F364290

General Info

Members Datasets Scaffolds Average Seq Length
253 152 506 174

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0010398|Ga0466963_0010398_3826_4407
Length 187
Sequence VAGREELACIAMRAVELVFAAGWGAFWLYWLVAAFSMKRGRVPWSRELRIRAVILVRLGAFRGHGLHSDPLRAALGLALFGLGLAFAICARIHLGRNWGSPMTEKNEPELVTSGPYHVVRHPIYAGILIAGIGTAVALSWWWLSPVVVAGVYFLYSATVEERYLAEQFPSDYPAYKRTSKMLIPFVL

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 9.09
Rhizosphere 90.12
Stem 0
Stem Tuber 0
Unclassified 17.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0010398 3300044694 Bacteria 5632
2 Ga0070658_10017563 3300005327 Bacteria 5723
3 Ga0070658_10309535 3300005327 Bacteria 1348
4 Ga0070658_10314355 3300005327 Bacteria 1337
5 Ga0070683_100335154 3300005329 Unclassified 1440
6 Ga0070683_101098890 3300005329 Bacteria 764
7 Ga0070682_100059689 3300005337 Unclassified 2410
8 Ga0070660_100024844 3300005339 Bacteria 4450
9 Ga0070660_100436345 3300005339 Bacteria 1085
10 Ga0070661_100277014 3300005344 Unclassified 1300
11 Ga0070659_100059406 3300005366 Unclassified 3019
12 Ga0070709_10042408 3300005434 Bacteria 2810
13 Ga0070714_100022729 3300005435 Bacteria 5145
14 Ga0070714_100023716 3300005435 Bacteria 5045
15 Ga0070714_100234219 3300005435 Archaea 1693
16 Ga0070714_100474143 3300005435 Bacteria 1191
17 Ga0070713_100057891 3300005436 Bacteria 3229
18 Ga0070713_100130268 3300005436 Bacteria 2217
19 Ga0070713_100537888 3300005436 Unclassified 1105
20 Ga0070713_101258488 3300005436 Bacteria 717
21 Ga0070710_10001658 3300005437 Bacteria 10488
22 Ga0070710_10303850 3300005437 Archaea 1042
23 Ga0070711_100025670 3300005439 Bacteria 3856
24 Ga0070708_100302188 3300005445 Bacteria 1507
25 Ga0070678_100637505 3300005456 Unclassified 955
26 Ga0070681_10308591 3300005458 Unclassified 1491
27 Ga0070706_100006387 3300005467 Bacteria 11136
28 Ga0070707_100644559 3300005468 Bacteria 1022
29 Ga0070698_100192735 3300005471 Bacteria 1975
30 Ga0070698_100238188 3300005471 Bacteria 1753
31 Ga0070699_100541798 3300005518 Unclassified 1059
32 Ga0070679_100065164 3300005530 Bacteria 3631
33 Ga0070696_100426861 3300005546 Bacteria 1042
34 Ga0070665_100052338 3300005548 Bacteria 4096
35 Ga0070704_100758948 3300005549 Unclassified 864
36 Ga0068855_100133580 3300005563 Unclassified 2832
37 Ga0068857_100116798 3300005577 Unclassified 2400
38 Ga0068854_100419612 3300005578 Bacteria 1111
39 Ga0068856_100117968 3300005614 Bacteria 2655
40 Ga0068866_10401508 3300005718 Unclassified 884
41 Ga0070717_10312200 3300006028 Bacteria 1399
42 Ga0070717_10510960 3300006028 Bacteria 1086
43 Ga0070717_10641673 3300006028 Bacteria 964
44 Ga0070715_10112124 3300006163 Archaea 1288
45 Ga0070712_100258813 3300006175 Bacteria 1394
46 Ga0070712_100866349 3300006175 Unclassified 777
47 Ga0105240_10263907 3300009093 Unclassified 1986
48 Ga0105243_10427178 3300009148 Unclassified 1237
49 Ga0105242_10105520 3300009176 Bacteria 2393
50 Ga0105242_10305469 3300009176 Bacteria 1454
51 Ga0105237_10052819 3300009545 Bacteria 4078
52 Ga0105238_10288011 3300009551 Unclassified 1624
53 Ga0105239_10256077 3300010375 Unclassified 1966
54 Ga0157370_10044657 3300013104 Bacteria 4256
55 Ga0157369_10226783 3300013105 Unclassified 1954
56 Ga0157374_10057925 3300013296 Bacteria 3619
57 Ga0157378_10161501 3300013297 Bacteria 2096
