F364380

General Info

Members Datasets Scaffolds Average Seq Length
253 173 223 320

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0001648|Ga0496121_0001648_19870_20943
Length 357
Sequence MGPADSKSQRREIKPKKIKTLTRAIKGQKMTEKFGAKSTADDVLSGVDLKGKRFLITGASSGIGLETARSLASHGASVVGAVRDLAKARAATASVRDVASQAGGSIELIELDLASLQSVRACADKLLADGRPFDSIIANAGVMATPFGRTVDGFEVQFGTNYLGHFALINRIEPLLADNGRLVVLSSQAHRVADVDLDDPNFGQQAYDPFVAYGRSKTATSLFAVEFDRRHRNRGIRAASVMPGNSLTDLPRHFSQQELQGLFETVGKARADAGLPPAELKEISQAAATSVWAAAVANKDEIGGHYLEDCAVAPIDDTPNPFADGVRSYALDANKARQLWAKSEELISTVVKVIAHI

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
4 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
7 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
8 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
9 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
10 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221719 Rhizobium sp. Root274 Isolate Unclassified
15 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
16 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
17 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
20 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
21 2904456579 Variovorax sp. 2002 Isolate Unclassified
22 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
23 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
24 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
25 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
77 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
78 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
168 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
169 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
170 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
171 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
172 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
173 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.14
Metatranscriptomes 0
Isolates 11.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.86
Nodule 5.14
Rhizoplane 2.77
Rhizosphere 65.61
Stem 0
Stem Tuber 0
Unclassified 14.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5301574 2162886012 Bacteria 1489
2 JGI24735J21928_10002408 3300002067 Bacteria 6501
3 Ga0055526_1006264 3300003771 Bacteria 6517
4 Ga0055524_1000200 3300003775 Bacteria 65908
5 Ga0055528_1000033 3300003790 Bacteria 119662
6 Ga0055543_1006172 3300004625 Bacteria 2939
7 Ga0065165_1013166 3300005262 Bacteria 3309
8 Ga0065714_10002636 3300005288 Bacteria 12793
9 Ga0065714_10065031 3300005288 Bacteria 13739
10 Ga0065704_10003665 3300005289 Bacteria 6400
11 Ga0065715_10093156 3300005293 Bacteria 4789
12 Ga0070666_10027286 3300005335 Bacteria 3738
13 Ga0070671_100130704 3300005355 Bacteria 2115
14 Ga0070684_100087023 3300005535 Bacteria 2774
15 Ga0070665_100376906 3300005548 Bacteria 1426
16 Ga0068859_100065426 3300005617 Bacteria 3670
17 Ga0068858_100006060 3300005842 Bacteria 11787
18 Ga0075363_100002364 3300006048 Bacteria 7678
19 Ga0075362_10000015 3300006177 Bacteria 84026
20 Ga0075369_10001344 3300006186 Bacteria 8357
21 Ga0075366_10000072 3300006195 Bacteria 39088
22 Ga0075366_10156153 3300006195 Bacteria 1382
23 Ga0075370_10000005 3300006353 Bacteria 112202
24 Ga0097620_100065426 3300006931 Bacteria 3670
25 Ga0105251_10023665 3300009011 Bacteria 3165
26 Ga0105244_10001814 3300009036 Bacteria 16711
27 Ga0105240_10104136 3300009093 Bacteria 3446
28 Ga0105240_10282754 3300009093 Bacteria 1905
29 Ga0105243_10096802 3300009148 Bacteria 2442
30 Ga0105238_10028146 3300009551 Bacteria 5725
31 Ga0105239_10185548 3300010375 Bacteria 2328
32 Ga0157371_10001607 3300013102 Bacteria 23174
33 Ga0163162_10000878 3300013306 Bacteria 27977
