702_1000037344 594
143 3300005616 Ga0068852_100024813 Ga0068852_1000248132 594
144 3300005834 Ga0068851_10007522 Ga0068851_100075222 594
145 3300006048 Ga0075363_100017854 Ga0075363_1000178545 594
146 3300006881 Ga0068865_100011062 Ga0068865_1000110622 594
147 3300009098 Ga0105245_10010880 Ga0105245_100108805 594
148 3300009148 Ga0105243_10008253 Ga0105243_100082534 594
149 3300009177 Ga0105248_10255686 Ga0105248_102556862 594
150 3300025901 Ga0207688_10010455 Ga0207688_100104554 594
151 3300025908 Ga0207643_10011475 Ga0207643_100114753 594
152 3300025919 Ga0207657_10006667 Ga0207657_100066675 594
153 3300025926 Ga0207659_10035949 Ga0207659_100359492 594
154 3300025937 Ga0207669_10053645 Ga0207669_100536451 594
155 3300025938 Ga0207704_10009618 Ga0207704_100096182 594
156 3300025972 Ga0207668_10071545 Ga0207668_100715452 594
157 3300025981 Ga0207640_10027841 Ga0207640_100278413 594
158 3300026023 Ga0207677_10084247 Ga0207677_100842472 594
159 3300026067 Ga0207678_10048458 Ga0207678_100484583 594
160 3300046642 Ga0495634_0000045 Ga0495634_0000045_70065_71861 594
161 3300047322 Ga0495680_0017955 Ga0495680_0017955_433_2220 594
162 3300048911 Ga0496108_0020734 Ga0496108_0020734_1913_3721 594
163 3300048916 Ga0496113_0043902 Ga0496113_0043902_984_2792 594
164 3300048915 Ga0496112_0001447 Ga0496112_0001447_5022_6839 595
165 3300048916 Ga0496113_0000099 Ga0496113_0000099_27623_29440 595
166 3300005549 Ga0070704_100074352 Ga0070704_1000743522 597
167 3300025927 Ga0207687_10028367 Ga0207687_100283672 597
168 3300047321 Ga0495676_0011737 Ga0495676_0011737_2052_3860 597
169 3300048903 Ga0496100_0057219 Ga0496100_0057219_86_1894 597
170 3300048904 Ga0496101_0017243 Ga0496101_0017243_708_2516 597
171 3300048910 Ga0496107_0027516 Ga0496107_0027516_85_1893 597
172 3300048915 Ga0496112_0000006 Ga0496112_0000006_55662_57455 597
173 3300048917 Ga0496114_0023959 Ga0496114_0023959_105_1913 597
174 3300048918 Ga0496115_0017768 Ga0496115_0017768_851_2659 597
175 3300048921 Ga0496118_0000790 Ga0496118_0000790_28356_30158 597
176 3300048923 Ga0496120_0002463 Ga0496120_0002463_10086_11888 597
177 3300048924 Ga0496121_0058451 Ga0496121_0058451_970_2772 597
178 3300005327 Ga0070658_10135481 Ga0070658_101354811 598
179 3300005356 Ga0070674_100000007 Ga0070674_10000000766 598
180 3300005439 Ga0070711_100001686 Ga0070711_1000016862 598
181 3300005459 Ga0068867_100000750 Ga0068867_10000075010 598
182 3300005548 Ga0070665_100074806 Ga0070665_1000748062 598
183 3300005718 Ga0068866_10000003 Ga0068866_10000003207 598
184 3300006163 Ga0070715_10000029 Ga0070715_1000002984 598
185 3300013308 Ga0157375_10002318 Ga0157375_100023183 598
186 3300025899 Ga0207642_10000002 Ga0207642_10000002458 598
187 3300025900 Ga0207710_10000631 Ga0207710_100006316 598
188 3300025905 Ga0207685_10000031 Ga0207685_100000316 598
189 3300025916 Ga0207663_10003958 Ga0207663_100039583 598
190 3300025937 Ga0207669_10000001 Ga0207669_1000000184 598
191 3300026089 Ga0207648_10001987 Ga0207648_1000198711 598
192 3300026121 Ga0207683_10058973 Ga0207683_100589732 598
193 3300028379 Ga0268266_10000376 Ga0268266_1000037646 598
194 3300046459 Ga0495629_0000106 Ga0495629_0000106_4390_6189 598
195 3300046507 Ga0495606_0000040 Ga0495606_0000040_187441_189240 598
196 3300046516 Ga0495628_0025385 Ga0495628_0025385_1867_3666 598
197 3300046517 Ga0495630_0000014 Ga0495630_0000014_26685_28484 598
198 3300046529 Ga0495652_0000010 Ga0495652_0000010_142862_144661 598
199 3300046681 Ga0495647_0006939 Ga0495647_0006939_1410_3209 598
200 3300047319 Ga0495674_0000010 Ga0495674_0000010_60517_62316 598
201 3300047321 Ga0495676_0000186 Ga0495676_0000186_16675_18471 598
202 3300048905 Ga0496102_0095960 Ga0496102_0095960_260_2056 598
203 3300048911 Ga0496108_0000295 Ga0496108_0000295_38706_40502 598
204 3300048911 Ga0496108_0014098 Ga0496108_0014098_3917_5716 598
205 3300048912 Ga0496109_0000056 Ga0496109_0000056_97621_99420 598
206 3300048912 Ga0496109_0000371 Ga0496109_0000371_37586_39382 598
207 3300048914 Ga0496111_0026153 Ga0496111_0026153_1532_3331 598
208 3300048917 Ga0496114_0000171 Ga0496114_0000171_12056_13852 598
209 3300048918 Ga0496115_0000011 Ga0496115_0000011_187704_189500 598
210 3300048918 Ga0496115_0002021 Ga0496115_0002021_648_2444 598
211 3300048919 Ga0496116_0000367 Ga0496116_0000367_33273_35108 598
212 3300048922 Ga0496119_0003161 Ga0496119_0003161_8952_10787 598
213 3300050515 nmdc:mga0a205_5033_c1 nmdc:mga0a205_5033_c1_7502_9298 598
214 3300053078 Ga0495612_0000110 Ga0495612_0000110_10231_12030 598
215 3300053078 Ga0495612_0001018 Ga0495612_0001018_2444_4243 598
216 3300001977 JGI24746J21847_1000436 JGI24746J21847_10004365 599
217 3300005337 Ga0070682_100000011 Ga0070682_100000011103 599
218 3300005338 Ga0068868_100000453 Ga0068868_10000045316 599
219 3300005341 Ga0070691_10000002 Ga0070691_1000000222 599
220 3300005435 Ga0070714_100042700 Ga0070714_1000427003 599
221 3300005457 Ga0070662_100000002 Ga0070662_100000002145 599
222 3300005547 Ga0070693_100000215 Ga0070693_10000021527 599
223 3300005578 Ga0068854_100000113 Ga0068854_10000011332 599
224 3300005614 Ga0068856_100001668 Ga0068856_10000166820 599
225 3300005834 Ga0068851_10004719 Ga0068851_100047195 599
226 3300006881 Ga0068865_100000094 Ga0068865_10000009433 599
227 3300009098 Ga0105245_10002028 Ga0105245_100020289 599
228 3300009176 Ga0105242_10001472 Ga0105242_1000147212 599
229 3300013307 Ga0157372_10000060 Ga0157372_1000006066 599
230 3300025933 Ga0207706_10000001 Ga0207706_10000001327 599
231 3300025934 Ga0207686_10000888 Ga0207686_100008889 599
232 3300025938 Ga0207704_10000088 Ga0207704_1000008818 599
233 3300025981 Ga0207640_10000401 Ga0207640_100004012 599
234 3300026023 Ga0207677_10000203 Ga0207677_1000020326 599
235 3300026078 Ga0207702_10000076 Ga0207702_1000007665 599
236 3300026078 Ga0207702_10069275 Ga0207702_100692752 599
237 3300045976 Ga0466967_0000001 Ga0466967_0000001_212063_213904 599
238 3300046460 Ga0495638_0046513 Ga0495638_0046513_161_1960 599
239 3300046499 Ga0495594_0000045 Ga0495594_0000045_45588_47438 599
240 3300046516 Ga0495628_0000808 Ga0495628_0000808_4151_5965 599
241 3300046557 Ga0495622_0000201 Ga0495622_0000201_43981_45810 599
242 3300047317 Ga0495604_0000067 Ga0495604_0000067_25066_26940 599
243 3300048088 Ga0495602_0000775 Ga0495602_0000775_541_2355 599
244 3300048903 Ga0496100_0000001 Ga0496100_0000001_295453_297303 599
245 3300048904 Ga0496101_0000004 Ga0496101_0000004_96805_98655 599
246 3300048905 Ga0496102_0033579 Ga0496102_0033579_2383_4221 599
247 3300048907 Ga0496104_0000015 Ga0496104_0000015_118189_120018 599
248 3300048908 Ga0496105_0000004 Ga0496105_0000004_355781_357610 599
249 3300048909 Ga0496106_0000056 Ga0496106_0000056_17778_19628 599
250 3300048910 Ga0496107_0000005 Ga0496107_0000005_232945_234795 599
251 3300048913 Ga0496110_0000114 Ga0496110_0000114_40515_42356 599
252 3300048914 Ga0496111_0000008 Ga0496111_0000008_38664_40505 599
253 3300049586 Ga0501070_0024224 Ga0501070_0024224_1619_3442 599
254 3300053085 Ga0495619_0000081 Ga0495619_0000081_13893_15692 599

