F364666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 254 | 169 | 254 | 591 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100042700|Ga0070714_1000427003 |
| Length | 623 |
| Sequence | VSEPVKAEDVSAASVKAGAGLGKRLRPDAPPLRGNTYRDAWCGQVLADRVDSEVRVAGWVHRRRDHGGLIFIDLRDRTGIVQLVFNPDRSGASFELAHQLRAEDVLSASGTVVRRSAETVNPELATGEVELLVSAAGRLADAETPPFQIEGFSGEVGEDTRLRYRYLDLRREQMQQALALRHRVVAAMREFLGAEGFLDVETPVLTRSTPEGARDFLVPSRQQQGSFYALPQSPQLFKQLLMISGLERYFQIARCFRDEATRADRQAEFTQLDVEMSFVNGEDVIEVNERLLAHVFAQVGGPQVEVPMQRMCYDEAMGRFGTDRPDLRFGLELVDLSDALRETEFKVFRSVLEGGGAIRGLNAGRRELPRSELDGLISRAQDLGAKGLVWAFREGDGWRSPTAKFLSAEELADLNGRLGAEEGDLLLLVADKRPVTDAVLGQLRLDLGEKFGLIDENEHRLVWIVDWPLLDWNEDEQRWDAMHHPFTAPAGEFDPDNPGAARAQAYDVVWNGQELGGGSIRIHDAGTQEQVFAALGIDRETAEARFGFLLEALRYGAPPHGGIAYGVDRIVQRLSGAETIRDVIAFPKTASGFDLLTGAPAPVDQIQLRELGVAVHKPELPGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 61 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 99 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 100 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 101 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 104 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 105 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 106 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 107 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 159 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 160 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 11.81 |
| Rhizosphere | 76.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000436 | 3300001977 | Bacteria | 6227 |
| 2 | JGI24740J21852_10005534 | 3300001979 | Bacteria | 5324 |
| 3 | JGI25407J50210_10001130 | 3300003373 | Bacteria | 5879 |
| 4 | Ga0070658_10014357 | 3300005327 | Bacteria | 6354 |
| 5 | Ga0070658_10135481 | 3300005327 | Bacteria | 2054 |
| 6 | Ga0070683_100001171 | 3300005329 | Bacteria | 19865 |
| 7 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 8 | Ga0068868_100000453 | 3300005338 | Bacteria | 27329 |
| 9 | Ga0068868_100004287 | 3300005338 | Bacteria | 9988 |
| 10 | Ga0068868_100022420 | 3300005338 | Bacteria | 4765 |
| 11 | Ga0068868_100028183 | 3300005338 | Bacteria | 4292 |
| 12 | Ga0070660_100013872 | 3300005339 | Bacteria | 5797 |
| 13 | Ga0070660_100015463 | 3300005339 | Bacteria | 5512 |
| 14 | Ga0070660_100024067 | 3300005339 | Bacteria | 4518 |
| 15 | Ga0070691_10000002 | 3300005341 | Bacteria | 90686 |
| 16 | Ga0070691_10018823 | 3300005341 | Bacteria | 3184 |
| 17 | Ga0070661_100000145 | 3300005344 | Bacteria | 58346 |
| 18 | Ga0070675_100000776 | 3300005354 | Bacteria | 22323 |
| 19 | Ga0070675_100031138 | 3300005354 | Bacteria | 4311 |
| 20 | Ga0070674_100000007 | 3300005356 | Bacteria | 145531 |
| 21 | Ga0070688_100000169 | 3300005365 | Bacteria | 35241 |
| 22 | Ga0070688_100002791 | 3300005365 | Bacteria | 8876 |
| 23 | Ga0070659_100007047 | 3300005366 | Bacteria | 8142 |
| 24 | Ga0070667_100018885 | 3300005367 | Bacteria | 5715 |
| 25 | Ga0070714_100042700 | 3300005435 | Bacteria | 3832 |
| 26 | Ga0070713_100001073 | 3300005436 | Bacteria | 17481 |
| 27 | Ga0070711_100001686 | 3300005439 | Bacteria | 12237 |
| 28 | Ga0070678_100094560 | 3300005456 | Bacteria | 2301 |
| 29 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 30 | Ga0068867_100000750 | 3300005459 | Bacteria | 21786 |
| 31 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 32 | Ga0070685_10000019 | 3300005466 | Bacteria | 105881 |
| 33 | Ga0068853_100077446 | 3300005539 | Bacteria | 2905 |
| 34 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 35 | Ga0070693_100000215 | 3300005547 | Bacteria | 26935 |
| 36 | Ga0070665_100008785 | 3300005548 | Bacteria | 10223 |
| 37 | Ga0070665_100074806 | 3300005548 | Bacteria | 3393 |
| 38 | Ga0070704_100074352 | 3300005549 | Bacteria | 2478 |
| 39 | Ga0068854_100000113 | 3300005578 | Bacteria | 55436 |
| 40 | Ga0068856_100001668 | 3300005614 | Bacteria | 23239 |
| 41 | Ga0070702_100003734 | 3300005615 | Bacteria | 6866 |
| 42 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 43 | Ga0068852_100024813 | 3300005616 | Bacteria | 4850 |
| 44 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 45 | Ga0068851_10004719 | 3300005834 | Bacteria | 6167 |
| 46 | Ga0068851_10007522 | 3300005834 | Bacteria | 5006 |
| 47 | Ga0068858_100000120 | 3300005842 | Bacteria | 81766 |
| 48 | Ga0068860_100002215 | 3300005843 | Bacteria | 20454 |
| 49 | Ga0081538_10008449 | 3300005981 | Bacteria | 8735 |
| 50 | Ga0075365_10000891 | 3300006038 | Bacteria | 12493 |
| 51 | Ga0075363_100017854 | 3300006048 | Bacteria | 3526 |
| 52 | Ga0070715_10000029 | 3300006163 | Bacteria | 88994 |