34 Ga0182008_10025617 3300014497 Bacteria 2996
35 Ga0182008_10042256 3300014497 Bacteria 2272
36 Ga0182008_10139487 3300014497 Bacteria 1212
37 Ga0157379_10167195 3300014968 Bacteria 1985
38 Ga0182006_1002982 3300015261 Bacteria 8912
39 Ga0182006_1009134 3300015261 Bacteria 4456
40 Ga0182007_10015463 3300015262 Bacteria 2845
41 Ga0182005_1001657 3300015265 Bacteria 8659
42 Ga0182005_1008632 3300015265 Bacteria 2994
43 Ga0163161_10020329 3300017792 Bacteria 4658
44 Ga0209673_1000157 3300025273 Bacteria 144747
45 Ga0209564_1000237 3300025295 Bacteria 120540
46 Ga0209256_1000185 3300025299 Bacteria 120265
47 Ga0209051_1001296 3300025303 Bacteria 22021
48 Ga0207713_1011932 3300025735 Bacteria 4686
49 Ga0207680_10032003 3300025903 Bacteria 2984
50 Ga0207695_10265187 3300025913 Bacteria 1614
51 Ga0207695_10437512 3300025913 Bacteria 1191
52 Ga0207709_10055800 3300025935 Bacteria 2442
53 Ga0207703_10003735 3300026035 Bacteria 12667
54 Ga0207641_10229665 3300026088 Bacteria 1724
55 Ga0268266_10300585 3300028379 Bacteria 1497
56 Ga0307509_10000021 3300031507 Bacteria 250589
57 Ga0307514_10102006 3300031649 Bacteria 2058
58 Ga0307507_10057865 3300033179 Bacteria 3646
59 Ga0439466_0012290 3300041411 Bacteria 3156
60 Ga0439466_0056135 3300041411 Bacteria 1278
61 Ga0439451_000768 3300042009 Bacteria 6108
62 Ga0439456_002792 3300042013 Bacteria 3521
63 Ga0450907_000035 3300042146 Bacteria 60070
64 Ga0439446_0000921 3300042156 Bacteria 6349
65 Ga0450909_001164 3300042185 Bacteria 3641
66 Ga0439434_0000039 3300042435 Bacteria 31449
67 Ga0439460_0030850 3300042461 Bacteria 1526
68 Ga0439440_0000239 3300042993 Bacteria 8801
69 Ga0495617_001484 3300046452 Bacteria 10256
70 Ga0495617_009425 3300046452 Bacteria 3353
71 Ga0495638_0000027 3300046460 Bacteria 337569
72 Ga0495638_0002520 3300046460 Bacteria 14903
73 Ga0495638_0043045 3300046460 Bacteria 2850
74 Ga0495638_0113332 3300046460 Bacteria 1609
75 Ga0495653_0044252 3300046463 Bacteria 3455
76 Ga0495650_0001919 3300046471 Bacteria 18411
77 Ga0495582_0025951 3300046473 Bacteria 3211
78 Ga0495605_0005339 3300046474 Bacteria 7490
79 Ga0495605_0021716 3300046474 Bacteria 3395
80 Ga0495639_0023220 3300046475 Bacteria 2724
81 Ga0495584_0003646 3300046491 Bacteria 8397
82 Ga0495585_0001603 3300046492 Bacteria 17472
83 Ga0495585_0002294 3300046492 Bacteria 13786
84 Ga0495585_0027774 3300046492 Bacteria 3229
85 Ga0495607_0001683 3300046501 Bacteria 19054
86 Ga0495607_0002107 3300046501 Bacteria 16612
87 Ga0495607_0002360 3300046501 Bacteria 15426
88 Ga0495607_0008316 3300046501 Bacteria 7094
89 Ga0495583_0000006 3300046506 Bacteria 436893
90 Ga0495583_0000415 3300046506 Bacteria 64791
91 Ga0495606_0000208 3300046507 Bacteria 103578
92 Ga0495606_0004315 3300046507 Bacteria 14309
93 Ga0495606_0009048 3300046507 Bacteria 8502
94 Ga0495610_0002288 3300046512 Bacteria 16185
95 Ga0495610_0005000 3300046512 Bacteria 9600
96 Ga0495616_0011249 3300046513 Bacteria 5137
97 Ga0495618_0011239 3300046514 Bacteria 5424
98 Ga0495628_0014567 3300046516 Bacteria 6586
99 Ga0495630_0127173 3300046517 Bacteria 1934
100 Ga0495632_0127401 3300046519 Bacteria 1186
101 Ga0495637_0003505 3300046520 Bacteria 8319
102 Ga0495643_0000082 3300046522 Bacteria 159651
103 Ga0495643_0012610 3300046522 Bacteria 5092
104 Ga0495643_0039289 3300046522 Bacteria 2589
105 Ga0495644_0000291 3300046523 Bacteria 23231
106 Ga0495648_0000002 3300046524 Bacteria 593972
107 Ga0495648_0004642 3300046524 Bacteria 11660
108 Ga0495648_0072137 3300046524 Bacteria 1999
109 Ga0495666_0042250 3300046526 Bacteria 2205
110 Ga0495642_0026271 3300046528 Bacteria 2312
111 Ga0495654_0003432 3300046530 Bacteria 9716
112 Ga0495665_0036359 3300046531 Bacteria 2629
