F364290
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 152 | 506 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0010398|Ga0466963_0010398_3826_4407 |
| Length | 187 |
| Sequence | VAGREELACIAMRAVELVFAAGWGAFWLYWLVAAFSMKRGRVPWSRELRIRAVILVRLGAFRGHGLHSDPLRAALGLALFGLGLAFAICARIHLGRNWGSPMTEKNEPELVTSGPYHVVRHPIYAGILIAGIGTAVALSWWWLSPVVVAGVYFLYSATVEERYLAEQFPSDYPAYKRTSKMLIPFVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 46 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 72 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 73 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 75 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 82 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 83 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 85 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 87 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 89 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 90 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 91 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 93 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 94 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 95 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 96 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 99 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 100 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 101 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 152 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 1.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 9.09 |
| Rhizosphere | 90.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0010398 | 3300044694 | Bacteria | 5632 |
| 2 | Ga0070658_10017563 | 3300005327 | Bacteria | 5723 |
| 3 | Ga0070658_10309535 | 3300005327 | Bacteria | 1348 |
| 4 | Ga0070658_10314355 | 3300005327 | Bacteria | 1337 |
| 5 | Ga0070683_100335154 | 3300005329 | Unclassified | 1440 |
| 6 | Ga0070683_101098890 | 3300005329 | Bacteria | 764 |
| 7 | Ga0070682_100059689 | 3300005337 | Unclassified | 2410 |
| 8 | Ga0070660_100024844 | 3300005339 | Bacteria | 4450 |
| 9 | Ga0070660_100436345 | 3300005339 | Bacteria | 1085 |
| 10 | Ga0070661_100277014 | 3300005344 | Unclassified | 1300 |
| 11 | Ga0070659_100059406 | 3300005366 | Unclassified | 3019 |
| 12 | Ga0070709_10042408 | 3300005434 | Bacteria | 2810 |
| 13 | Ga0070714_100022729 | 3300005435 | Bacteria | 5145 |
| 14 | Ga0070714_100023716 | 3300005435 | Bacteria | 5045 |
| 15 | Ga0070714_100234219 | 3300005435 | Archaea | 1693 |
| 16 | Ga0070714_100474143 | 3300005435 | Bacteria | 1191 |
| 17 | Ga0070713_100057891 | 3300005436 | Bacteria | 3229 |
| 18 | Ga0070713_100130268 | 3300005436 | Bacteria | 2217 |
| 19 | Ga0070713_100537888 | 3300005436 | Unclassified | 1105 |
| 20 | Ga0070713_101258488 | 3300005436 | Bacteria | 717 |
| 21 | Ga0070710_10001658 | 3300005437 | Bacteria | 10488 |
| 22 | Ga0070710_10303850 | 3300005437 | Archaea | 1042 |
| 23 | Ga0070711_100025670 | 3300005439 | Bacteria | 3856 |
| 24 | Ga0070708_100302188 | 3300005445 | Bacteria | 1507 |
| 25 | Ga0070678_100637505 | 3300005456 | Unclassified | 955 |
| 26 | Ga0070681_10308591 | 3300005458 | Unclassified | 1491 |
| 27 | Ga0070706_100006387 | 3300005467 | Bacteria | 11136 |
| 28 | Ga0070707_100644559 | 3300005468 | Bacteria | 1022 |