58 Ga0157378_11077155 3300013297 Bacteria 840
59 Ga0157372_10054353 3300013307 Bacteria 4466
60 Ga0197907_11278959 3300020069 Bacteria 786
61 Ga0206353_10799155 3300020082 Bacteria 1707
62 Ga0213872_10370353 3300021361 Unclassified 585
63 Ga0224712_10397243 3300022467 Bacteria 657
64 Ga0207692_10002158 3300025898 Bacteria 7516
65 Ga0207685_10099613 3300025905 Archaea 1240
66 Ga0207699_10188655 3300025906 Unclassified 1390
67 Ga0207699_10423303 3300025906 Bacteria 951
68 Ga0207705_10157933 3300025909 Bacteria 1702
69 Ga0207684_10005123 3300025910 Bacteria 12205
70 Ga0207707_10945079 3300025912 Bacteria 710
71 Ga0207695_10307126 3300025913 Unclassified 1477
72 Ga0207693_10004494 3300025915 Bacteria 11799
73 Ga0207693_10484583 3300025915 Bacteria 966
74 Ga0207663_10045897 3300025916 Bacteria 2690
75 Ga0207663_10719131 3300025916 Unclassified 792
76 Ga0207657_10000416 3300025919 Bacteria 45222
77 Ga0207657_10043912 3300025919 Bacteria 3933
78 Ga0207649_10048773 3300025920 Bacteria 2612
79 Ga0207646_10701201 3300025922 Bacteria 905
80 Ga0207694_10562908 3300025924 Bacteria 957
81 Ga0207664_10033690 3300025929 Bacteria 3938
82 Ga0207664_10212921 3300025929 Unclassified 1673
83 Ga0207664_11544522 3300025929 Bacteria 586
84 Ga0207690_10164531 3300025932 Bacteria 1656
85 Ga0207686_10124713 3300025934 Unclassified 1758
86 Ga0207709_10637378 3300025935 Bacteria 847
87 Ga0207665_10237752 3300025939 Unclassified 1341
88 Ga0207661_10086462 3300025944 Bacteria 2602
89 Ga0207640_10792749 3300025981 Bacteria 820
90 Ga0207702_10213410 3300026078 Unclassified 1795
91 Ga0207702_10473135 3300026078 Unclassified 1218
92 Ga0207702_10547335 3300026078 Bacteria 1132
93 Ga0207674_10109547 3300026116 Unclassified 2738
94 Ga0207683_10092709 3300026121 Plasmid 2691
95 Ga0268266_10164666 3300028379 Unclassified 2008
96 Ga0265318_10111463 3300028577 Bacteria 1006
97 Ga0265323_10129466 3300028653 Bacteria 818
98 Ga0265338_10024157 3300028800 Bacteria 6220
99 Ga0265338_10103973 3300028800 Bacteria 2305
100 Ga0265340_10142144 3300031247 Bacteria 1097
101 Ga0265339_10109300 3300031249 Bacteria 1432
102 Ga0265331_10020414 3300031250 Bacteria 3401
103 Ga0265327_10011807 3300031251 Bacteria 5970
104 Ga0265316_10079809 3300031344 Bacteria 2510
105 Ga0265313_10083379 3300031595 Bacteria 1447
106 Ga0265314_10006678 3300031711 Bacteria 10137
107 Ga0373934_0058782 3300035086 Bacteria 1530
108 Ga0373944_0151690 3300035089 Unclassified 817
109 Ga0373945_0012489 3300035116 Bacteria 2823
110 Ga0373953_0103733 3300035117 Bacteria 1198
111 Ga0373954_0055128 3300035118 Bacteria 1870
112 Ga0373943_0568819 3300035170 Bacteria 666
113 Ga0373955_0088846 3300035172 Bacteria 1758
114 Ga0373927_0072130 3300035695 Bacteria 2235
115 Ga0373927_0410796 3300035695 Unclassified 893
116 Ga0373933_0024318 3300035724 Bacteria 3467
117 Ga0373933_0118228 3300035724 Bacteria 1658
118 Ga0373933_0196293 3300035724 Unclassified 1290
119 Ga0373947_0060183 3300035725 Bacteria 2305
120 Ga0373947_0278222 3300035725 Bacteria 1112
121 Ga0373937_0002161 3300036401 Bacteria 16471
122 Ga0373937_0061275 3300036401 Plasmid 3458
123 Ga0373937_0081958 3300036401 Bacteria 2984
124 Ga0436364_0429986 3300037853 Bacteria 4583
125 Ga0466969_0247414 3300044656 Bacteria 808
126 Ga0466961_0100082 3300044693 Bacteria 1827
127 Ga0466963_0031597 3300044694 Bacteria 3424