113 Ga0495640_0133090 3300046533 Bacteria 1608
114 Ga0495609_0000195 3300046538 Bacteria 60608
115 Ga0495609_0004741 3300046538 Bacteria 7354
116 Ga0495609_0154923 3300046538 Bacteria 973
117 Ga0495622_0000043 3300046557 Bacteria 115796
118 Ga0495633_0000033 3300046558 Bacteria 186714
119 Ga0495656_0005218 3300046615 Bacteria 4476
120 Ga0495656_0007349 3300046615 Bacteria 3890
121 Ga0495611_0012014 3300046648 Bacteria 3679
122 Ga0495625_0000053 3300046660 Bacteria 190575
123 Ga0495625_0009715 3300046660 Bacteria 8006
124 Ga0495625_0017500 3300046660 Bacteria 5610
125 Ga0495625_0022916 3300046660 Bacteria 4777
126 Ga0495625_0151737 3300046660 Bacteria 1557
127 Ga0495659_0000758 3300046664 Bacteria 11589
128 Ga0495659_0108808 3300046664 Bacteria 1080
129 Ga0495661_0068877 3300046665 Bacteria 2075
130 Ga0495661_0092525 3300046665 Bacteria 1718
131 Ga0495661_0100546 3300046665 Bacteria 1628
132 Ga0495623_0005465 3300046679 Bacteria 8305
133 Ga0495624_0024680 3300046690 Bacteria 3954
134 Ga0495624_0060877 3300046690 Bacteria 2366
135 Ga0495670_0076803 3300046691 Bacteria 1697
136 Ga0495671_0052532 3300046692 Bacteria 2025
137 Ga0495649_0011210 3300046694 Bacteria 5269
138 Ga0495649_0013444 3300046694 Bacteria 4722
139 Ga0495649_0014200 3300046694 Bacteria 4573
140 Ga0495649_0060495 3300046694 Bacteria 2038
141 Ga0495649_0156587 3300046694 Unclassified 1195
142 Ga0495660_0003477 3300046810 Bacteria 9720
143 Ga0495660_0084283 3300046810 Bacteria 1662
144 Ga0495604_0002871 3300047317 Bacteria 13822
145 Ga0495636_0030673 3300047318 Bacteria 2199
146 Ga0495636_0159653 3300047318 Bacteria 1015
147 Ga0495674_0043882 3300047319 Bacteria 3976
148 Ga0495674_0060781 3300047319 Bacteria 3295
149 Ga0495672_0000050 3300047320 Bacteria 240336
150 Ga0495672_0000081 3300047320 Bacteria 159863
151 Ga0495672_0000150 3300047320 Bacteria 101026
152 Ga0495672_0009715 3300047320 Bacteria 6935
153 Ga0495676_0067417 3300047321 Bacteria 2768
154 Ga0495680_0011572 3300047322 Bacteria 7801
155 Ga0495683_0000360 3300047323 Bacteria 37542
156 Ga0495683_0005743 3300047323 Bacteria 6838
157 Ga0495683_0118520 3300047323 Bacteria 1258
158 Ga0495683_0124251 3300047323 Bacteria 1222
159 Ga0495687_004456 3300047443 Bacteria 9437
160 Ga0495687_015434 3300047443 Bacteria 3884
161 Ga0495687_028788 3300047443 Bacteria 2579
162 Ga0495687_046079 3300047443 Bacteria 1884
163 Ga0495687_095979 3300047443 Bacteria 1123
164 Ga0495685_000016 3300047447 Bacteria 76154
165 Ga0495685_000905 3300047447 Bacteria 9058
166 Ga0495673_0000080 3300047469 Bacteria 201831
167 Ga0495673_0000999 3300047469 Bacteria 25145
168 Ga0495673_0006179 3300047469 Bacteria 7094
169 Ga0495673_0043312 3300047469 Bacteria 2015
170 Ga0495686_0052387 3300047472 Bacteria 2559
171 Ga0495593_0007889 3300047673 Bacteria 6199
172 Ga0495602_0007723 3300048088 Bacteria 11244
173 Ga0495614_0050023 3300048089 Bacteria 1791
174 Ga0495626_0001803 3300048091 Bacteria 16156
175 Ga0495626_0013678 3300048091 Bacteria 4211
176 Ga0496102_0047776 3300048905 Bacteria 3891
177 Ga0496102_0172784 3300048905 Bacteria 2034
178 Ga0496102_0256001 3300048905 Bacteria 1650
179 Ga0496103_0017797 3300048906 Bacteria 4257
180 Ga0496106_0000038 3300048909 Bacteria 111983
181 Ga0496116_0027878 3300048919 Bacteria 4103
182 Ga0496117_0000195 3300048920 Bacteria 123331
183 Ga0496117_0018794 3300048920 Bacteria 5708
184 Ga0496118_0000016 3300048921 Bacteria 549586
185 Ga0496118_0030352 3300048921 Bacteria 4513
186 Ga0496119_0007811 3300048922 Bacteria 9539
187 Ga0496120_0033148 3300048923 Bacteria 3106
188 Ga0496120_0072408 3300048923 Bacteria 1888
189 Ga0496121_0001648 3300048924 Bacteria 36903
190 Ga0496121_0010420 3300048924 Bacteria 10487
191 Ga0496121_0014553 3300048924 Bacteria 8338