| 29 | Ga0070698_100192735 | 3300005471 | Bacteria | 1975 |
| 30 | Ga0070698_100238188 | 3300005471 | Bacteria | 1753 |
| 31 | Ga0070699_100541798 | 3300005518 | Unclassified | 1059 |
| 32 | Ga0070679_100065164 | 3300005530 | Bacteria | 3631 |
| 33 | Ga0070696_100426861 | 3300005546 | Bacteria | 1042 |
| 34 | Ga0070665_100052338 | 3300005548 | Bacteria | 4096 |
| 35 | Ga0070704_100758948 | 3300005549 | Unclassified | 864 |
| 36 | Ga0068855_100133580 | 3300005563 | Unclassified | 2832 |
| 37 | Ga0068857_100116798 | 3300005577 | Unclassified | 2400 |
| 38 | Ga0068854_100419612 | 3300005578 | Bacteria | 1111 |
| 39 | Ga0068856_100117968 | 3300005614 | Bacteria | 2655 |
| 40 | Ga0068866_10401508 | 3300005718 | Unclassified | 884 |
| 41 | Ga0070717_10312200 | 3300006028 | Bacteria | 1399 |
| 42 | Ga0070717_10510960 | 3300006028 | Bacteria | 1086 |
| 43 | Ga0070717_10641673 | 3300006028 | Bacteria | 964 |
| 44 | Ga0070715_10112124 | 3300006163 | Archaea | 1288 |
| 45 | Ga0070712_100258813 | 3300006175 | Bacteria | 1394 |
| 46 | Ga0070712_100866349 | 3300006175 | Unclassified | 777 |
| 47 | Ga0105240_10263907 | 3300009093 | Unclassified | 1986 |
| 48 | Ga0105243_10427178 | 3300009148 | Unclassified | 1237 |
| 49 | Ga0105242_10105520 | 3300009176 | Bacteria | 2393 |
| 50 | Ga0105242_10305469 | 3300009176 | Bacteria | 1454 |
| 51 | Ga0105237_10052819 | 3300009545 | Bacteria | 4078 |
| 52 | Ga0105238_10288011 | 3300009551 | Unclassified | 1624 |
| 53 | Ga0105239_10256077 | 3300010375 | Unclassified | 1966 |
| 54 | Ga0157370_10044657 | 3300013104 | Bacteria | 4256 |
| 55 | Ga0157369_10226783 | 3300013105 | Unclassified | 1954 |
| 56 | Ga0157374_10057925 | 3300013296 | Bacteria | 3619 |
| 57 | Ga0157378_10161501 | 3300013297 | Bacteria | 2096 |
| 58 | Ga0157378_11077155 | 3300013297 | Bacteria | 840 |
| 59 | Ga0157372_10054353 | 3300013307 | Bacteria | 4466 |
| 60 | Ga0197907_11278959 | 3300020069 | Bacteria | 786 |
| 61 | Ga0206353_10799155 | 3300020082 | Bacteria | 1707 |
| 62 | Ga0213872_10370353 | 3300021361 | Unclassified | 585 |
| 63 | Ga0224712_10397243 | 3300022467 | Bacteria | 657 |
| 64 | Ga0207692_10002158 | 3300025898 | Bacteria | 7516 |
| 65 | Ga0207685_10099613 | 3300025905 | Archaea | 1240 |
| 66 | Ga0207699_10188655 | 3300025906 | Unclassified | 1390 |
| 67 | Ga0207699_10423303 | 3300025906 | Bacteria | 951 |
| 68 | Ga0207705_10157933 | 3300025909 | Bacteria | 1702 |
| 69 | Ga0207684_10005123 | 3300025910 | Bacteria | 12205 |
| 70 | Ga0207707_10945079 | 3300025912 | Bacteria | 710 |
| 71 | Ga0207695_10307126 | 3300025913 | Unclassified | 1477 |
| 72 | Ga0207693_10004494 | 3300025915 | Bacteria | 11799 |
| 73 | Ga0207693_10484583 | 3300025915 | Bacteria | 966 |
| 74 | Ga0207663_10045897 | 3300025916 | Bacteria | 2690 |
| 75 | Ga0207663_10719131 | 3300025916 | Unclassified | 792 |
| 76 | Ga0207657_10000416 | 3300025919 | Bacteria | 45222 |
| 77 | Ga0207657_10043912 | 3300025919 | Bacteria | 3933 |
| 78 | Ga0207649_10048773 | 3300025920 | Bacteria | 2612 |
| 79 | Ga0207646_10701201 | 3300025922 | Bacteria | 905 |
| 80 | Ga0207694_10562908 | 3300025924 | Bacteria | 957 |
| 81 | Ga0207664_10033690 | 3300025929 | Bacteria | 3938 |
| 82 | Ga0207664_10212921 | 3300025929 | Unclassified | 1673 |
| 83 | Ga0207664_11544522 | 3300025929 | Bacteria | 586 |
| 84 | Ga0207690_10164531 | 3300025932 | Bacteria | 1656 |