128 Ga0466963_0050495 3300044694 Bacteria 2753
129 Ga0466963_0086817 3300044694 Bacteria 2126
130 Ga0466963_0554564 3300044694 Bacteria 811
131 Ga0466964_0014578 3300044706 Bacteria 2989
132 Ga0466964_0017451 3300044706 Bacteria 2746
133 Ga0466964_0034589 3300044706 Unclassified 2016
134 Ga0466971_0011235 3300044719 Bacteria 3922
135 Ga0466971_0447456 3300044719 Unclassified 633
136 Ga0466957_0025243 3300044842 Bacteria 3521
137 Ga0466957_0130120 3300044842 Bacteria 1612
138 Ga0466957_0323966 3300044842 Bacteria 1040
139 Ga0466959_0647637 3300045049 Bacteria 709
140 Ga0466958_0003295 3300045836 Bacteria 8360
141 Ga0466958_0020913 3300045836 Bacteria 3819
142 Ga0466958_0097820 3300045836 Bacteria 1821
143 Ga0466958_0147543 3300045836 Bacteria 1483
144 Ga0466967_0069549 3300045976 Bacteria 3146
145 Ga0466967_0072544 3300045976 Bacteria 3086
146 Ga0466967_0187689 3300045976 Bacteria 1952
147 Ga0466967_0302370 3300045976 Bacteria 1539
148 Ga0466967_0344858 3300045976 Bacteria 1441
149 Ga0466967_0450650 3300045976 Bacteria 1257
150 Ga0466967_0473458 3300045976 Bacteria 1226
151 Ga0466967_0612097 3300045976 Bacteria 1075
152 Ga0495592_0127402 3300046454 Bacteria 1784
153 Ga0495592_0184858 3300046454 Bacteria 1417
154 Ga0495592_0287656 3300046454 Unclassified 1073
155 Ga0495629_0042280 3300046459 Unclassified 3203
156 Ga0495629_0111336 3300046459 Bacteria 1908
157 Ga0495641_0010889 3300046461 Bacteria 5227
158 Ga0495641_0058705 3300046461 Bacteria 1740
159 Ga0495641_0189013 3300046461 Unclassified 923
160 Ga0495651_0053982 3300046462 Bacteria 3092
161 Ga0495651_0125164 3300046462 Bacteria 1883
162 Ga0495653_0018091 3300046463 Bacteria 5729
163 Ga0495653_0026744 3300046463 Bacteria 4624
164 Ga0495582_0062031 3300046473 Bacteria 2065
165 Ga0495582_0200957 3300046473 Bacteria 1138
166 Ga0495662_0074021 3300046476 Bacteria 1652
167 Ga0495664_0031163 3300046477 Unclassified 3125
168 Ga0495664_0123514 3300046477 Bacteria 1566
169 Ga0495608_0035760 3300046511 Bacteria 3347
170 Ga0495608_0050573 3300046511 Plasmid 2757
171 Ga0495608_0140802 3300046511 Bacteria 1540
172 Ga0495608_0181922 3300046511 Bacteria 1329
173 Ga0495618_0008414 3300046514 Bacteria 6244
174 Ga0495618_0102201 3300046514 Bacteria 1835
175 Ga0495618_0116423 3300046514 Bacteria 1711
176 Ga0495618_0153208 3300046514 Bacteria 1472
177 Ga0495628_0101977 3300046516 Bacteria 2214
178 Ga0495630_0447214 3300046517 Bacteria 990
179 Ga0495652_0037937 3300046529 Bacteria 4177
180 Ga0495652_0067270 3300046529 Bacteria 3004
181 Ga0495640_0012635 3300046533 Bacteria 6444
182 Ga0495640_0067290 3300046533 Bacteria 2413
183 Ga0495640_0089078 3300046533 Bacteria 2039
184 Ga0495586_0009877 3300046535 Bacteria 5082
185 Ga0495586_0014920 3300046535 Bacteria 4129
186 Ga0495587_0053575 3300046536 Bacteria 2378
187 Ga0495645_0172809 3300046543 Bacteria 1486
188 Ga0495667_0045070 3300046559 Plasmid 2921
189 Ga0495667_0261587 3300046559 Bacteria 1100
190 Ga0495667_0561741 3300046559 Unclassified 712
191 Ga0495634_0018613 3300046642 Bacteria 4941
192 Ga0495634_0021594 3300046642 Bacteria 4547
193 Ga0495635_0009327 3300046663 Bacteria 6856
194 Ga0495635_0933444 3300046663 Unclassified 554
195 Ga0495657_0014092 3300046675 Bacteria 5874
196 Ga0495657_0071887 3300046675 Bacteria 2258
197 Ga0495657_0078595 3300046675 Bacteria 2138