192 Ga0496121_0125433 3300048924 Bacteria 1931
193 Ga0496122_0055227 3300048925 Bacteria 2974
194 Ga0496122_0164187 3300048925 Bacteria 1349
195 Ga0496123_0014475 3300048926 Bacteria 6535
196 Ga0496125_0012215 3300048928 Bacteria 8544
197 Ga0496125_0024586 3300048928 Bacteria 5536
198 Ga0496126_0010503 3300048929 Bacteria 9696
199 Ga0496126_0019195 3300048929 Bacteria 6738
200 Ga0496126_0038092 3300048929 Bacteria 4476
201 Ga0496126_0064577 3300048929 Bacteria 3279
202 Ga0496126_0130938 3300048929 Bacteria 2168
203 Ga0496126_0192321 3300048929 Bacteria 1727
204 Ga0495678_000074 3300049459 Bacteria 125964
205 Ga0495678_003545 3300049459 Bacteria 9572
206 Ga0495678_006191 3300049459 Bacteria 6400
207 Ga0495682_0000402 3300049460 Bacteria 31076
208 Ga0495682_0001421 3300049460 Bacteria 12967
209 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
210 nmdc:mga03n38_5505_c1 3300050490 Unclassified 4317
211 nmdc:mga0k408_19667_c1 3300050493 Bacteria 3776
212 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
213 nmdc:mga04h51_105981_c1 3300050495 Bacteria 1030
214 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
215 nmdc:mga0sz30_261_c1 3300050516 Bacteria 20355
216 Ga0500583_0000463 3300053092 Bacteria 12643
217 Ga0500641_0057642 3300053096 Bacteria 1611
218 Ga0500594_0002956 3300053118 Bacteria 3712
219 Ga0500568_0000280 3300053139 Bacteria 42298
220 Ga0500568_0052490 3300053139 Bacteria 1600
221 Ga0500616_0001924 3300053153 Bacteria 18531
222 Ga0500622_0016630 3300053156 Bacteria 3929
223 Ga0500633_0002546 3300053160 Bacteria 3779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0154923 Ga0495609_0154923_33_857 274
2 3300042461 Ga0439460_0030850 Ga0439460_0030850_568_1395 275
3 3300048919 Ga0496116_0027878 Ga0496116_0027878_3146_4012 280
4 3300053160 Ga0500633_0002546 Ga0500633_0002546_2568_3572 292
5 3300014497 Ga0182008_10139487 Ga0182008_101394871 293
6 3300009093 Ga0105240_10282754 Ga0105240_102827541 294
7 3300025913 Ga0207695_10437512 Ga0207695_104375121 294
8 3300046460 Ga0495638_0002520 Ga0495638_0002520_8143_9135 294
9 3300046690 Ga0495624_0060877 Ga0495624_0060877_669_1691 294
10 3300046694 Ga0495649_0013444 Ga0495649_0013444_574_1596 294
11 3300047319 Ga0495674_0043882 Ga0495674_0043882_798_1820 294
12 3300047320 Ga0495672_0000050 Ga0495672_0000050_177390_178394 294
13 3300047323 Ga0495683_0124251 Ga0495683_0124251_140_1162 294
14 3300053139 Ga0500568_0000280 Ga0500568_0000280_36224_37207 294
15 3300053153 Ga0500616_0001924 Ga0500616_0001924_433_1425 294
16 3300002067 JGI24735J21928_10002408 JGI24735J21928_100024085 295
17 3300046522 Ga0495643_0012610 Ga0495643_0012610_3581_4630 295
18 3300047318 Ga0495636_0159653 Ga0495636_0159653_11_991 295
19 3300046463 Ga0495653_0044252 Ga0495653_0044252_732_1754 296
20 3300046473 Ga0495582_0025951 Ga0495582_0025951_565_1587 296
21 3300046514 Ga0495618_0011239 Ga0495618_0011239_1926_2948 296
22 3300046516 Ga0495628_0014567 Ga0495628_0014567_3311_4333 296
23 3300046517 Ga0495630_0127173 Ga0495630_0127173_476_1498 296
24 3300046526 Ga0495666_0042250 Ga0495666_0042250_1013_2035 296
25 3300046531 Ga0495665_0036359 Ga0495665_0036359_944_1966 296
26 3300046533 Ga0495640_0133090 Ga0495640_0133090_273_1295 296
27 3300046679 Ga0495623_0005465 Ga0495623_0005465_5891_6913 296
28 3300046690 Ga0495624_0024680 Ga0495624_0024680_1690_2712 296
29 3300047317 Ga0495604_0002871 Ga0495604_0002871_4224_5246 296
30 3300047319 Ga0495674_0060781 Ga0495674_0060781_1726_2748 296
31 3300047321 Ga0495676_0067417 Ga0495676_0067417_943_1965 296
32 3300047322 Ga0495680_0011572 Ga0495680_0011572_4446_5468 296
33 3300047443 Ga0495687_028788 Ga0495687_028788_742_1725 296