| 85 | Ga0207686_10124713 | 3300025934 | Unclassified | 1758 |
| 86 | Ga0207709_10637378 | 3300025935 | Bacteria | 847 |
| 87 | Ga0207665_10237752 | 3300025939 | Unclassified | 1341 |
| 88 | Ga0207661_10086462 | 3300025944 | Bacteria | 2602 |
| 89 | Ga0207640_10792749 | 3300025981 | Bacteria | 820 |
| 90 | Ga0207702_10213410 | 3300026078 | Unclassified | 1795 |
| 91 | Ga0207702_10473135 | 3300026078 | Unclassified | 1218 |
| 92 | Ga0207702_10547335 | 3300026078 | Bacteria | 1132 |
| 93 | Ga0207674_10109547 | 3300026116 | Unclassified | 2738 |
| 94 | Ga0207683_10092709 | 3300026121 | Plasmid | 2691 |
| 95 | Ga0268266_10164666 | 3300028379 | Unclassified | 2008 |
| 96 | Ga0265318_10111463 | 3300028577 | Bacteria | 1006 |
| 97 | Ga0265323_10129466 | 3300028653 | Bacteria | 818 |
| 98 | Ga0265338_10024157 | 3300028800 | Bacteria | 6220 |
| 99 | Ga0265338_10103973 | 3300028800 | Bacteria | 2305 |
| 100 | Ga0265340_10142144 | 3300031247 | Bacteria | 1097 |
| 101 | Ga0265339_10109300 | 3300031249 | Bacteria | 1432 |
| 102 | Ga0265331_10020414 | 3300031250 | Bacteria | 3401 |
| 103 | Ga0265327_10011807 | 3300031251 | Bacteria | 5970 |
| 104 | Ga0265316_10079809 | 3300031344 | Bacteria | 2510 |
| 105 | Ga0265313_10083379 | 3300031595 | Bacteria | 1447 |
| 106 | Ga0265314_10006678 | 3300031711 | Bacteria | 10137 |
| 107 | Ga0373934_0058782 | 3300035086 | Bacteria | 1530 |
| 108 | Ga0373944_0151690 | 3300035089 | Unclassified | 817 |
| 109 | Ga0373945_0012489 | 3300035116 | Bacteria | 2823 |
| 110 | Ga0373953_0103733 | 3300035117 | Bacteria | 1198 |
| 111 | Ga0373954_0055128 | 3300035118 | Bacteria | 1870 |
| 112 | Ga0373943_0568819 | 3300035170 | Bacteria | 666 |
| 113 | Ga0373955_0088846 | 3300035172 | Bacteria | 1758 |
| 114 | Ga0373927_0072130 | 3300035695 | Bacteria | 2235 |
| 115 | Ga0373927_0410796 | 3300035695 | Unclassified | 893 |
| 116 | Ga0373933_0024318 | 3300035724 | Bacteria | 3467 |
| 117 | Ga0373933_0118228 | 3300035724 | Bacteria | 1658 |
| 118 | Ga0373933_0196293 | 3300035724 | Unclassified | 1290 |
| 119 | Ga0373947_0060183 | 3300035725 | Bacteria | 2305 |
| 120 | Ga0373947_0278222 | 3300035725 | Bacteria | 1112 |
| 121 | Ga0373937_0002161 | 3300036401 | Bacteria | 16471 |
| 122 | Ga0373937_0061275 | 3300036401 | Plasmid | 3458 |
| 123 | Ga0373937_0081958 | 3300036401 | Bacteria | 2984 |
| 124 | Ga0436364_0429986 | 3300037853 | Bacteria | 4583 |
| 125 | Ga0466969_0247414 | 3300044656 | Bacteria | 808 |
| 126 | Ga0466961_0100082 | 3300044693 | Bacteria | 1827 |
| 127 | Ga0466963_0031597 | 3300044694 | Bacteria | 3424 |
| 128 | Ga0466963_0050495 | 3300044694 | Bacteria | 2753 |
| 129 | Ga0466963_0086817 | 3300044694 | Bacteria | 2126 |
| 130 | Ga0466963_0554564 | 3300044694 | Bacteria | 811 |
| 131 | Ga0466964_0014578 | 3300044706 | Bacteria | 2989 |
| 132 | Ga0466964_0017451 | 3300044706 | Bacteria | 2746 |
| 133 | Ga0466964_0034589 | 3300044706 | Unclassified | 2016 |
| 134 | Ga0466971_0011235 | 3300044719 | Bacteria | 3922 |
| 135 | Ga0466971_0447456 | 3300044719 | Unclassified | 633 |
| 136 | Ga0466957_0025243 | 3300044842 | Bacteria | 3521 |
| 137 | Ga0466957_0130120 | 3300044842 | Bacteria | 1612 |
| 138 | Ga0466957_0323966 | 3300044842 | Bacteria | 1040 |
| 139 | Ga0466959_0647637 | 3300045049 | Bacteria | 709 |
| 140 | Ga0466958_0003295 | 3300045836 | Bacteria | 8360 |