| 53 | Ga0068865_100000094 | 3300006881 | Bacteria | 46651 |
| 54 | Ga0068865_100011062 | 3300006881 | Bacteria | 5635 |
| 55 | Ga0105245_10000026 | 3300009098 | Bacteria | 163660 |
| 56 | Ga0105245_10002028 | 3300009098 | Bacteria | 18364 |
| 57 | Ga0105245_10010880 | 3300009098 | Bacteria | 7913 |
| 58 | Ga0105247_10000347 | 3300009101 | Bacteria | 40377 |
| 59 | Ga0114129_10115786 | 3300009147 | Bacteria | 3694 |
| 60 | Ga0105243_10008253 | 3300009148 | Bacteria | 8000 |
| 61 | Ga0105243_10023590 | 3300009148 | Bacteria | 4688 |
| 62 | Ga0105242_10001472 | 3300009176 | Bacteria | 18524 |
| 63 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 64 | Ga0105248_10255686 | 3300009177 | Bacteria | 1972 |
| 65 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 66 | Ga0105249_10008485 | 3300009553 | Bacteria | 8954 |
| 67 | Ga0157371_10040163 | 3300013102 | Bacteria | 3344 |
| 68 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 69 | Ga0157378_10013876 | 3300013297 | Bacteria | 7047 |
| 70 | Ga0157378_10028598 | 3300013297 | Bacteria | 4919 |
| 71 | Ga0157372_10000060 | 3300013307 | Bacteria | 122372 |
| 72 | Ga0157375_10000171 | 3300013308 | Bacteria | 61181 |
| 73 | Ga0157375_10002318 | 3300013308 | Bacteria | 16436 |
| 74 | Ga0157380_10000439 | 3300014326 | Bacteria | 25370 |
| 75 | Ga0157380_10001547 | 3300014326 | Bacteria | 15125 |
| 76 | Ga0157379_10032002 | 3300014968 | Bacteria | 4688 |
| 77 | Ga0157376_10017167 | 3300014969 | Bacteria | 5513 |
| 78 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 79 | Ga0213874_10004520 | 3300021377 | Bacteria | 3185 |
| 80 | Ga0213876_10007095 | 3300021384 | Bacteria | 6105 |
| 81 | Ga0213876_10020088 | 3300021384 | Bacteria | 3529 |
| 82 | Ga0213876_10030021 | 3300021384 | Bacteria | 2866 |
| 83 | Ga0213876_10047700 | 3300021384 | Bacteria | 2264 |
| 84 | Ga0213875_10003337 | 3300021388 | Bacteria | 9161 |
| 85 | Ga0213875_10005185 | 3300021388 | Bacteria | 7048 |
| 86 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 87 | Ga0207710_10000631 | 3300025900 | Bacteria | 20232 |
| 88 | Ga0207688_10010455 | 3300025901 | Bacteria | 5051 |
| 89 | Ga0207685_10000031 | 3300025905 | Bacteria | 77451 |
| 90 | Ga0207643_10011475 | 3300025908 | Bacteria | 4785 |
| 91 | Ga0207663_10003958 | 3300025916 | Bacteria | 7329 |
| 92 | Ga0207657_10006667 | 3300025919 | Bacteria | 11945 |
| 93 | Ga0207657_10011239 | 3300025919 | Bacteria | 8897 |
| 94 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 95 | Ga0207694_10000056 | 3300025924 | Bacteria | 146908 |
| 96 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 97 | Ga0207659_10035949 | 3300025926 | Bacteria | 3428 |
| 98 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 99 | Ga0207687_10028367 | 3300025927 | Bacteria | 3761 |
| 100 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 101 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 102 | Ga0207686_10000888 | 3300025934 | Bacteria | 18054 |
| 103 | Ga0207709_10005406 | 3300025935 | Bacteria | 7264 |
| 104 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 105 | Ga0207669_10053645 | 3300025937 | Bacteria | 2430 |
| 106 | Ga0207704_10000088 | 3300025938 | Bacteria | 53926 |
| 107 | Ga0207704_10009618 | 3300025938 | Bacteria | 4673 |
| 108 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 109 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 110 | Ga0207661_10000220 | 3300025944 | Bacteria | 37288 |
| 111 | Ga0207661_10015873 | 3300025944 | Bacteria | 5548 |
| 112 | Ga0207661_10067239 | 3300025944 | Bacteria | 2914 |
| 113 | Ga0207712_10005524 | 3300025961 | Bacteria | 7975 |
| 114 | Ga0207668_10010578 | 3300025972 | Bacteria | 5580 |
| 115 | Ga0207668_10031550 | 3300025972 | Bacteria | 3491 |
| 116 | Ga0207668_10071545 | 3300025972 | Bacteria | 2478 |
| 117 | Ga0207640_10000401 | 3300025981 | Bacteria | 27504 |
| 118 | Ga0207640_10027841 | 3300025981 | Bacteria | 3448 |
| 119 | Ga0207658_10004106 | 3300025986 | Bacteria | 10155 |
| 120 | Ga0207677_10000203 | 3300026023 | Bacteria | 47885 |
| 121 | Ga0207677_10000379 | 3300026023 | Bacteria | 30693 |
| 122 | Ga0207677_10084247 | 3300026023 | Bacteria | 2291 |
| 123 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 124 | Ga0207639_10102261 | 3300026041 | Bacteria | 2319 |
| 125 | Ga0207678_10048458 | 3300026067 | Bacteria | 3673 |
| 126 | Ga0207702_10000076 | 3300026078 | Bacteria | 112300 |
| 127 | Ga0207702_10069275 | 3300026078 | Bacteria | 3033 |
| 128 | Ga0207648_10001987 | 3300026089 | Bacteria | 22343 |
| 129 | Ga0207683_10058973 | 3300026121 | Bacteria | 3371 |
| 130 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 131 | Ga0268266_10000376 | 3300028379 | Bacteria | 68245 |