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00152

tRNA-synt_2

tRNA synthetases class II (D, K and N)

157

590

0.99

PF02938

GAD

GAD domain

348

440

0.96

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

54

135

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9587 16 118
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9318 16 118
4o2d-assembly1.cif.gz_A crystal structure of aspartyl-trna synthetase from mycobacterium smegmatis with bound aspartic acid 0.8792 13 590
6wom-assembly2.cif.gz_C-2 crystal structure of aspartyl-trna ligase from elizabethkingia sp. 0.8777 12 589
6wom-assembly2.cif.gz_C-2 crystal structure of aspartyl-trna ligase from elizabethkingia sp. 0.8762 12 589
ID Description Score Start End Superfamily
4o2dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9755 13 118 2.40.50.140
1l0wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9675 14 121 2.40.50.140
1c0aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.967 14 119 2.40.50.140
5groB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9587 16 118 2.40.50.140
1c0aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9493 14 119 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V7VKA8-F1-model_v4 Aspartate--tRNA ligase 0.9793 14 116 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A2M8AHC2-F1-model_v4 Aspartate--tRNA ligase 0.9736 252 540 GO:0004815
GO:0005524
GO:0005737
GO:0006422
AF-A0A536LPS0-F1-model_v4 Aspartate--tRNA ligase 0.9736 16 111 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A6A8LTC8-F1-model_v4 Aspartate--tRNA ligase (EC 6.1.1.12) 0.9727 14 114 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A7V2TNW9-F1-model_v4 Aspartate--tRNA ligase 0.9719 10 114 GO:0003676
GO:0004815
GO:0005524
GO:0006422

Feature Viewer

pLDDT pTM Quality
83.34 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map