34 3300047673 Ga0495593_0007889 Ga0495593_0007889_1613_2635 296
35 3300048088 Ga0495602_0007723 Ga0495602_0007723_1616_2638 296
36 3300048089 Ga0495614_0050023 Ga0495614_0050023_537_1559 296
37 3300048920 Ga0496117_0018794 Ga0496117_0018794_1137_2186 299
38 3300048926 Ga0496123_0014475 Ga0496123_0014475_2069_3118 299
39 3300031507 Ga0307509_10000021 Ga0307509_10000021121 300
40 3300046810 Ga0495660_0084283 Ga0495660_0084283_67_1032 300
41 3300047469 Ga0495673_0000080 Ga0495673_0000080_108265_109224 303
42 3300047469 Ga0495673_0043312 Ga0495673_0043312_186_1112 303
43 3300046660 Ga0495625_0151737 Ga0495625_0151737_530_1459 304
44 3300046665 Ga0495661_0068877 Ga0495661_0068877_627_1556 304
45 3300046810 Ga0495660_0003477 Ga0495660_0003477_1711_2640 304
46 3300031649 Ga0307514_10102006 Ga0307514_101020062 306
47 3300046460 Ga0495638_0113332 Ga0495638_0113332_316_1281 306
48 3300046664 Ga0495659_0000758 Ga0495659_0000758_9899_10864 306
49 3300046665 Ga0495661_0092525 Ga0495661_0092525_518_1483 306
50 3300046694 Ga0495649_0156587 Ga0495649_0156587_171_1136 306
51 3300047443 Ga0495687_046079 Ga0495687_046079_728_1693 306
52 3300047447 Ga0495685_000905 Ga0495685_000905_7138_8103 306
53 3300025303 Ga0209051_1001296 Ga0209051_100129623 307
54 3300048920 Ga0496117_0000195 Ga0496117_0000195_208_1155 307
55 3300048921 Ga0496118_0000016 Ga0496118_0000016_242495_243442 307
56 3300048922 Ga0496119_0007811 Ga0496119_0007811_3831_4778 307
57 3300048923 Ga0496120_0033148 Ga0496120_0033148_195_1142 307
58 3300048923 Ga0496120_0072408 Ga0496120_0072408_483_1430 307
59 3300048924 Ga0496121_0014553 Ga0496121_0014553_5465_6412 307
60 3300048928 Ga0496125_0012215 Ga0496125_0012215_7213_8160 307
61 3300048928 Ga0496125_0024586 Ga0496125_0024586_49_996 307
62 3300048929 Ga0496126_0038092 Ga0496126_0038092_1215_2162 307
63 iso_pu_bacteria 2513237093 2513633915 310
64 iso_pu_bacteria 2515154114 2515646900 310
65 iso_pu_bacteria 2643221611 2644072770 311
66 iso_pu_bacteria 2510065045 2510247294 312
67 iso_pu_bacteria 2513237103 2513707292 312
68 iso_pu_bacteria 2515154113 2515638807 312
69 iso_pu_bacteria 2516653077 2517038760 312
70 iso_pu_bacteria 2643221664 2644357075 312
71 iso_pu_bacteria 2718217991 2719638527 312
72 iso_pu_bacteria 2821443989 2821450845 312
73 iso_pu_bacteria 2842217011 2842219128 312
74 iso_pu_bacteria 2885383462 2885389837 312
75 iso_pu_bacteria 2919100787 2919106413 312
76 iso_pu_bacteria 2936367885 2936369224 312
77 iso_pu_bacteria 2936375103 2936377429 312
78 iso_pu_bacteria 3005416602 3005419797 312
79 iso_pu_bacteria 639633055 639646357 312
80 iso_pu_bacteria 8005314921 8005317779 312
81 iso_pu_bacteria 8005376324 8005377727 312
82 iso_pu_bacteria 8045864390 8045865700 312
83 iso_pu_bacteria 8055301274 8055304488 312
84 iso_pu_bacteria 8057874678 8057877451 312
85 3300006048 Ga0075363_100002364 Ga0075363_1000023647 313
86 3300006177 Ga0075362_10000015 Ga0075362_1000001555 313
87 3300006186 Ga0075369_10001344 Ga0075369_100013445 313
88 3300006195 Ga0075366_10000072 Ga0075366_100000726 313
89 3300006195 Ga0075366_10156153 Ga0075366_101561532 313
90 3300006353 Ga0075370_10000005 Ga0075370_100000052 313
91 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_282395_283351 313
92 3300050490 nmdc:mga03n38_5505_c1 nmdc:mga03n38_5505_c1_2252_3208 313
93 3300050493 nmdc:mga0k408_19667_c1 nmdc:mga0k408_19667_c1_2712_3710 313
94 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_267658_268614 313
95 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_419279_420277 313
96 3300050516 nmdc:mga0sz30_261_c1 nmdc:mga0sz30_261_c1_3963_4919 313
97 iso_pu_bacteria 2571042143 2571530063 314
98 3300025913 Ga0207695_10265187 Ga0207695_102651872 315