| 132 | Ga0268266_10032580 | 3300028379 | Bacteria | 4428 |
| 133 | Ga0268266_10104120 | 3300028379 | Bacteria | 2505 |
| 134 | Ga0268265_10000985 | 3300028380 | Bacteria | 25857 |
| 135 | Ga0268264_10001600 | 3300028381 | Bacteria | 20943 |
| 136 | Ga0268264_10059909 | 3300028381 | Bacteria | 3190 |
| 137 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 138 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 139 | Ga0265325_10014095 | 3300031241 | Bacteria | 4528 |
| 140 | Ga0307415_100000776 | 3300032126 | Bacteria | 14456 |
| 141 | Ga0436364_1060681 | 3300037853 | Bacteria | 10442 |
| 142 | Ga0436364_1135545 | 3300037853 | Bacteria | 45062 |
| 143 | Ga0436364_1272494 | 3300037853 | Bacteria | 6765 |
| 144 | Ga0400485_02102 | 3300038735 | Bacteria | 7467 |
| 145 | Ga0436365_0050161 | 3300039437 | Bacteria | 5216 |
| 146 | Ga0436365_0330393 | 3300039437 | Bacteria | 4614 |
| 147 | Ga0436365_0337423 | 3300039437 | Bacteria | 38026 |
| 148 | Ga0436365_0410951 | 3300039437 | Bacteria | 5095 |
| 149 | Ga0436365_1193523 | 3300039437 | Bacteria | 8327 |
| 150 | Ga0436365_1301997 | 3300039437 | Bacteria | 12608 |
| 151 | Ga0436365_1569230 | 3300039437 | Bacteria | 4819 |
| 152 | Ga0436363_1162705 | 3300039450 | Bacteria | 8347 |
| 153 | Ga0436363_1370309 | 3300039450 | Bacteria | 5506 |
| 154 | Ga0436363_1603373 | 3300039450 | Bacteria | 5457 |
| 155 | Ga0466963_0018867 | 3300044694 | Bacteria | 4320 |
| 156 | Ga0466971_0009797 | 3300044719 | Bacteria | 4183 |
| 157 | Ga0466957_0001578 | 3300044842 | Bacteria | 11997 |
| 158 | Ga0466960_0031988 | 3300044901 | Bacteria | 2431 |
| 159 | Ga0466959_0054501 | 3300045049 | Bacteria | 2921 |
| 160 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 161 | Ga0466967_0142180 | 3300045976 | Bacteria | 2236 |
| 162 | Ga0495592_0000078 | 3300046454 | Bacteria | 85591 |
| 163 | Ga0495629_0000106 | 3300046459 | Bacteria | 74178 |
| 164 | Ga0495638_0046513 | 3300046460 | Bacteria | 2726 |
| 165 | Ga0495653_0017050 | 3300046463 | Bacteria | 5909 |
| 166 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 167 | Ga0495594_0000045 | 3300046499 | Bacteria | 54326 |
| 168 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 169 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 170 | Ga0495608_0000240 | 3300046511 | Bacteria | 39700 |
| 171 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 172 | Ga0495628_0000808 | 3300046516 | Bacteria | 28939 |
| 173 | Ga0495628_0002953 | 3300046516 | Bacteria | 15246 |
| 174 | Ga0495628_0025385 | 3300046516 | Bacteria | 4841 |
| 175 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 176 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 177 | Ga0495587_0002896 | 3300046536 | Bacteria | 11489 |
| 178 | Ga0495598_0000644 | 3300046537 | Bacteria | 6562 |
| 179 | Ga0495622_0000201 | 3300046557 | Bacteria | 47462 |
| 180 | Ga0495633_0012646 | 3300046558 | Bacteria | 4480 |
| 181 | Ga0495634_0000045 | 3300046642 | Bacteria | 99087 |
| 182 | Ga0495635_0000031 | 3300046663 | Bacteria | 110244 |
| 183 | Ga0495588_0000203 | 3300046674 | Bacteria | 59454 |
| 184 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 185 | Ga0495647_0001309 | 3300046681 | Bacteria | 7654 |
| 186 | Ga0495647_0006939 | 3300046681 | Bacteria | 3772 |
| 187 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 188 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 189 | Ga0495624_0016933 | 3300046690 | Bacteria | 4902 |
| 190 | Ga0495600_0017375 | 3300046809 | Bacteria | 4576 |
| 191 | Ga0495604_0000067 | 3300047317 | Bacteria | 90345 |
| 192 | Ga0495604_0000577 | 3300047317 | Bacteria | 32087 |
| 193 | Ga0495604_0005265 | 3300047317 | Bacteria | 10255 |
| 194 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 195 | Ga0495676_0000186 | 3300047321 | Bacteria | 49054 |
| 196 | Ga0495676_0011737 | 3300047321 | Bacteria | 7902 |
| 197 | Ga0495680_0000114 | 3300047322 | Bacteria | 76486 |
| 198 | Ga0495680_0017955 | 3300047322 | Bacteria | 6017 |
| 199 | Ga0495675_0000017 | 3300047444 | Bacteria | 123394 |
| 200 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 201 | Ga0495602_0000775 | 3300048088 | Bacteria | 30490 |
| 202 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 203 | Ga0496100_0057219 | 3300048903 | Bacteria | 2553 |
| 204 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 205 | Ga0496101_0017243 | 3300048904 | Bacteria | 4895 |
| 206 | Ga0496102_0033579 | 3300048905 | Bacteria | 4611 |
| 207 | Ga0496102_0095960 | 3300048905 | Bacteria | 2749 |
| 208 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 209 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 210 | Ga0496106_0000056 | 3300048909 | Bacteria | 90682 |