198 Ga0495599_0111488 3300046678 Bacteria 1704
199 Ga0495599_0200079 3300046678 Bacteria 1227
200 Ga0495623_0396972 3300046679 Unclassified 743
201 Ga0495646_0032078 3300046680 Bacteria 3270
202 Ga0495658_0241595 3300046683 Bacteria 1134
203 Ga0495613_0061658 3300046689 Bacteria 2745
204 Ga0495624_0021261 3300046690 Bacteria 4306
205 Ga0495624_0145230 3300046690 Bacteria 1452
206 Ga0495600_0133324 3300046809 Bacteria 1614
207 Ga0495600_0569806 3300046809 Bacteria 690
208 Ga0495581_0128085 3300047315 Bacteria 1479
209 Ga0495674_0016425 3300047319 Bacteria 6904
210 Ga0495674_0024067 3300047319 Bacteria 5603
211 Ga0495674_0026138 3300047319 Bacteria 5344
212 Ga0495674_1002231 3300047319 Bacteria 640
213 Ga0495676_0286163 3300047321 Unclassified 1115
214 Ga0495680_0023295 3300047322 Bacteria 5150
215 Ga0495680_0105081 3300047322 Bacteria 2100
216 Ga0495680_0340227 3300047322 Bacteria 1047
217 Ga0495675_0102649 3300047444 Bacteria 1789
218 Ga0495684_0011763 3300047471 Bacteria 6755
219 Ga0495684_0032912 3300047471 Bacteria 3981
220 Ga0495684_0209706 3300047471 Bacteria 1433
221 Ga0495614_0161689 3300048089 Bacteria 1002
222 Ga0496100_0032924 3300048903 Bacteria 3238
223 Ga0496100_0396555 3300048903 Bacteria 1050
224 Ga0496101_0032357 3300048904 Bacteria 3681
225 Ga0496101_0103514 3300048904 Bacteria 2134
226 Ga0496101_0196203 3300048904 Bacteria 1559
227 Ga0496102_0357495 3300048905 Bacteria 1375
228 Ga0496104_0017670 3300048907 Bacteria 6501
229 Ga0496104_0039687 3300048907 Bacteria 4408
230 Ga0496104_0842744 3300048907 Bacteria 822
231 Ga0496105_0483852 3300048908 Bacteria 973
232 Ga0496106_0031568 3300048909 Bacteria 3948
233 Ga0496106_0045959 3300048909 Bacteria 3281
234 Ga0496107_0036481 3300048910 Bacteria 3526
235 Ga0496107_0070286 3300048910 Bacteria 2541
236 Ga0496112_0174863 3300048915 Bacteria 2112
237 Ga0496113_0019368 3300048916 Bacteria 4759
238 Ga0496114_0050971 3300048917 Bacteria 3445
239 Ga0496114_0293615 3300048917 Unclassified 1434
240 Ga0496114_0463558 3300048917 Bacteria 1122
241 Ga0496115_0227230 3300048918 Bacteria 1539
242 Ga0496115_0237464 3300048918 Bacteria 1502
243 Ga0496115_0322832 3300048918 Bacteria 1262
244 Ga0496115_0448723 3300048918 Bacteria 1042
245 Ga0495601_0005996 3300053077 Bacteria 7091
246 Ga0495601_0215789 3300053077 Bacteria 1253
247 Ga0495601_0512517 3300053077 Unclassified 773
248 Ga0495612_0138733 3300053078 Unclassified 1054
249 Ga0495595_0042483 3300053084 Bacteria 2082
250 Ga0495619_0110111 3300053085 Bacteria 1881
251 Ga0495619_0116298 3300053085 Bacteria 1831
252 Ga0500566_0393629 3300053094 Bacteria 622
253 Ga0466962_0111472 3300061719 Bacteria 1317
254 Ga0466963_0010398
255 Ga0070658_10017563
256 Ga0070658_10309535
257 Ga0070658_10314355
258 Ga0070683_100335154
259 Ga0070683_101098890
260 Ga0070682_100059689
261 Ga0070660_100024844
262 Ga0070660_100436345
263 Ga0070661_100277014
264 Ga0070659_100059406
265 Ga0070709_10042408
266 Ga0070714_100022729
267 Ga0070714_100023716
268 Ga0070714_100234219
269 Ga0070714_100474143
270 Ga0070713_100057891
271 Ga0070713_100130268
272 Ga0070713_100537888
273 Ga0070713_101258488
274 Ga0070710_10001658
275 Ga0070710_10303850
276 Ga0070711_100025670
277 Ga0070708_100302188
278 Ga0070678_100637505
279 Ga0070681_10308591
280 Ga0070706_100006387
281 Ga0070707_100644559