| 141 | Ga0466958_0020913 | 3300045836 | Bacteria | 3819 |
| 142 | Ga0466958_0097820 | 3300045836 | Bacteria | 1821 |
| 143 | Ga0466958_0147543 | 3300045836 | Bacteria | 1483 |
| 144 | Ga0466967_0069549 | 3300045976 | Bacteria | 3146 |
| 145 | Ga0466967_0072544 | 3300045976 | Bacteria | 3086 |
| 146 | Ga0466967_0187689 | 3300045976 | Bacteria | 1952 |
| 147 | Ga0466967_0302370 | 3300045976 | Bacteria | 1539 |
| 148 | Ga0466967_0344858 | 3300045976 | Bacteria | 1441 |
| 149 | Ga0466967_0450650 | 3300045976 | Bacteria | 1257 |
| 150 | Ga0466967_0473458 | 3300045976 | Bacteria | 1226 |
| 151 | Ga0466967_0612097 | 3300045976 | Bacteria | 1075 |
| 152 | Ga0495592_0127402 | 3300046454 | Bacteria | 1784 |
| 153 | Ga0495592_0184858 | 3300046454 | Bacteria | 1417 |
| 154 | Ga0495592_0287656 | 3300046454 | Unclassified | 1073 |
| 155 | Ga0495629_0042280 | 3300046459 | Unclassified | 3203 |
| 156 | Ga0495629_0111336 | 3300046459 | Bacteria | 1908 |
| 157 | Ga0495641_0010889 | 3300046461 | Bacteria | 5227 |
| 158 | Ga0495641_0058705 | 3300046461 | Bacteria | 1740 |
| 159 | Ga0495641_0189013 | 3300046461 | Unclassified | 923 |
| 160 | Ga0495651_0053982 | 3300046462 | Bacteria | 3092 |
| 161 | Ga0495651_0125164 | 3300046462 | Bacteria | 1883 |
| 162 | Ga0495653_0018091 | 3300046463 | Bacteria | 5729 |
| 163 | Ga0495653_0026744 | 3300046463 | Bacteria | 4624 |
| 164 | Ga0495582_0062031 | 3300046473 | Bacteria | 2065 |
| 165 | Ga0495582_0200957 | 3300046473 | Bacteria | 1138 |
| 166 | Ga0495662_0074021 | 3300046476 | Bacteria | 1652 |
| 167 | Ga0495664_0031163 | 3300046477 | Unclassified | 3125 |
| 168 | Ga0495664_0123514 | 3300046477 | Bacteria | 1566 |
| 169 | Ga0495608_0035760 | 3300046511 | Bacteria | 3347 |
| 170 | Ga0495608_0050573 | 3300046511 | Plasmid | 2757 |
| 171 | Ga0495608_0140802 | 3300046511 | Bacteria | 1540 |
| 172 | Ga0495608_0181922 | 3300046511 | Bacteria | 1329 |
| 173 | Ga0495618_0008414 | 3300046514 | Bacteria | 6244 |
| 174 | Ga0495618_0102201 | 3300046514 | Bacteria | 1835 |
| 175 | Ga0495618_0116423 | 3300046514 | Bacteria | 1711 |
| 176 | Ga0495618_0153208 | 3300046514 | Bacteria | 1472 |
| 177 | Ga0495628_0101977 | 3300046516 | Bacteria | 2214 |
| 178 | Ga0495630_0447214 | 3300046517 | Bacteria | 990 |
| 179 | Ga0495652_0037937 | 3300046529 | Bacteria | 4177 |
| 180 | Ga0495652_0067270 | 3300046529 | Bacteria | 3004 |
| 181 | Ga0495640_0012635 | 3300046533 | Bacteria | 6444 |
| 182 | Ga0495640_0067290 | 3300046533 | Bacteria | 2413 |
| 183 | Ga0495640_0089078 | 3300046533 | Bacteria | 2039 |
| 184 | Ga0495586_0009877 | 3300046535 | Bacteria | 5082 |
| 185 | Ga0495586_0014920 | 3300046535 | Bacteria | 4129 |
| 186 | Ga0495587_0053575 | 3300046536 | Bacteria | 2378 |
| 187 | Ga0495645_0172809 | 3300046543 | Bacteria | 1486 |
| 188 | Ga0495667_0045070 | 3300046559 | Plasmid | 2921 |
| 189 | Ga0495667_0261587 | 3300046559 | Bacteria | 1100 |
| 190 | Ga0495667_0561741 | 3300046559 | Unclassified | 712 |
| 191 | Ga0495634_0018613 | 3300046642 | Bacteria | 4941 |
| 192 | Ga0495634_0021594 | 3300046642 | Bacteria | 4547 |
| 193 | Ga0495635_0009327 | 3300046663 | Bacteria | 6856 |
| 194 | Ga0495635_0933444 | 3300046663 | Unclassified | 554 |
| 195 | Ga0495657_0014092 | 3300046675 | Bacteria | 5874 |
| 196 | Ga0495657_0071887 | 3300046675 | Bacteria | 2258 |