| 211 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 212 | Ga0496107_0027516 | 3300048910 | Bacteria | 4037 |
| 213 | Ga0496108_0000288 | 3300048911 | Bacteria | 43361 |
| 214 | Ga0496108_0000295 | 3300048911 | Bacteria | 42820 |
| 215 | Ga0496108_0014098 | 3300048911 | Bacteria | 6520 |
| 216 | Ga0496108_0020734 | 3300048911 | Bacteria | 5403 |
| 217 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 218 | Ga0496109_0000056 | 3300048912 | Bacteria | 120835 |
| 219 | Ga0496109_0000371 | 3300048912 | Bacteria | 41026 |
| 220 | Ga0496110_0000114 | 3300048913 | Bacteria | 44437 |
| 221 | Ga0496111_0000008 | 3300048914 | Bacteria | 96148 |
| 222 | Ga0496111_0026153 | 3300048914 | Bacteria | 4120 |
| 223 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 224 | Ga0496112_0001447 | 3300048915 | Bacteria | 18224 |
| 225 | Ga0496113_0000099 | 3300048916 | Bacteria | 36270 |
| 226 | Ga0496113_0043902 | 3300048916 | Bacteria | 3310 |
| 227 | Ga0496114_0000171 | 3300048917 | Bacteria | 46036 |
| 228 | Ga0496114_0023959 | 3300048917 | Bacteria | 4980 |
| 229 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 230 | Ga0496115_0002021 | 3300048918 | Bacteria | 14499 |
| 231 | Ga0496115_0017768 | 3300048918 | Bacteria | 5445 |
| 232 | Ga0496116_0000367 | 3300048919 | Bacteria | 69349 |
| 233 | Ga0496118_0000790 | 3300048921 | Bacteria | 50676 |
| 234 | Ga0496119_0003161 | 3300048922 | Bacteria | 17290 |
| 235 | Ga0496119_0009992 | 3300048922 | Bacteria | 8037 |
| 236 | Ga0496120_0002463 | 3300048923 | Bacteria | 18648 |
| 237 | Ga0496121_0058451 | 3300048924 | Bacteria | 3188 |
| 238 | Ga0501070_0024224 | 3300049586 | Bacteria | 5090 |
| 239 | Ga0501075_0001056 | 3300049591 | Bacteria | 17694 |
| 240 | Ga0501076_0027300 | 3300049592 | Bacteria | 4427 |
| 241 | Ga0501076_0096917 | 3300049592 | Bacteria | 2376 |
| 242 | Ga0501076_0117963 | 3300049592 | Bacteria | 2148 |
| 243 | nmdc:mga0qj67_2962_c1 | 3300050509 | Bacteria | 12177 |
| 244 | nmdc:mga0a205_5033_c1 | 3300050515 | Bacteria | 11906 |
| 245 | Ga0495601_0000038 | 3300053077 | Bacteria | 81122 |
| 246 | Ga0495612_0000110 | 3300053078 | Bacteria | 34644 |
| 247 | Ga0495612_0001018 | 3300053078 | Bacteria | 11500 |
| 248 | Ga0495655_0000543 | 3300053083 | Bacteria | 6195 |
| 249 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 250 | Ga0495595_0000157 | 3300053084 | Bacteria | 26977 |
| 251 | Ga0495595_0001559 | 3300053084 | Bacteria | 8940 |
| 252 | Ga0495619_0000053 | 3300053085 | Bacteria | 98761 |
| 253 | Ga0495619_0000081 | 3300053085 | Bacteria | 72034 |
| 254 | Ga0495619_0002559 | 3300053085 | Bacteria | 11897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1301997 | Ga0436365_1301997_475_2139 | 536 |
| 2 | 3300039437 | Ga0436365_1193523 | Ga0436365_1193523_5319_7031 | 553 |
| 3 | 3300049592 | Ga0501076_0117963 | Ga0501076_0117963_441_2105 | 554 |
| 4 | 3300005339 | Ga0070660_100013872 | Ga0070660_1000138724 | 564 |
| 5 | 3300039450 | Ga0436363_1162705 | Ga0436363_1162705_1038_2798 | 564 |
| 6 | 3300046537 | Ga0495598_0000644 | Ga0495598_0000644_3186_4982 | 564 |
| 7 | 3300045049 | Ga0466959_0054501 | Ga0466959_0054501_1081_2841 | 565 |
| 8 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_230006_231847 | 565 |
| 9 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_362152_363993 | 565 |
| 10 | 3300047444 | Ga0495675_0000017 | Ga0495675_0000017_81655_83496 | 565 |
| 11 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_81649_83490 | 565 |
| 12 | 3300053085 | Ga0495619_0000053 | Ga0495619_0000053_35307_37148 | 565 |
| 13 | 3300021384 | Ga0213876_10007095 | Ga0213876_100070952 | 567 |
| 14 | 3300021388 | Ga0213875_10003337 | Ga0213875_100033376 | 567 |
| 15 | 3300037853 | Ga0436364_1135545 | Ga0436364_1135545_39377_41137 | 567 |
| 16 | 3300039437 | Ga0436365_0337423 | Ga0436365_0337423_31403_33163 | 567 |
| 17 | 3300039450 | Ga0436363_1370309 | Ga0436363_1370309_2218_3978 | 567 |
| 18 | 3300005365 | Ga0070688_100000169 | Ga0070688_10000016925 | 568 |
| 19 | 3300005367 | Ga0070667_100018885 | Ga0070667_1000188855 | 568 |
| 20 | 3300005466 | Ga0070685_10000019 | Ga0070685_100000192 | 568 |
| 21 | 3300009553 | Ga0105249_10008485 | Ga0105249_100084853 | 568 |
| 22 | 3300014968 | Ga0157379_10032002 | Ga0157379_100320022 | 568 |
| 23 | 3300021384 | Ga0213876_10030021 | Ga0213876_100300212 | 568 |
| 24 | 3300025961 | Ga0207712_10005524 | Ga0207712_100055241 | 568 |
| 25 | 3300025972 | Ga0207668_10031550 | Ga0207668_100315503 | 568 |
| 26 | 3300025986 | Ga0207658_10004106 | Ga0207658_100041065 | 568 |