99 3300046452 Ga0495617_001484 Ga0495617_001484_8949_9905 315
100 3300046507 Ga0495606_0000208 Ga0495606_0000208_60974_61930 315
101 3300046520 Ga0495637_0003505 Ga0495637_0003505_5525_6502 315
102 3300047323 Ga0495683_0118520 Ga0495683_0118520_111_1067 315
103 3300048929 Ga0496126_0010503 Ga0496126_0010503_3904_4887 315
104 3300048929 Ga0496126_0130938 Ga0496126_0130938_23_982 315
105 iso_pu_bacteria 2857558681 2857558696 315
106 3300003771 Ga0055526_1006264 Ga0055526_10062645 316
107 3300003775 Ga0055524_1000200 Ga0055524_100020063 316
108 3300003790 Ga0055528_1000033 Ga0055528_100003396 316
109 3300005288 Ga0065714_10065031 Ga0065714_1006503113 316
110 3300005335 Ga0070666_10027286 Ga0070666_100272863 316
111 3300005355 Ga0070671_100130704 Ga0070671_1001307042 316
112 3300005535 Ga0070684_100087023 Ga0070684_1000870233 316
113 3300005617 Ga0068859_100065426 Ga0068859_1000654263 316
114 3300005842 Ga0068858_100006060 Ga0068858_1000060605 316
115 3300006931 Ga0097620_100065426 Ga0097620_1000654263 316
116 3300009036 Ga0105244_10001814 Ga0105244_1000181417 316
117 3300009093 Ga0105240_10104136 Ga0105240_101041362 316
118 3300009148 Ga0105243_10096802 Ga0105243_100968021 316
119 3300009551 Ga0105238_10028146 Ga0105238_100281467 316
120 3300010375 Ga0105239_10185548 Ga0105239_101855482 316
121 3300014497 Ga0182008_10042256 Ga0182008_100422562 316
122 3300014968 Ga0157379_10167195 Ga0157379_101671952 316
123 3300015261 Ga0182006_1002982 Ga0182006_10029825 316
124 3300015261 Ga0182006_1009134 Ga0182006_10091342 316
125 3300015262 Ga0182007_10015463 Ga0182007_100154633 316
126 3300015265 Ga0182005_1008632 Ga0182005_10086322 316
127 3300025273 Ga0209673_1000157 Ga0209673_100015792 316
128 3300025295 Ga0209564_1000237 Ga0209564_100023792 316
129 3300025299 Ga0209256_1000185 Ga0209256_100018592 316
130 3300025903 Ga0207680_10032003 Ga0207680_100320033 316
131 3300025935 Ga0207709_10055800 Ga0207709_100558003 316
132 3300026035 Ga0207703_10003735 Ga0207703_1000373511 316
133 3300026088 Ga0207641_10229665 Ga0207641_102296652 316
134 3300046460 Ga0495638_0000027 Ga0495638_0000027_209140_210102 316
135 3300046460 Ga0495638_0043045 Ga0495638_0043045_691_1668 316
136 3300046471 Ga0495650_0001919 Ga0495650_0001919_15533_16495 316
137 3300046475 Ga0495639_0023220 Ga0495639_0023220_1730_2692 316
138 3300046492 Ga0495585_0027774 Ga0495585_0027774_1584_2561 316
139 3300046501 Ga0495607_0001683 Ga0495607_0001683_85_1050 316
140 3300046506 Ga0495583_0000006 Ga0495583_0000006_341399_342361 316
141 3300046507 Ga0495606_0004315 Ga0495606_0004315_8385_9356 316
142 3300046512 Ga0495610_0002288 Ga0495610_0002288_9038_10015 316
143 3300046512 Ga0495610_0005000 Ga0495610_0005000_3572_4540 316
144 3300046519 Ga0495632_0127401 Ga0495632_0127401_149_1114 316
145 3300046522 Ga0495643_0000082 Ga0495643_0000082_42232_43209 316
146 3300046522 Ga0495643_0039289 Ga0495643_0039289_284_1255 316
147 3300046524 Ga0495648_0000002 Ga0495648_0000002_75206_76168 316
148 3300046524 Ga0495648_0004642 Ga0495648_0004642_1637_2614 316
149 3300046524 Ga0495648_0072137 Ga0495648_0072137_375_1334 316
150 3300046528 Ga0495642_0026271 Ga0495642_0026271_623_1585 316
151 3300046538 Ga0495609_0004741 Ga0495609_0004741_4598_5560 316
152 3300046557 Ga0495622_0000043 Ga0495622_0000043_31965_32927 316
153 3300046558 Ga0495633_0000033 Ga0495633_0000033_144466_145428 316
154 3300046648 Ga0495611_0012014 Ga0495611_0012014_2275_3252 316
155 3300046660 Ga0495625_0000053 Ga0495625_0000053_85257_86219 316
156 3300046660 Ga0495625_0017500 Ga0495625_0017500_4016_4981 316
157 3300046665 Ga0495661_0100546 Ga0495661_0100546_14_991 316
158 3300046694 Ga0495649_0011210 Ga0495649_0011210_3951_4922 316
159 3300046694 Ga0495649_0014200 Ga0495649_0014200_1543_2514 316
160 3300046694 Ga0495649_0060495 Ga0495649_0060495_555_1523 316
161 3300047320 Ga0495672_0000081 Ga0495672_0000081_116065_117042 316
162 3300047320 Ga0495672_0000150 Ga0495672_0000150_96863_97831 316
163 3300047323 Ga0495683_0000360 Ga0495683_0000360_23869_24840 316
164 3300047443 Ga0495687_095979 Ga0495687_095979_65_1033 316
165 3300048091 Ga0495626_0013678 Ga0495626_0013678_2704_3675 316
166 3300048905 Ga0496102_0047776 Ga0496102_0047776_1382_2359 316
167 3300048905 Ga0496102_0172784 Ga0496102_0172784_142_1125 316
168 3300048906 Ga0496103_0017797 Ga0496103_0017797_1399_2382 316
169 3300048909 Ga0496106_0000038 Ga0496106_0000038_74683_75666 316
170 3300048921 Ga0496118_0030352 Ga0496118_0030352_3380_4360 316
171 3300048924 Ga0496121_0001648 Ga0496121_0001648_19870_20943 316
172 3300048924 Ga0496121_0010420 Ga0496121_0010420_2475_3455 316
173 3300048925 Ga0496122_0164187 Ga0496122_0164187_288_1256 316
174 3300048929 Ga0496126_0019195 Ga0496126_0019195_4155_5123 316
175 3300048929 Ga0496126_0192321 Ga0496126_0192321_452_1420 316
176 3300049459 Ga0495678_000074 Ga0495678_000074_82121_83098 316
177 3300049459 Ga0495678_006191 Ga0495678_006191_4303_5265 316
178 3300050495 nmdc:mga04h51_105981_c1 nmdc:mga04h51_105981_c1_55_1020 316
179 3300053092 Ga0500583_0000463 Ga0500583_0000463_5450_6418 316
180 3300053096 Ga0500641_0057642 Ga0500641_0057642_50_1018 316
181 3300053118 Ga0500594_0002956 Ga0500594_0002956_2077_3036 316
182 3300053139 Ga0500568_0052490 Ga0500568_0052490_30_998 316
183 3300053156 Ga0500622_0016630 Ga0500622_0016630_604_1578 316
184 iso_pu_bacteria 2643221653 2644300831 316
185 iso_pu_bacteria 2643221719 2644659053 316
186 3300005262 Ga0065165_1013166 Ga0065165_10131663 317
187 3300005548 Ga0070665_100376906 Ga0070665_1003769062 317
188 3300028379 Ga0268266_10300585 Ga0268266_103005851 317
189 3300046507 Ga0495606_0009048 Ga0495606_0009048_5691_6659 317
190 3300048924 Ga0496121_0125433 Ga0496121_0125433_322_1287 317
191 3300004625 Ga0055543_1006172 Ga0055543_10061723 318
192 3300048929 Ga0496126_0064577 Ga0496126_0064577_1840_2832 319
193 iso_pu_bacteria 2599185248 2599768646 319
194 iso_pu_bacteria 2599185305 2599958393 319
195 iso_pu_bacteria 2904449895 2904454349 319
196 iso_pu_bacteria 2904456579 2904461221 319
197 2162886012 MBSR1b_contig_5301574 MBSR1b_0259.00005210 323
198 3300005288 Ga0065714_10002636 Ga0065714_100026362 323
199 3300005289 Ga0065704_10003665 Ga0065704_100036655 323
200 3300005293 Ga0065715_10093156 Ga0065715_100931567 323
201 3300009011 Ga0105251_10023665 Ga0105251_100236651 323
202 3300013102 Ga0157371_10001607 Ga0157371_1000160714 323
203 3300013306 Ga0163162_10000878 Ga0163162_1000087818 323
204 3300014497 Ga0182008_10025617 Ga0182008_100256173 323
205 3300015265 Ga0182005_1001657 Ga0182005_10016578 323
206 3300017792 Ga0163161_10020329 Ga0163161_100203291 323
207 3300025735 Ga0207713_1011932 Ga0207713_10119324 323
208 3300033179 Ga0307507_10057865 Ga0307507_100578655 323
209 3300041411 Ga0439466_0012290 Ga0439466_0012290_1732_2703 323
210 3300041411 Ga0439466_0056135 Ga0439466_0056135_179_1150 323
211 3300042009 Ga0439451_000768 Ga0439451_000768_2706_3677 323
212 3300042013 Ga0439456_002792 Ga0439456_002792_2362_3333 323
213 3300042146 Ga0450907_000035 Ga0450907_000035_56295_57266 323
214 3300042156 Ga0439446_0000921 Ga0439446_0000921_2701_3672 323
215 3300042185 Ga0450909_001164 Ga0450909_001164_2352_3323 323
216 3300042435 Ga0439434_0000039 Ga0439434_0000039_2546_3517 323
217 3300042993 Ga0439440_0000239 Ga0439440_0000239_2636_3607 323
218 3300046452 Ga0495617_009425 Ga0495617_009425_319_1290 323
219 3300046474 Ga0495605_0005339 Ga0495605_0005339_4245_5216 323