282 Ga0070698_100192735
283 Ga0070698_100238188
284 Ga0070699_100541798
285 Ga0070679_100065164
286 Ga0070696_100426861
287 Ga0070665_100052338
288 Ga0070704_100758948
289 Ga0068855_100133580
290 Ga0068857_100116798
291 Ga0068854_100419612
292 Ga0068856_100117968
293 Ga0068866_10401508
294 Ga0070717_10312200
295 Ga0070717_10510960
296 Ga0070717_10641673
297 Ga0070715_10112124
298 Ga0070712_100258813
299 Ga0070712_100866349
300 Ga0105240_10263907
301 Ga0105243_10427178
302 Ga0105242_10105520
303 Ga0105242_10305469
304 Ga0105237_10052819
305 Ga0105238_10288011
306 Ga0105239_10256077
307 Ga0157370_10044657
308 Ga0157369_10226783
309 Ga0157374_10057925
310 Ga0157378_10161501
311 Ga0157378_11077155
312 Ga0157372_10054353
313 Ga0197907_11278959
314 Ga0206353_10799155
315 Ga0213872_10370353
316 Ga0224712_10397243
317 Ga0207692_10002158
318 Ga0207685_10099613
319 Ga0207699_10188655
320 Ga0207699_10423303
321 Ga0207705_10157933
322 Ga0207684_10005123
323 Ga0207707_10945079
324 Ga0207695_10307126
325 Ga0207693_10004494
326 Ga0207693_10484583
327 Ga0207663_10045897
328 Ga0207663_10719131
329 Ga0207657_10000416
330 Ga0207657_10043912
331 Ga0207649_10048773
332 Ga0207646_10701201
333 Ga0207694_10562908
334 Ga0207664_10033690
335 Ga0207664_10212921
336 Ga0207664_11544522
337 Ga0207690_10164531
338 Ga0207686_10124713
339 Ga0207709_10637378
340 Ga0207665_10237752
341 Ga0207661_10086462
342 Ga0207640_10792749
343 Ga0207702_10213410
344 Ga0207702_10473135
345 Ga0207702_10547335
346 Ga0207674_10109547
347 Ga0207683_10092709
348 Ga0268266_10164666
349 Ga0265318_10111463
350 Ga0265323_10129466
351 Ga0265338_10024157
352 Ga0265338_10103973
353 Ga0265340_10142144
354 Ga0265339_10109300
355 Ga0265331_10020414
356 Ga0265327_10011807
357 Ga0265316_10079809
358 Ga0265313_10083379
359 Ga0265314_10006678
360 Ga0373934_0058782
361 Ga0373944_0151690
362 Ga0373945_0012489
363 Ga0373953_0103733
364 Ga0373954_0055128
365 Ga0373943_0568819
366 Ga0373955_0088846
367 Ga0373927_0072130
368 Ga0373927_0410796
369 Ga0373933_0024318
370 Ga0373933_0118228
371 Ga0373933_0196293
372 Ga0373947_0060183
373 Ga0373947_0278222
374 Ga0373937_0002161
375 Ga0373937_0061275
376 Ga0373937_0081958
377 Ga0436364_0429986
378 Ga0466969_0247414
379 Ga0466961_0100082
380 Ga0466963_0031597
381 Ga0466963_0050495
382 Ga0466963_0086817
383 Ga0466963_0554564
384 Ga0466964_0014578
385 Ga0466964_0017451
386 Ga0466964_0034589
387 Ga0466971_0011235
388 Ga0466971_0447456
389 Ga0466957_0025243
390 Ga0466957_0130120
391 Ga0466957_0323966
392 Ga0466959_0647637
393 Ga0466958_0003295
394 Ga0466958_0020913
395 Ga0466958_0097820
396 Ga0466958_0147543
397 Ga0466967_0069549
398 Ga0466967_0072544
399 Ga0466967_0187689
400 Ga0466967_0302370
401 Ga0466967_0344858
402 Ga0466967_0450650
403 Ga0466967_0473458
404 Ga0466967_0612097
405 Ga0495592_0127402
406 Ga0495592_0184858
407 Ga0495592_0287656
408 Ga0495629_0042280
409 Ga0495629_0111336
410 Ga0495641_0010889
411 Ga0495641_0058705
412 Ga0495641_0189013
413 Ga0495651_0053982
414 Ga0495651_0125164
415 Ga0495653_0018091
416 Ga0495653_0026744
417 Ga0495582_0062031
418 Ga0495582_0200957
419 Ga0495662_0074021
420 Ga0495664_0031163
421 Ga0495664_0123514
422 Ga0495608_0035760
423 Ga0495608_0050573
424 Ga0495608_0140802
425 Ga0495608_0181922
426 Ga0495618_0008414
427 Ga0495618_0102201