| 27 | 3300028380 | Ga0268265_10000985 | Ga0268265_1000098523 | 568 |
| 28 | 3300028381 | Ga0268264_10059909 | Ga0268264_100599092 | 568 |
| 29 | 3300037853 | Ga0436364_1272494 | Ga0436364_1272494_2848_4611 | 568 |
| 30 | 3300039450 | Ga0436363_1603373 | Ga0436363_1603373_2513_4273 | 568 |
| 31 | 3300005344 | Ga0070661_100000145 | Ga0070661_10000014519 | 570 |
| 32 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003382 | 570 |
| 33 | 3300006038 | Ga0075365_10000891 | Ga0075365_1000089111 | 571 |
| 34 | 3300028379 | Ga0268266_10032580 | Ga0268266_100325802 | 571 |
| 35 | 3300048911 | Ga0496108_0000288 | Ga0496108_0000288_3943_5742 | 571 |
| 36 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_116562_118361 | 571 |
| 37 | 3300049591 | Ga0501075_0001056 | Ga0501075_0001056_354_2150 | 571 |
| 38 | 3300021384 | Ga0213876_10020088 | Ga0213876_100200882 | 572 |
| 39 | 3300039437 | Ga0436365_0050161 | Ga0436365_0050161_2063_3823 | 572 |
| 40 | 3300044719 | Ga0466971_0009797 | Ga0466971_0009797_714_2474 | 572 |
| 41 | 3300014326 | Ga0157380_10000439 | Ga0157380_1000043919 | 573 |
| 42 | 3300046454 | Ga0495592_0000078 | Ga0495592_0000078_52026_53822 | 573 |
| 43 | 3300046516 | Ga0495628_0002953 | Ga0495628_0002953_3153_4949 | 573 |
| 44 | 3300009101 | Ga0105247_10000347 | Ga0105247_1000034713 | 574 |
| 45 | 3300013297 | Ga0157378_10013876 | Ga0157378_100138765 | 574 |
| 46 | 3300013308 | Ga0157375_10000171 | Ga0157375_1000017147 | 574 |
| 47 | 3300017792 | Ga0163161_10000022 | Ga0163161_1000002284 | 574 |
| 48 | 3300046536 | Ga0495587_0002896 | Ga0495587_0002896_5791_7515 | 574 |
| 49 | 3300053083 | Ga0495655_0000543 | Ga0495655_0000543_3757_5670 | 574 |
| 50 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_95514_97310 | 575 |
| 51 | 3300046511 | Ga0495608_0000240 | Ga0495608_0000240_14326_16122 | 575 |
| 52 | 3300053084 | Ga0495595_0000157 | Ga0495595_0000157_8627_10423 | 575 |
| 53 | 3300053084 | Ga0495595_0001559 | Ga0495595_0001559_37_1827 | 575 |
| 54 | 3300005338 | Ga0068868_100004287 | Ga0068868_1000042876 | 576 |
| 55 | 3300005354 | Ga0070675_100000776 | Ga0070675_10000077612 | 576 |
| 56 | 3300014969 | Ga0157376_10017167 | Ga0157376_100171674 | 576 |
| 57 | 3300025926 | Ga0207659_10000013 | Ga0207659_10000013170 | 576 |
| 58 | 3300026023 | Ga0207677_10000379 | Ga0207677_100003795 | 576 |
| 59 | 3300028563 | Ga0265319_1000014 | Ga0265319_1000014120 | 576 |
| 60 | 3300028800 | Ga0265338_10000185 | Ga0265338_10000185118 | 576 |
| 61 | 3300031241 | Ga0265325_10014095 | Ga0265325_100140952 | 576 |
| 62 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_22279_24075 | 576 |
| 63 | 3300046663 | Ga0495635_0000031 | Ga0495635_0000031_23522_25318 | 576 |
| 64 | 3300046681 | Ga0495647_0001309 | Ga0495647_0001309_2769_4565 | 576 |
| 65 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_189396_191192 | 576 |
| 66 | 3300046689 | Ga0495613_0000032 | Ga0495613_0000032_45074_46948 | 576 |
| 67 | 3300046809 | Ga0495600_0017375 | Ga0495600_0017375_585_2420 | 576 |
| 68 | 3300053077 | Ga0495601_0000038 | Ga0495601_0000038_72499_74373 | 576 |
| 69 | 3300005436 | Ga0070713_100001073 | Ga0070713_10000107314 | 577 |
| 70 | 3300009098 | Ga0105245_10000026 | Ga0105245_1000002699 | 577 |
| 71 | 3300025927 | Ga0207687_10000017 | Ga0207687_1000001783 | 577 |
| 72 | 3300025928 | Ga0207700_10000033 | Ga0207700_10000033120 | 577 |
| 73 | 3300032126 | Ga0307415_100000776 | Ga0307415_1000007764 | 577 |
| 74 | 3300046690 | Ga0495624_0016933 | Ga0495624_0016933_2352_4148 | 577 |
| 75 | 3300047322 | Ga0495680_0000114 | Ga0495680_0000114_23355_25151 | 577 |
| 76 | 3300001979 | JGI24740J21852_10005534 | JGI24740J21852_100055345 | 578 |
| 77 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020233 | 578 |
| 78 | 3300009551 | Ga0105238_10000048 | Ga0105238_1000004833 | 578 |
| 79 | 3300025924 | Ga0207694_10000056 | Ga0207694_1000005633 | 578 |
| 80 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006145 | 578 |
| 81 | 3300046463 | Ga0495653_0017050 | Ga0495653_0017050_924_2720 | 578 |
| 82 | 3300047317 | Ga0495604_0000577 | Ga0495604_0000577_22659_24533 | 578 |
| 83 | 3300047317 | Ga0495604_0005265 | Ga0495604_0005265_6840_8714 | 578 |
| 84 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_51620_53494 | 578 |
| 85 | 3300005329 | Ga0070683_100001171 | Ga0070683_10000117121 | 579 |
| 86 | 3300005339 | Ga0070660_100024067 | Ga0070660_1000240672 | 579 |
| 87 | 3300005365 | Ga0070688_100002791 | Ga0070688_1000027917 | 579 |
| 88 | 3300005466 | Ga0070685_10000013 | Ga0070685_100000135 | 579 |
| 89 | 3300013105 | Ga0157369_10000014 | Ga0157369_1000001430 | 579 |