| 197 | Ga0495657_0078595 | 3300046675 | Bacteria | 2138 |
| 198 | Ga0495599_0111488 | 3300046678 | Bacteria | 1704 |
| 199 | Ga0495599_0200079 | 3300046678 | Bacteria | 1227 |
| 200 | Ga0495623_0396972 | 3300046679 | Unclassified | 743 |
| 201 | Ga0495646_0032078 | 3300046680 | Bacteria | 3270 |
| 202 | Ga0495658_0241595 | 3300046683 | Bacteria | 1134 |
| 203 | Ga0495613_0061658 | 3300046689 | Bacteria | 2745 |
| 204 | Ga0495624_0021261 | 3300046690 | Bacteria | 4306 |
| 205 | Ga0495624_0145230 | 3300046690 | Bacteria | 1452 |
| 206 | Ga0495600_0133324 | 3300046809 | Bacteria | 1614 |
| 207 | Ga0495600_0569806 | 3300046809 | Bacteria | 690 |
| 208 | Ga0495581_0128085 | 3300047315 | Bacteria | 1479 |
| 209 | Ga0495674_0016425 | 3300047319 | Bacteria | 6904 |
| 210 | Ga0495674_0024067 | 3300047319 | Bacteria | 5603 |
| 211 | Ga0495674_0026138 | 3300047319 | Bacteria | 5344 |
| 212 | Ga0495674_1002231 | 3300047319 | Bacteria | 640 |
| 213 | Ga0495676_0286163 | 3300047321 | Unclassified | 1115 |
| 214 | Ga0495680_0023295 | 3300047322 | Bacteria | 5150 |
| 215 | Ga0495680_0105081 | 3300047322 | Bacteria | 2100 |
| 216 | Ga0495680_0340227 | 3300047322 | Bacteria | 1047 |
| 217 | Ga0495675_0102649 | 3300047444 | Bacteria | 1789 |
| 218 | Ga0495684_0011763 | 3300047471 | Bacteria | 6755 |
| 219 | Ga0495684_0032912 | 3300047471 | Bacteria | 3981 |
| 220 | Ga0495684_0209706 | 3300047471 | Bacteria | 1433 |
| 221 | Ga0495614_0161689 | 3300048089 | Bacteria | 1002 |
| 222 | Ga0496100_0032924 | 3300048903 | Bacteria | 3238 |
| 223 | Ga0496100_0396555 | 3300048903 | Bacteria | 1050 |
| 224 | Ga0496101_0032357 | 3300048904 | Bacteria | 3681 |
| 225 | Ga0496101_0103514 | 3300048904 | Bacteria | 2134 |
| 226 | Ga0496101_0196203 | 3300048904 | Bacteria | 1559 |
| 227 | Ga0496102_0357495 | 3300048905 | Bacteria | 1375 |
| 228 | Ga0496104_0017670 | 3300048907 | Bacteria | 6501 |
| 229 | Ga0496104_0039687 | 3300048907 | Bacteria | 4408 |
| 230 | Ga0496104_0842744 | 3300048907 | Bacteria | 822 |
| 231 | Ga0496105_0483852 | 3300048908 | Bacteria | 973 |
| 232 | Ga0496106_0031568 | 3300048909 | Bacteria | 3948 |
| 233 | Ga0496106_0045959 | 3300048909 | Bacteria | 3281 |
| 234 | Ga0496107_0036481 | 3300048910 | Bacteria | 3526 |
| 235 | Ga0496107_0070286 | 3300048910 | Bacteria | 2541 |
| 236 | Ga0496112_0174863 | 3300048915 | Bacteria | 2112 |
| 237 | Ga0496113_0019368 | 3300048916 | Bacteria | 4759 |
| 238 | Ga0496114_0050971 | 3300048917 | Bacteria | 3445 |
| 239 | Ga0496114_0293615 | 3300048917 | Unclassified | 1434 |
| 240 | Ga0496114_0463558 | 3300048917 | Bacteria | 1122 |
| 241 | Ga0496115_0227230 | 3300048918 | Bacteria | 1539 |
| 242 | Ga0496115_0237464 | 3300048918 | Bacteria | 1502 |
| 243 | Ga0496115_0322832 | 3300048918 | Bacteria | 1262 |
| 244 | Ga0496115_0448723 | 3300048918 | Bacteria | 1042 |
| 245 | Ga0495601_0005996 | 3300053077 | Bacteria | 7091 |
| 246 | Ga0495601_0215789 | 3300053077 | Bacteria | 1253 |
| 247 | Ga0495601_0512517 | 3300053077 | Unclassified | 773 |
| 248 | Ga0495612_0138733 | 3300053078 | Unclassified | 1054 |
| 249 | Ga0495595_0042483 | 3300053084 | Bacteria | 2082 |
| 250 | Ga0495619_0110111 | 3300053085 | Bacteria | 1881 |
| 251 | Ga0495619_0116298 | 3300053085 | Bacteria | 1831 |
| 252 | Ga0500566_0393629 | 3300053094 | Bacteria | 622 |
| 253 | Ga0466962_0111472 | 3300061719 | Bacteria | 1317 |