220 3300046474 Ga0495605_0021716 Ga0495605_0021716_2226_3197 323
221 3300046491 Ga0495584_0003646 Ga0495584_0003646_4529_5500 323
222 3300046492 Ga0495585_0001603 Ga0495585_0001603_14449_15420 323
223 3300046492 Ga0495585_0002294 Ga0495585_0002294_10394_11365 323
224 3300046501 Ga0495607_0002107 Ga0495607_0002107_13052_14023 323
225 3300046501 Ga0495607_0002360 Ga0495607_0002360_3713_4684 323
226 3300046501 Ga0495607_0008316 Ga0495607_0008316_4196_5167 323
227 3300046506 Ga0495583_0000415 Ga0495583_0000415_23548_24519 323
228 3300046513 Ga0495616_0011249 Ga0495616_0011249_3638_4609 323
229 3300046523 Ga0495644_0000291 Ga0495644_0000291_8742_9713 323
230 3300046530 Ga0495654_0003432 Ga0495654_0003432_2355_3326 323
231 3300046538 Ga0495609_0000195 Ga0495609_0000195_47026_47997 323
232 3300046615 Ga0495656_0005218 Ga0495656_0005218_3389_4360 323
233 3300046615 Ga0495656_0007349 Ga0495656_0007349_1853_2824 323
234 3300046660 Ga0495625_0009715 Ga0495625_0009715_4629_5600 323
235 3300046660 Ga0495625_0022916 Ga0495625_0022916_3304_4275 323
236 3300046664 Ga0495659_0108808 Ga0495659_0108808_77_1048 323
237 3300046691 Ga0495670_0076803 Ga0495670_0076803_52_1023 323
238 3300046692 Ga0495671_0052532 Ga0495671_0052532_389_1360 323
239 3300047318 Ga0495636_0030673 Ga0495636_0030673_286_1257 323
240 3300047320 Ga0495672_0009715 Ga0495672_0009715_4240_5211 323
241 3300047323 Ga0495683_0005743 Ga0495683_0005743_1892_2863 323
242 3300047443 Ga0495687_004456 Ga0495687_004456_2022_2993 323
243 3300047443 Ga0495687_015434 Ga0495687_015434_393_1364 323
244 3300047447 Ga0495685_000016 Ga0495685_000016_1706_2677 323
245 3300047469 Ga0495673_0000999 Ga0495673_0000999_10903_11874 323
246 3300047469 Ga0495673_0006179 Ga0495673_0006179_3975_4946 323
247 3300047472 Ga0495686_0052387 Ga0495686_0052387_1190_2161 323
248 3300048091 Ga0495626_0001803 Ga0495626_0001803_2422_3393 323
249 3300048905 Ga0496102_0256001 Ga0496102_0256001_164_1135 323
250 3300048925 Ga0496122_0055227 Ga0496122_0055227_1608_2579 323
251 3300049459 Ga0495678_003545 Ga0495678_003545_2483_3454 323
252 3300049460 Ga0495682_0000402 Ga0495682_0000402_19485_20456 323
253 3300049460 Ga0495682_0001421 Ga0495682_0001421_2059_3030 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

259

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

54

269

0.83

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

289

0.82

PF08659

KR

KR domain

53

228

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8881 14 323
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8664 14 323
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.8415 20 278
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.8383 21 278
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.8372 20 278
ID Description Score Start End Superfamily
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 52 323 3.40.50.720
af_Q95QH4_36_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9262 22 215 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9207 52 323 3.40.50.720
af_E9AH88_143_327_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9154 19 190 3.40.50.720
af_F1Q911_35_322_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9152 16 321 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A829PQB5-F1-model_v4 Short chain dehydrogenase family protein 0.9572 19 223 GO:0016491
AF-A0A6I4TQ83-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9567 3 323
AF-A0A7K2YNL0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9526 1 178
AF-A0A7R9MMS4-F1-model_v4 Retinol dehydrogenase 12 0.9518 16 193 GO:0016491
AF-A0A665WFJ7-F1-model_v4 Retinol dehydrogenase 12-like 0.9509 15 203 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map