| 90 | 3300013297 | Ga0157378_10028598 | Ga0157378_100285983 | 579 |
| 91 | 3300025919 | Ga0207657_10011239 | Ga0207657_100112394 | 579 |
| 92 | 3300025944 | Ga0207661_10000220 | Ga0207661_1000022018 | 579 |
| 93 | 3300044842 | Ga0466957_0001578 | Ga0466957_0001578_7817_9619 | 579 |
| 94 | 3300046674 | Ga0495588_0000203 | Ga0495588_0000203_54706_56505 | 579 |
| 95 | 3300048922 | Ga0496119_0009992 | Ga0496119_0009992_1794_3533 | 579 |
| 96 | 3300005543 | Ga0070672_100000001 | Ga0070672_100000001203 | 581 |
| 97 | 3300013102 | Ga0157371_10040163 | Ga0157371_100401632 | 581 |
| 98 | 3300025940 | Ga0207691_10000017 | Ga0207691_10000017128 | 581 |
| 99 | 3300005548 | Ga0070665_100008785 | Ga0070665_1000087854 | 582 |
| 100 | 3300028379 | Ga0268266_10104120 | Ga0268266_101041201 | 582 |
| 101 | 3300038735 | Ga0400485_02102 | Ga0400485_02102_1447_3222 | 582 |
| 102 | 3300009147 | Ga0114129_10115786 | Ga0114129_101157863 | 583 |
| 103 | 3300005539 | Ga0068853_100077446 | Ga0068853_1000774462 | 584 |
| 104 | 3300014326 | Ga0157380_10001547 | Ga0157380_100015478 | 584 |
| 105 | 3300026041 | Ga0207639_10102261 | Ga0207639_101022612 | 584 |
| 106 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002118 | 585 |
| 107 | 3300021377 | Ga0213874_10004520 | Ga0213874_100045202 | 585 |
| 108 | 3300021384 | Ga0213876_10047700 | Ga0213876_100477002 | 585 |
| 109 | 3300021388 | Ga0213875_10005185 | Ga0213875_100051852 | 585 |
| 110 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004167 | 585 |
| 111 | 3300037853 | Ga0436364_1060681 | Ga0436364_1060681_3533_5293 | 585 |
| 112 | 3300039437 | Ga0436365_0330393 | Ga0436365_0330393_2158_3918 | 585 |
| 113 | 3300039437 | Ga0436365_0410951 | Ga0436365_0410951_11_1771 | 585 |
| 114 | 3300039437 | Ga0436365_1569230 | Ga0436365_1569230_114_1874 | 585 |
| 115 | 3300046558 | Ga0495633_0012646 | Ga0495633_0012646_117_1913 | 585 |
| 116 | 3300050509 | nmdc:mga0qj67_2962_c1 | nmdc:mga0qj67_2962_c1_1819_3576 | 585 |
| 117 | 3300005981 | Ga0081538_10008449 | Ga0081538_100084492 | 586 |
| 118 | 3300003373 | JGI25407J50210_10001130 | JGI25407J50210_100011305 | 587 |
| 119 | 3300005842 | Ga0068858_100000120 | Ga0068858_1000001209 | 587 |
| 120 | 3300026035 | Ga0207703_10000018 | Ga0207703_10000018242 | 587 |
| 121 | 3300044694 | Ga0466963_0018867 | Ga0466963_0018867_1851_3617 | 587 |
| 122 | 3300045976 | Ga0466967_0142180 | Ga0466967_0142180_285_2057 | 588 |
| 123 | 3300005338 | Ga0068868_100022420 | Ga0068868_1000224202 | 589 |
| 124 | 3300053085 | Ga0495619_0002559 | Ga0495619_0002559_3015_4811 | 589 |
| 125 | 3300044901 | Ga0466960_0031988 | Ga0466960_0031988_335_2119 | 592 |
| 126 | 3300005843 | Ga0068860_100002215 | Ga0068860_10000221511 | 593 |
| 127 | 3300009148 | Ga0105243_10023590 | Ga0105243_100235902 | 593 |
| 128 | 3300025935 | Ga0207709_10005406 | Ga0207709_100054062 | 593 |
| 129 | 3300025944 | Ga0207661_10015873 | Ga0207661_100158733 | 593 |
| 130 | 3300025944 | Ga0207661_10067239 | Ga0207661_100672392 | 593 |
| 131 | 3300025972 | Ga0207668_10010578 | Ga0207668_100105785 | 593 |
| 132 | 3300028381 | Ga0268264_10001600 | Ga0268264_1000160011 | 593 |
| 133 | 3300049592 | Ga0501076_0027300 | Ga0501076_0027300_2395_4188 | 593 |
| 134 | 3300049592 | Ga0501076_0096917 | Ga0501076_0096917_502_2295 | 593 |
| 135 | 3300005327 | Ga0070658_10014357 | Ga0070658_100143576 | 594 |
| 136 | 3300005338 | Ga0068868_100028183 | Ga0068868_1000281835 | 594 |
| 137 | 3300005339 | Ga0070660_100015463 | Ga0070660_1000154634 | 594 |
| 138 | 3300005341 | Ga0070691_10018823 | Ga0070691_100188232 | 594 |
| 139 | 3300005354 | Ga0070675_100031138 | Ga0070675_1000311382 | 594 |
| 140 | 3300005366 | Ga0070659_100007047 | Ga0070659_1000070476 | 594 |
| 141 | 3300005456 | Ga0070678_100094560 | Ga0070678_1000945601 | 594 |
| 142 | 3300005615 | Ga0070702_100003734 | Ga0070702_1000037344 | 594 |
| 143 | 3300005616 | Ga0068852_100024813 | Ga0068852_1000248132 | 594 |
| 144 | 3300005834 | Ga0068851_10007522 | Ga0068851_100075222 | 594 |
| 145 | 3300006048 | Ga0075363_100017854 | Ga0075363_1000178545 | 594 |
| 146 | 3300006881 | Ga0068865_100011062 | Ga0068865_1000110622 | 594 |
| 147 | 3300009098 | Ga0105245_10010880 | Ga0105245_100108805 | 594 |
| 148 | 3300009148 | Ga0105243_10008253 | Ga0105243_100082534 | 594 |
| 149 | 3300009177 | Ga0105248_10255686 | Ga0105248_102556862 | 594 |
| 150 | 3300025901 | Ga0207688_10010455 | Ga0207688_100104554 | 594 |
| 151 | 3300025908 | Ga0207643_10011475 | Ga0207643_100114753 | 594 |
| 152 | 3300025919 | Ga0207657_10006667 | Ga0207657_100066675 | 594 |
| 153 | 3300025926 | Ga0207659_10035949 | Ga0207659_100359492 | 594 |