428 Ga0495618_0116423
429 Ga0495618_0153208
430 Ga0495628_0101977
431 Ga0495630_0447214
432 Ga0495652_0037937
433 Ga0495652_0067270
434 Ga0495640_0012635
435 Ga0495640_0067290
436 Ga0495640_0089078
437 Ga0495586_0009877
438 Ga0495586_0014920
439 Ga0495587_0053575
440 Ga0495645_0172809
441 Ga0495667_0045070
442 Ga0495667_0261587
443 Ga0495667_0561741
444 Ga0495634_0018613
445 Ga0495634_0021594
446 Ga0495635_0009327
447 Ga0495635_0933444
448 Ga0495657_0014092
449 Ga0495657_0071887
450 Ga0495657_0078595
451 Ga0495599_0111488
452 Ga0495599_0200079
453 Ga0495623_0396972
454 Ga0495646_0032078
455 Ga0495658_0241595
456 Ga0495613_0061658
457 Ga0495624_0021261
458 Ga0495624_0145230
459 Ga0495600_0133324
460 Ga0495600_0569806
461 Ga0495581_0128085
462 Ga0495674_0016425
463 Ga0495674_0024067
464 Ga0495674_0026138
465 Ga0495674_1002231
466 Ga0495676_0286163
467 Ga0495680_0023295
468 Ga0495680_0105081
469 Ga0495680_0340227
470 Ga0495675_0102649
471 Ga0495684_0011763
472 Ga0495684_0032912
473 Ga0495684_0209706
474 Ga0495614_0161689
475 Ga0496100_0032924
476 Ga0496100_0396555
477 Ga0496101_0032357
478 Ga0496101_0103514
479 Ga0496101_0196203
480 Ga0496102_0357495
481 Ga0496104_0017670
482 Ga0496104_0039687
483 Ga0496104_0842744
484 Ga0496105_0483852
485 Ga0496106_0031568
486 Ga0496106_0045959
487 Ga0496107_0036481
488 Ga0496107_0070286
489 Ga0496112_0174863
490 Ga0496113_0019368
491 Ga0496114_0050971
492 Ga0496114_0293615
493 Ga0496114_0463558
494 Ga0496115_0227230
495 Ga0496115_0237464
496 Ga0496115_0322832
497 Ga0496115_0448723
498 Ga0495601_0005996
499 Ga0495601_0215789
500 Ga0495601_0512517
501 Ga0495612_0138733
502 Ga0495595_0042483
503 Ga0495619_0110111
504 Ga0495619_0116298
505 Ga0500566_0393629
506 Ga0466962_0111472

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

71

171

0.88

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

74

166

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.6362 27 182
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.628 30 181
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.6165 3 181
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.6045 3 181
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.594 2 182
ID Description Score Start End Superfamily
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7976 63 179 1.20.120.1630
af_Q55C17_128_299_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7171 7 180 1.20.120.1630
af_Q55C17_128_299_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.71 7 180 1.20.120.1630
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7067 4 176 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.699 63 179 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A563DX71-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8906 1 172 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-T1B5Y5-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase (EC 2.1.1.100) 0.848 73 182 GO:0004671
GO:0016020
GO:0032259
AF-A0A531LUH1-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8447 73 182 GO:0004671
GO:0016020
GO:0032259
AF-A0A563DX71-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8401 1 172 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A7W7QY80-F1-model_v4 Protein-S-isoprenylcysteine O-methyltransferase Ste14 0.8356 1 182 GO:0008168
GO:0012505
GO:0016020
GO:0032259

Map