| 254 | Ga0466963_0010398 | |||
| 255 | Ga0070658_10017563 | |||
| 256 | Ga0070658_10309535 | |||
| 257 | Ga0070658_10314355 | |||
| 258 | Ga0070683_100335154 | |||
| 259 | Ga0070683_101098890 | |||
| 260 | Ga0070682_100059689 | |||
| 261 | Ga0070660_100024844 | |||
| 262 | Ga0070660_100436345 | |||
| 263 | Ga0070661_100277014 | |||
| 264 | Ga0070659_100059406 | |||
| 265 | Ga0070709_10042408 | |||
| 266 | Ga0070714_100022729 | |||
| 267 | Ga0070714_100023716 | |||
| 268 | Ga0070714_100234219 | |||
| 269 | Ga0070714_100474143 | |||
| 270 | Ga0070713_100057891 | |||
| 271 | Ga0070713_100130268 | |||
| 272 | Ga0070713_100537888 | |||
| 273 | Ga0070713_101258488 | |||
| 274 | Ga0070710_10001658 | |||
| 275 | Ga0070710_10303850 | |||
| 276 | Ga0070711_100025670 | |||
| 277 | Ga0070708_100302188 | |||
| 278 | Ga0070678_100637505 | |||
| 279 | Ga0070681_10308591 | |||
| 280 | Ga0070706_100006387 | |||
| 281 | Ga0070707_100644559 | |||
| 282 | Ga0070698_100192735 | |||
| 283 | Ga0070698_100238188 | |||
| 284 | Ga0070699_100541798 | |||
| 285 | Ga0070679_100065164 | |||
| 286 | Ga0070696_100426861 | |||
| 287 | Ga0070665_100052338 | |||
| 288 | Ga0070704_100758948 | |||
| 289 | Ga0068855_100133580 | |||
| 290 | Ga0068857_100116798 | |||
| 291 | Ga0068854_100419612 | |||
| 292 | Ga0068856_100117968 | |||
| 293 | Ga0068866_10401508 | |||
| 294 | Ga0070717_10312200 | |||
| 295 | Ga0070717_10510960 | |||
| 296 | Ga0070717_10641673 | |||
| 297 | Ga0070715_10112124 | |||
| 298 | Ga0070712_100258813 | |||
| 299 | Ga0070712_100866349 | |||
| 300 | Ga0105240_10263907 | |||
| 301 | Ga0105243_10427178 | |||
| 302 | Ga0105242_10105520 | |||
| 303 | Ga0105242_10305469 | |||
| 304 | Ga0105237_10052819 | |||
| 305 | Ga0105238_10288011 | |||
| 306 | Ga0105239_10256077 | |||
| 307 | Ga0157370_10044657 | |||
| 308 | Ga0157369_10226783 | |||
| 309 | Ga0157374_10057925 | |||
| 310 | Ga0157378_10161501 | |||
| 311 | Ga0157378_11077155 | |||
| 312 | Ga0157372_10054353 | |||
| 313 | Ga0197907_11278959 | |||
| 314 | Ga0206353_10799155 | |||
| 315 | Ga0213872_10370353 | |||
| 316 | Ga0224712_10397243 | |||
| 317 | Ga0207692_10002158 | |||
| 318 | Ga0207685_10099613 | |||
| 319 | Ga0207699_10188655 | |||
| 320 | Ga0207699_10423303 | |||
| 321 | Ga0207705_10157933 | |||
| 322 | Ga0207684_10005123 | |||
| 323 | Ga0207707_10945079 | |||
| 324 | Ga0207695_10307126 | |||
| 325 | Ga0207693_10004494 | |||
| 326 | Ga0207693_10484583 | |||
| 327 | Ga0207663_10045897 | |||
| 328 | Ga0207663_10719131 | |||
| 329 | Ga0207657_10000416 | |||
| 330 | Ga0207657_10043912 | |||
| 331 | Ga0207649_10048773 | |||
| 332 | Ga0207646_10701201 | |||
| 333 | Ga0207694_10562908 | |||
| 334 | Ga0207664_10033690 | |||
| 335 | Ga0207664_10212921 | |||
| 336 | Ga0207664_11544522 | |||
| 337 | Ga0207690_10164531 | |||
| 338 | Ga0207686_10124713 | |||
| 339 | Ga0207709_10637378 | |||
| 340 | Ga0207665_10237752 | |||
| 341 | Ga0207661_10086462 | |||
| 342 | Ga0207640_10792749 | |||
| 343 | Ga0207702_10213410 | |||
| 344 | Ga0207702_10473135 | |||
| 345 | Ga0207702_10547335 | |||
| 346 | Ga0207674_10109547 | |||
| 347 | Ga0207683_10092709 | |||
| 348 | Ga0268266_10164666 | |||
| 349 | Ga0265318_10111463 | |||
| 350 | Ga0265323_10129466 | |||
| 351 | Ga0265338_10024157 | |||
| 352 | Ga0265338_10103973 | |||
| 353 | Ga0265340_10142144 | |||
| 354 | Ga0265339_10109300 | |||
| 355 | Ga0265331_10020414 | |||
| 356 | Ga0265327_10011807 | |||
| 357 | Ga0265316_10079809 | |||
| 358 | Ga0265313_10083379 | |||
| 359 | Ga0265314_10006678 | |||
| 360 | Ga0373934_0058782 | |||
| 361 | Ga0373944_0151690 | |||
| 362 | Ga0373945_0012489 | |||
| 363 | Ga0373953_0103733 | |||
| 364 | Ga0373954_0055128 | |||
| 365 | Ga0373943_0568819 | |||
| 366 | Ga0373955_0088846 | |||
| 367 | Ga0373927_0072130 | |||
| 368 | Ga0373927_0410796 | |||
| 369 | Ga0373933_0024318 | |||
| 370 | Ga0373933_0118228 | |||
| 371 | Ga0373933_0196293 | |||
| 372 | Ga0373947_0060183 | |||
| 373 | Ga0373947_0278222 | |||
| 374 | Ga0373937_0002161 | |||
| 375 | Ga0373937_0061275 | |||
| 376 | Ga0373937_0081958 | |||
| 377 | Ga0436364_0429986 | |||
| 378 | Ga0466969_0247414 | |||
| 379 | Ga0466961_0100082 | |||
| 380 | Ga0466963_0031597 | |||
| 381 | Ga0466963_0050495 | |||
| 382 | Ga0466963_0086817 | |||
| 383 | Ga0466963_0554564 | |||
| 384 | Ga0466964_0014578 | |||
| 385 | Ga0466964_0017451 | |||
| 386 | Ga0466964_0034589 | |||
| 387 | Ga0466971_0011235 | |||
| 388 | Ga0466971_0447456 | |||
| 389 | Ga0466957_0025243 | |||
| 390 | Ga0466957_0130120 | |||
| 391 | Ga0466957_0323966 | |||
| 392 | Ga0466959_0647637 | |||
| 393 | Ga0466958_0003295 | |||
| 394 | Ga0466958_0020913 | |||
| 395 | Ga0466958_0097820 | |||
| 396 | Ga0466958_0147543 | |||
| 397 | Ga0466967_0069549 | |||
| 398 | Ga0466967_0072544 | |||
| 399 | Ga0466967_0187689 | |||
| 400 | Ga0466967_0302370 | |||
| 401 | Ga0466967_0344858 | |||
| 402 | Ga0466967_0450650 | |||
| 403 | Ga0466967_0473458 | |||
| 404 | Ga0466967_0612097 | |||
| 405 | Ga0495592_0127402 | |||
| 406 | Ga0495592_0184858 | |||
| 407 | Ga0495592_0287656 | |||
| 408 | Ga0495629_0042280 | |||
| 409 | Ga0495629_0111336 | |||
| 410 | Ga0495641_0010889 | |||
| 411 | Ga0495641_0058705 | |||
| 412 | Ga0495641_0189013 | |||
| 413 | Ga0495651_0053982 | |||
| 414 | Ga0495651_0125164 | |||
| 415 | Ga0495653_0018091 | |||
| 416 | Ga0495653_0026744 | |||
| 417 | Ga0495582_0062031 | |||
| 418 | Ga0495582_0200957 | |||
| 419 | Ga0495662_0074021 | |||
| 420 | Ga0495664_0031163 | |||
| 421 | Ga0495664_0123514 | |||
| 422 | Ga0495608_0035760 | |||
| 423 | Ga0495608_0050573 | |||
| 424 | Ga0495608_0140802 | |||
| 425 | Ga0495608_0181922 | |||
| 426 | Ga0495618_0008414 | |||
| 427 | Ga0495618_0102201 | |||
| 428 | Ga0495618_0116423 | |||
| 429 | Ga0495618_0153208 | |||
| 430 | Ga0495628_0101977 | |||
| 431 | Ga0495630_0447214 | |||
| 432 | Ga0495652_0037937 | |||
| 433 | Ga0495652_0067270 | |||
| 434 | Ga0495640_0012635 | |||
| 435 | Ga0495640_0067290 | |||
| 436 | Ga0495640_0089078 | |||
| 437 | Ga0495586_0009877 | |||
| 438 | Ga0495586_0014920 | |||
| 439 | Ga0495587_0053575 | |||
| 440 | Ga0495645_0172809 | |||
| 441 | Ga0495667_0045070 | |||
| 442 | Ga0495667_0261587 | |||
| 443 | Ga0495667_0561741 | |||
| 444 | Ga0495634_0018613 | |||
| 445 | Ga0495634_0021594 | |||
| 446 | Ga0495635_0009327 | |||
| 447 | Ga0495635_0933444 | |||
| 448 | Ga0495657_0014092 | |||
| 449 | Ga0495657_0071887 | |||
| 450 | Ga0495657_0078595 | |||
| 451 | Ga0495599_0111488 | |||
| 452 | Ga0495599_0200079 | |||
| 453 | Ga0495623_0396972 | |||
| 454 | Ga0495646_0032078 | |||
| 455 | Ga0495658_0241595 | |||
| 456 | Ga0495613_0061658 | |||
| 457 | Ga0495624_0021261 | |||
| 458 | Ga0495624_0145230 | |||
| 459 | Ga0495600_0133324 | |||
| 460 | Ga0495600_0569806 | |||
| 461 | Ga0495581_0128085 | |||
| 462 | Ga0495674_0016425 | |||
| 463 | Ga0495674_0024067 | |||
| 464 | Ga0495674_0026138 | |||
| 465 | Ga0495674_1002231 | |||
| 466 | Ga0495676_0286163 | |||
| 467 | Ga0495680_0023295 | |||
| 468 | Ga0495680_0105081 | |||
| 469 | Ga0495680_0340227 | |||
| 470 | Ga0495675_0102649 | |||
| 471 | Ga0495684_0011763 | |||
| 472 | Ga0495684_0032912 | |||
| 473 | Ga0495684_0209706 | |||
| 474 | Ga0495614_0161689 | |||
| 475 | Ga0496100_0032924 | |||
| 476 | Ga0496100_0396555 | |||
| 477 | Ga0496101_0032357 | |||
| 478 | Ga0496101_0103514 | |||
| 479 | Ga0496101_0196203 | |||
| 480 | Ga0496102_0357495 | |||
| 481 | Ga0496104_0017670 | |||
| 482 | Ga0496104_0039687 | |||
| 483 | Ga0496104_0842744 | |||
| 484 | Ga0496105_0483852 | |||
| 485 | Ga0496106_0031568 | |||
| 486 | Ga0496106_0045959 | |||
| 487 | Ga0496107_0036481 | |||
| 488 | Ga0496107_0070286 | |||
| 489 | Ga0496112_0174863 | |||
| 490 | Ga0496113_0019368 | |||
| 491 | Ga0496114_0050971 | |||
| 492 | Ga0496114_0293615 | |||
| 493 | Ga0496114_0463558 | |||
| 494 | Ga0496115_0227230 | |||
| 495 | Ga0496115_0237464 | |||
| 496 | Ga0496115_0322832 | |||
| 497 | Ga0496115_0448723 | |||
| 498 | Ga0495601_0005996 | |||
| 499 | Ga0495601_0215789 | |||
| 500 | Ga0495601_0512517 | |||
| 501 | Ga0495612_0138733 | |||
| 502 | Ga0495595_0042483 | |||
| 503 | Ga0495619_0110111 | |||
| 504 | Ga0495619_0116298 | |||
| 505 | Ga0500566_0393629 | |||
| 506 | Ga0466962_0111472 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.6362 | 27 | 182 |
| 5vg9-assembly1.cif.gz_A | structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody | 0.628 | 30 | 181 |
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.6165 | 3 | 181 |
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.6045 | 3 | 181 |
| 7c83-assembly1.cif.gz_A | crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a | 0.594 | 2 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71912_2_135_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7976 | 63 | 179 | 1.20.120.1630 |
| af_Q55C17_128_299_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7171 | 7 | 180 | 1.20.120.1630 |
| af_Q55C17_128_299_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.71 | 7 | 180 | 1.20.120.1630 |
| af_C6TD75_105_305_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7067 | 4 | 176 | 1.20.120.1630 |
| af_P71912_2_135_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.699 | 63 | 179 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A563DX71-F1-model_v4 | Isoprenylcysteine carboxylmethyltransferase family protein | 0.8906 | 1 | 172 |
GO:0008168
GO:0012505 GO:0016020 GO:0032259 |
| AF-T1B5Y5-F1-model_v4 | Isoprenylcysteine carboxyl methyltransferase (EC 2.1.1.100) | 0.848 | 73 | 182 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A531LUH1-F1-model_v4 | Isoprenylcysteine carboxylmethyltransferase family protein | 0.8447 | 73 | 182 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A563DX71-F1-model_v4 | Isoprenylcysteine carboxylmethyltransferase family protein | 0.8401 | 1 | 172 |
GO:0008168
GO:0012505 GO:0016020 GO:0032259 |
| AF-A0A7W7QY80-F1-model_v4 | Protein-S-isoprenylcysteine O-methyltransferase Ste14 | 0.8356 | 1 | 182 |
GO:0008168
GO:0012505 GO:0016020 GO:0032259 |