| 154 | 3300025937 | Ga0207669_10053645 | Ga0207669_100536451 | 594 |
| 155 | 3300025938 | Ga0207704_10009618 | Ga0207704_100096182 | 594 |
| 156 | 3300025972 | Ga0207668_10071545 | Ga0207668_100715452 | 594 |
| 157 | 3300025981 | Ga0207640_10027841 | Ga0207640_100278413 | 594 |
| 158 | 3300026023 | Ga0207677_10084247 | Ga0207677_100842472 | 594 |
| 159 | 3300026067 | Ga0207678_10048458 | Ga0207678_100484583 | 594 |
| 160 | 3300046642 | Ga0495634_0000045 | Ga0495634_0000045_70065_71861 | 594 |
| 161 | 3300047322 | Ga0495680_0017955 | Ga0495680_0017955_433_2220 | 594 |
| 162 | 3300048911 | Ga0496108_0020734 | Ga0496108_0020734_1913_3721 | 594 |
| 163 | 3300048916 | Ga0496113_0043902 | Ga0496113_0043902_984_2792 | 594 |
| 164 | 3300048915 | Ga0496112_0001447 | Ga0496112_0001447_5022_6839 | 595 |
| 165 | 3300048916 | Ga0496113_0000099 | Ga0496113_0000099_27623_29440 | 595 |
| 166 | 3300005549 | Ga0070704_100074352 | Ga0070704_1000743522 | 597 |
| 167 | 3300025927 | Ga0207687_10028367 | Ga0207687_100283672 | 597 |
| 168 | 3300047321 | Ga0495676_0011737 | Ga0495676_0011737_2052_3860 | 597 |
| 169 | 3300048903 | Ga0496100_0057219 | Ga0496100_0057219_86_1894 | 597 |
| 170 | 3300048904 | Ga0496101_0017243 | Ga0496101_0017243_708_2516 | 597 |
| 171 | 3300048910 | Ga0496107_0027516 | Ga0496107_0027516_85_1893 | 597 |
| 172 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_55662_57455 | 597 |
| 173 | 3300048917 | Ga0496114_0023959 | Ga0496114_0023959_105_1913 | 597 |
| 174 | 3300048918 | Ga0496115_0017768 | Ga0496115_0017768_851_2659 | 597 |
| 175 | 3300048921 | Ga0496118_0000790 | Ga0496118_0000790_28356_30158 | 597 |
| 176 | 3300048923 | Ga0496120_0002463 | Ga0496120_0002463_10086_11888 | 597 |
| 177 | 3300048924 | Ga0496121_0058451 | Ga0496121_0058451_970_2772 | 597 |
| 178 | 3300005327 | Ga0070658_10135481 | Ga0070658_101354811 | 598 |
| 179 | 3300005356 | Ga0070674_100000007 | Ga0070674_10000000766 | 598 |
| 180 | 3300005439 | Ga0070711_100001686 | Ga0070711_1000016862 | 598 |
| 181 | 3300005459 | Ga0068867_100000750 | Ga0068867_10000075010 | 598 |
| 182 | 3300005548 | Ga0070665_100074806 | Ga0070665_1000748062 | 598 |
| 183 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003207 | 598 |
| 184 | 3300006163 | Ga0070715_10000029 | Ga0070715_1000002984 | 598 |
| 185 | 3300013308 | Ga0157375_10002318 | Ga0157375_100023183 | 598 |
| 186 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002458 | 598 |
| 187 | 3300025900 | Ga0207710_10000631 | Ga0207710_100006316 | 598 |
| 188 | 3300025905 | Ga0207685_10000031 | Ga0207685_100000316 | 598 |
| 189 | 3300025916 | Ga0207663_10003958 | Ga0207663_100039583 | 598 |
| 190 | 3300025937 | Ga0207669_10000001 | Ga0207669_1000000184 | 598 |
| 191 | 3300026089 | Ga0207648_10001987 | Ga0207648_1000198711 | 598 |
| 192 | 3300026121 | Ga0207683_10058973 | Ga0207683_100589732 | 598 |
| 193 | 3300028379 | Ga0268266_10000376 | Ga0268266_1000037646 | 598 |
| 194 | 3300046459 | Ga0495629_0000106 | Ga0495629_0000106_4390_6189 | 598 |
| 195 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_187441_189240 | 598 |
| 196 | 3300046516 | Ga0495628_0025385 | Ga0495628_0025385_1867_3666 | 598 |
| 197 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_26685_28484 | 598 |
| 198 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_142862_144661 | 598 |
| 199 | 3300046681 | Ga0495647_0006939 | Ga0495647_0006939_1410_3209 | 598 |
| 200 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_60517_62316 | 598 |
| 201 | 3300047321 | Ga0495676_0000186 | Ga0495676_0000186_16675_18471 | 598 |
| 202 | 3300048905 | Ga0496102_0095960 | Ga0496102_0095960_260_2056 | 598 |
| 203 | 3300048911 | Ga0496108_0000295 | Ga0496108_0000295_38706_40502 | 598 |
| 204 | 3300048911 | Ga0496108_0014098 | Ga0496108_0014098_3917_5716 | 598 |
| 205 | 3300048912 | Ga0496109_0000056 | Ga0496109_0000056_97621_99420 | 598 |
| 206 | 3300048912 | Ga0496109_0000371 | Ga0496109_0000371_37586_39382 | 598 |
| 207 | 3300048914 | Ga0496111_0026153 | Ga0496111_0026153_1532_3331 | 598 |
| 208 | 3300048917 | Ga0496114_0000171 | Ga0496114_0000171_12056_13852 | 598 |
| 209 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_187704_189500 | 598 |
| 210 | 3300048918 | Ga0496115_0002021 | Ga0496115_0002021_648_2444 | 598 |
| 211 | 3300048919 | Ga0496116_0000367 | Ga0496116_0000367_33273_35108 | 598 |
| 212 | 3300048922 | Ga0496119_0003161 | Ga0496119_0003161_8952_10787 | 598 |
| 213 | 3300050515 | nmdc:mga0a205_5033_c1 | nmdc:mga0a205_5033_c1_7502_9298 | 598 |
| 214 | 3300053078 | Ga0495612_0000110 | Ga0495612_0000110_10231_12030 | 598 |
| 215 | 3300053078 | Ga0495612_0001018 | Ga0495612_0001018_2444_4243 | 598 |
| 216 | 3300001977 | JGI24746J21847_1000436 | JGI24746J21847_10004365 | 599 |
| 217 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011103 | 599 |
| 218 | 3300005338 | Ga0068868_100000453 | Ga0068868_10000045316 | 599 |
| 219 | 3300005341 | Ga0070691_10000002 | Ga0070691_1000000222 | 599 |
| 220 | 3300005435 | Ga0070714_100042700 | Ga0070714_1000427003 | 599 |
| 221 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002145 | 599 |
| 222 | 3300005547 | Ga0070693_100000215 | Ga0070693_10000021527 | 599 |
| 223 | 3300005578 | Ga0068854_100000113 | Ga0068854_10000011332 | 599 |
| 224 | 3300005614 | Ga0068856_100001668 | Ga0068856_10000166820 | 599 |
| 225 | 3300005834 | Ga0068851_10004719 | Ga0068851_100047195 | 599 |
| 226 | 3300006881 | Ga0068865_100000094 | Ga0068865_10000009433 | 599 |
| 227 | 3300009098 | Ga0105245_10002028 | Ga0105245_100020289 | 599 |
| 228 | 3300009176 | Ga0105242_10001472 | Ga0105242_1000147212 | 599 |
| 229 | 3300013307 | Ga0157372_10000060 | Ga0157372_1000006066 | 599 |
| 230 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001327 | 599 |
| 231 | 3300025934 | Ga0207686_10000888 | Ga0207686_100008889 | 599 |
| 232 | 3300025938 | Ga0207704_10000088 | Ga0207704_1000008818 | 599 |
| 233 | 3300025981 | Ga0207640_10000401 | Ga0207640_100004012 | 599 |
| 234 | 3300026023 | Ga0207677_10000203 | Ga0207677_1000020326 | 599 |
| 235 | 3300026078 | Ga0207702_10000076 | Ga0207702_1000007665 | 599 |
| 236 | 3300026078 | Ga0207702_10069275 | Ga0207702_100692752 | 599 |
| 237 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_212063_213904 | 599 |
| 238 | 3300046460 | Ga0495638_0046513 | Ga0495638_0046513_161_1960 | 599 |
| 239 | 3300046499 | Ga0495594_0000045 | Ga0495594_0000045_45588_47438 | 599 |
| 240 | 3300046516 | Ga0495628_0000808 | Ga0495628_0000808_4151_5965 | 599 |
| 241 | 3300046557 | Ga0495622_0000201 | Ga0495622_0000201_43981_45810 | 599 |
| 242 | 3300047317 | Ga0495604_0000067 | Ga0495604_0000067_25066_26940 | 599 |
| 243 | 3300048088 | Ga0495602_0000775 | Ga0495602_0000775_541_2355 | 599 |
| 244 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_295453_297303 | 599 |
| 245 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_96805_98655 | 599 |
| 246 | 3300048905 | Ga0496102_0033579 | Ga0496102_0033579_2383_4221 | 599 |
| 247 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_118189_120018 | 599 |
| 248 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_355781_357610 | 599 |
| 249 | 3300048909 | Ga0496106_0000056 | Ga0496106_0000056_17778_19628 | 599 |
| 250 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_232945_234795 | 599 |
| 251 | 3300048913 | Ga0496110_0000114 | Ga0496110_0000114_40515_42356 | 599 |
| 252 | 3300048914 | Ga0496111_0000008 | Ga0496111_0000008_38664_40505 | 599 |
| 253 | 3300049586 | Ga0501070_0024224 | Ga0501070_0024224_1619_3442 | 599 |
| 254 | 3300053085 | Ga0495619_0000081 | Ga0495619_0000081_13893_15692 | 599 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9587 | 16 | 118 |
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9318 | 16 | 118 |
| 4o2d-assembly1.cif.gz_A | crystal structure of aspartyl-trna synthetase from mycobacterium smegmatis with bound aspartic acid | 0.8792 | 13 | 590 |
| 6wom-assembly2.cif.gz_C-2 | crystal structure of aspartyl-trna ligase from elizabethkingia sp. | 0.8777 | 12 | 589 |
| 6wom-assembly2.cif.gz_C-2 | crystal structure of aspartyl-trna ligase from elizabethkingia sp. | 0.8762 | 12 | 589 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4o2dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9755 | 13 | 118 | 2.40.50.140 |
| 1l0wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9675 | 14 | 121 | 2.40.50.140 |
| 1c0aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.967 | 14 | 119 | 2.40.50.140 |
| 5groB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9587 | 16 | 118 | 2.40.50.140 |
| 1c0aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9493 | 14 | 119 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7VKA8-F1-model_v4 | Aspartate--tRNA ligase | 0.9793 | 14 | 116 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A2M8AHC2-F1-model_v4 | Aspartate--tRNA ligase | 0.9736 | 252 | 540 |
GO:0004815
GO:0005524 GO:0005737 GO:0006422 |
| AF-A0A536LPS0-F1-model_v4 | Aspartate--tRNA ligase | 0.9736 | 16 | 111 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A6A8LTC8-F1-model_v4 | Aspartate--tRNA ligase (EC 6.1.1.12) | 0.9727 | 14 | 114 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A7V2TNW9-F1-model_v4 | Aspartate--tRNA ligase | 0.9719 | 10 | 114 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar