F364216

General Info

Members Datasets Scaffolds Average Seq Length
253 143 506 156

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0011923|Ga0373927_0011923_2680_3120
Length 146
Sequence MLIPTAVFAGDISYNVKYDGGSVPEVKSGTELKLYIDAGQIRFVNEKKDLVAIPASAVTEISYGQDVHNRRVGAAIGIGVVTLGIGALMALTKSKKHFVGLTWANGDQKGGLAMQCDKNEYRGILTGLEGITGKKAVNTDTLTVKN

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 42.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0011923 3300035695 Bacteria 5785
2 Ga0070658_10073878 3300005327 Bacteria 2797
3 Ga0070658_10637391 3300005327 Bacteria 924
4 Ga0070683_100019143 3300005329 Bacteria 6076
5 Ga0070683_100815980 3300005329 Bacteria 894
6 Ga0070660_100055622 3300005339 Bacteria 3058
7 Ga0070660_100585218 3300005339 Bacteria 932
8 Ga0070671_100047701 3300005355 Bacteria 3561
9 Ga0070709_10376557 3300005434 Unclassified 1054
10 Ga0070714_100609923 3300005435 Unclassified 1048
11 Ga0070714_100838716 3300005435 Unclassified 891
12 Ga0070714_100961016 3300005435 Unclassified 831
13 Ga0070713_100778967 3300005436 Unclassified 916
14 Ga0070711_100880931 3300005439 Unclassified 763
15 Ga0070711_101479660 3300005439 Unclassified 592
16 Ga0070705_100125080 3300005440 Unclassified 1667
17 Ga0070663_100276649 3300005455 Bacteria 1336
18 Ga0070681_10021920 3300005458 Bacteria 6408
19 Ga0070681_10114548 3300005458 Bacteria 2635
20 Ga0070681_10415290 3300005458 Bacteria 1257
21 Ga0070681_10719319 3300005458 Bacteria 914
22 Ga0068867_100648751 3300005459 Unclassified 926
23 Ga0070706_100321560 3300005467 Bacteria 1443
24 Ga0070698_100092150 3300005471 Bacteria 3011
25 Ga0070698_100333278 3300005471 Unclassified 1449
26 Ga0070699_100206998 3300005518 Archaea 1745
27 Ga0070679_100049403 3300005530 Bacteria 4189
28 Ga0070679_100236323 3300005530 Bacteria 1786
29 Ga0070679_100765358 3300005530 Bacteria 908
30 Ga0070684_100122987 3300005535 Bacteria 2335
31 Ga0070684_100903651 3300005535 Unclassified 827
32 Ga0070697_100938468 3300005536 Unclassified 768
33 Ga0070696_100061374 3300005546 Unclassified 2630
34 Ga0070693_100091065 3300005547 Bacteria 1838
35 Ga0070665_100137983 3300005548 Bacteria 2442
36 Ga0070665_101279862 3300005548 Unclassified 743
37 Ga0070704_100049717 3300005549 Bacteria 2943
38 Ga0068855_100104327 3300005563 Bacteria 3261
39 Ga0068855_100618118 3300005563 Unclassified 1167
40 Ga0068855_100903954 3300005563 Bacteria 932
41 Ga0070664_101480106 3300005564 Unclassified 642
42 Ga0068857_100408041 3300005577 Bacteria 1265
43 Ga0068857_100514824 3300005577 Unclassified 1124
44 Ga0068857_101436789 3300005577 Unclassified 671
45 Ga0068854_100701266 3300005578 Unclassified 874
46 Ga0068854_101201502 3300005578 Bacteria 679
47 Ga0068856_100009990 3300005614 Bacteria 9217
48 Ga0068852_100122185 3300005616 Bacteria 2386
49 Ga0068859_100355740 3300005617 Unclassified 1559
50 Ga0068864_100345777 3300005618 Unclassified 1402
51 Ga0068863_100400542 3300005841 Bacteria 1342
52 Ga0068858_100500435 3300005842 Unclassified 1174
53 Ga0068860_100058834 3300005843 Bacteria 3654
54 Ga0070717_10029765 3300006028 Bacteria 4384
55 Ga0097621_100094299 3300006237 Unclassified 2509
56 Ga0068871_100061332 3300006358 Bacteria 3071
57 Ga0068871_100078623 3300006358 Bacteria 2728
58 Ga0068865_100015555 3300006881 Bacteria 4854
59 Ga0075436_100017251 3300006914 Bacteria 4941
60 Ga0097620_100355759 3300006931 Unclassified 1559
61 Ga0105240_10050846 3300009093 Bacteria 5221
62 Ga0105240_10427134 3300009093 Bacteria 1487
63 Ga0105240_11270383 3300009093 Bacteria 777
64 Ga0105245_10091123 3300009098 Bacteria 2805
65 Ga0105245_10249400 3300009098 Unclassified 1724
66 Ga0105243_10400802 3300009148 Unclassified 1274
67 Ga0105243_10714105 3300009148 Unclassified 979
68 Ga0105241_10454931 3300009174 Unclassified 1133
69 Ga0105242_10028501 3300009176 Bacteria 4447
70 Ga0105242_10147762 3300009176 Bacteria 2046
71 Ga0105242_10297391 3300009176 Unclassified 1472
72 Ga0105242_10301672 3300009176 Bacteria 1462
73 Ga0105248_11015043 3300009177 Unclassified 937
74 Ga0105248_11805697 3300009177 Bacteria 693
75 Ga0105237_10372092 3300009545 Unclassified 1433
76 Ga0105237_11456673 3300009545 Unclassified 691
77 Ga0105238_10002189 3300009551 Bacteria 19730
78 Ga0105238_10012536 3300009551 Bacteria 8556
79 Ga0105238_10039319 3300009551 Unclassified 4797
80 Ga0105238_10088515 3300009551 Bacteria 3082
81 Ga0105238_10153523 3300009551 Bacteria 2277
82 Ga0105238_10208519 3300009551 Unclassified 1930
83 Ga0105238_10683337 3300009551 Bacteria 1038
84 Ga0105249_10313348 3300009553 Unclassified 1578
85 Ga0099796_10008394 3300010159 Unclassified 2751
86 Ga0105239_10068908 3300010375 Bacteria 3888
87 Ga0105239_10077172 3300010375 Bacteria 3666
88 Ga0105239_10093954 3300010375 Bacteria 3312
89 Ga0105239_10146467 3300010375 Bacteria 2634
90 Ga0105239_10767677 3300010375 Bacteria 1104
91 Ga0105239_12145085 3300010375 Unclassified 649
92 Ga0105246_10130903 3300011119 Unclassified 1874
93 Ga0157373_11001089 3300013100 Bacteria 624
94 Ga0157371_10101253 3300013102 Bacteria 2044
95 Ga0157370_10295767 3300013104 Unclassified 1495
96 Ga0157369_10000563 3300013105 Bacteria 48721
97 Ga0157369_10180425 3300013105 Bacteria 2221
98 Ga0157369_10557287 3300013105 Unclassified 1184
99 Ga0157369_10850819 3300013105 Unclassified 936
100 Ga0157374_10426616 3300013296 Bacteria 1325
101 Ga0157374_10748096 3300013296 Unclassified 992
102 Ga0157378_10001295 3300013297 Bacteria 22518
103 Ga0157378_10395860 3300013297 Unclassified 1360
104 Ga0157378_11107398 3300013297 Bacteria 829
105 Ga0163162_10007531 3300013306 Bacteria 10601
106 Ga0163162_10371332 3300013306 Unclassified 1563
107 Ga0163162_10505587 3300013306 Unclassified 1339
108 Ga0163162_11299534 3300013306 Unclassified 826
109 Ga0157372_10101383 3300013307 Bacteria 3286
110 Ga0157372_10148733 3300013307 Bacteria 2702
111 Ga0157372_10316482 3300013307 Unclassified 1817
112 Ga0157372_10443747 3300013307 Bacteria 1512
113 Ga0157372_10557591 3300013307 Bacteria 1336
114 Ga0157375_10186613 3300013308 Bacteria 2227
115 Ga0157375_10411434 3300013308 Unclassified 1519
116 Ga0157375_10900348 3300013308 Unclassified 1029
117 Ga0163163_10001591 3300014325 Bacteria 19096
118 Ga0163163_10055690 3300014325 Unclassified 3909
119 Ga0163163_10282537 3300014325 Bacteria 1711
120 Ga0157376_10819871 3300014969 Unclassified 944
121 Ga0213872_10008448 3300021361 Bacteria 4984
122 Ga0213872_10055850 3300021361 Bacteria 1789
123 Ga0224572_1012462 3300024225 Bacteria 1616
124 Ga0207680_10808692 3300025903 Unclassified 672
125 Ga0207705_10148001 3300025909 Bacteria 1758
126 Ga0207705_10407210 3300025909 Bacteria 1052
127 Ga0207684_10105499 3300025910 Bacteria 2410
128 Ga0207684_10470398 3300025910 Unclassified 1079
129 Ga0207707_10114965 3300025912 Bacteria 2352
130 Ga0207707_10266374 3300025912 Bacteria 1485
131 Ga0207707_10456724 3300025912 Bacteria 1093
132 Ga0207695_10241689 3300025913 Bacteria 1707
133 Ga0207695_10652674 3300025913 Unclassified 933
134 Ga0207695_10881761 3300025913 Bacteria 774
135 Ga0207671_10962677 3300025914 Unclassified 673
136 Ga0207693_10255093 3300025915 Unclassified 1376
137 Ga0207663_10567866 3300025916 Unclassified 888
138 Ga0207663_10720539 3300025916 Unclassified 791
139 Ga0207657_10057003 3300025919 Bacteria 3369
140 Ga0207649_10106301 3300025920 Bacteria 1866
141 Ga0207649_10680282 3300025920 Unclassified 797
142 Ga0207652_10131849 3300025921 Bacteria 2229
143 Ga0207652_10344134 3300025921 Bacteria 1346
144 Ga0207646_10476803 3300025922 Unclassified 1125
145 Ga0207694_10124789 3300025924 Bacteria 2058
146 Ga0207694_10283680 3300025924 Bacteria 1361
147 Ga0207694_10357833 3300025924 Unclassified 1209
148 Ga0207687_11289486 3300025927 Unclassified 628
149 Ga0207700_10581642 3300025928 Unclassified 996
150 Ga0207700_11282955 3300025928 Unclassified 653
151 Ga0207664_10422121 3300025929 Bacteria 1188
152 Ga0207664_10610259 3300025929 Unclassified 980
153 Ga0207706_10309936 3300025933 Bacteria 1375
154 Ga0207686_10003948 3300025934 Bacteria 7951
155 Ga0207686_10773509 3300025934 Unclassified 768
156 Ga0207704_10137138 3300025938 Unclassified 1705
157 Ga0207661_10030577 3300025944 Unclassified 4150
158 Ga0207661_10757065 3300025944 Bacteria 894
159 Ga0207667_10072794 3300025949 Bacteria 3571
160 Ga0207667_10161605 3300025949 Bacteria 2304
161 Ga0207667_10474149 3300025949 Unclassified 1271
162 Ga0207667_10701001 3300025949 Bacteria 1015
163 Ga0207640_10612128 3300025981 Bacteria 923
164 Ga0207640_10688043 3300025981 Bacteria 875
165 Ga0207678_10640331 3300026067 Bacteria 933
166 Ga0207702_10079792 3300026078 Bacteria 2838
167 Ga0207641_10230989 3300026088 Unclassified 1719
168 Ga0207641_10647245 3300026088 Unclassified 1038
169 Ga0207676_10020361 3300026095 Bacteria 4854
170 Ga0207676_11380237 3300026095 Unclassified 700
171 Ga0207674_10859804 3300026116 Unclassified 874
172 Ga0207698_10014077 3300026142 Bacteria 5303
173 Ga0268266_10081894 3300028379 Bacteria 2814
174 Ga0265338_10153693 3300028800 Bacteria 1785
175 Ga0265316_10225977 3300031344 Bacteria 1380
176 Ga0373926_0182994 3300035083 Bacteria 804
177 Ga0373934_0061820 3300035086 Bacteria 1492
178 Ga0373934_0078636 3300035086 Bacteria 1324
179 Ga0373923_0428052 3300035111 Unclassified 640
180 Ga0373945_0420294 3300035116 Unclassified 588
181 Ga0373954_0044481 3300035118 Unclassified 2072
182 Ga0373954_0340867 3300035118 Unclassified 740
183 Ga0373956_0371906 3300035119 Bacteria 681
184 Ga0373943_0128113 3300035170 Unclassified 1356
185 Ga0373943_0409428 3300035170 Bacteria 784
186 Ga0373946_0554270 3300035171 Unclassified 593
187 Ga0373924_0310405 3300035410 Unclassified 701
188 Ga0373935_0187756 3300035692 Bacteria 1422
189 Ga0373927_0020246 3300035695 Plasmid 4363
190 Ga0373927_0754101 3300035695 Unclassified 643
191 Ga0373933_0074216 3300035724 Bacteria 2074
192 Ga0373947_0118430 3300035725 Bacteria 1680
193 Ga0373937_0025649 3300036401 Bacteria 5323
194 Ga0373937_0027342 3300036401 Bacteria 5158
195 Ga0373937_0371458 3300036401 Bacteria 1356
196 Ga0373925_0022076 3300037068 Plasmid 4639
197 Ga0373925_0082639 3300037068 Bacteria 2445
198 Ga0373925_0205558 3300037068 Bacteria 1567
199 Ga0436360_0206406 3300039438 Bacteria 699
200 Ga0436361_0391530 3300039447 Bacteria 815
201 Ga0436361_0454590 3300039447 Bacteria 37146
202 Ga0436361_0932413 3300039447 Bacteria 1131
203 Ga0436361_0991327 3300039447 Bacteria 1789
204 Ga0436361_1023732 3300039447 Bacteria 953
205 Ga0495603_0252161 3300046455 Unclassified 1016
206 Ga0495629_0071799 3300046459 Unclassified 2416
207 Ga0495651_0110542 3300046462 Unclassified 2033
208 Ga0495651_0400802 3300046462 Bacteria 896
209 Ga0495651_0667836 3300046462 Bacteria 650
210 Ga0495653_0434089 3300046463 Unclassified 829
211 Ga0495580_0001011 3300046472 Bacteria 24758
212 Ga0495580_0069568 3300046472 Unclassified 2459
213 Ga0495580_0455602 3300046472 Unclassified 858
214 Ga0495580_0709258 3300046472 Unclassified 658
215 Ga0495582_0163101 3300046473 Unclassified 1268
216 Ga0495639_0088984 3300046475 Unclassified 1446
217 Ga0495639_0404954 3300046475 Unclassified 689
218 Ga0495594_0024846 3300046499 Plasmid 3221
219 Ga0495594_0156026 3300046499 Unclassified 1296
220 Ga0495665_0062393 3300046531 Unclassified 1968
221 Ga0495665_0128494 3300046531 Bacteria 1327
222 Ga0495665_0153220 3300046531 Unclassified 1203
223 Ga0495665_0334540 3300046531 Unclassified 772
224 Ga0495587_0457240 3300046536 Unclassified 707
225 Ga0495645_0232321 3300046543 Unclassified 1235
226 Ga0495645_0486703 3300046543 Bacteria 773
227 Ga0495622_0091917 3300046557 Unclassified 1394
228 Ga0495667_0090963 3300046559 Unclassified 1977
229 Ga0495667_0378548 3300046559 Bacteria 893
230 Ga0495635_0155030 3300046663 Bacteria 1559
231 Ga0495623_0433720 3300046679 Unclassified 702
232 Ga0495646_0293182 3300046680 Unclassified 862
233 Ga0495647_0091901 3300046681 Unclassified 1245
234 Ga0495658_0025992 3300046683 Bacteria 3133
235 Ga0495669_0113924 3300046684 Bacteria 1264
236 Ga0495613_0009373 3300046689 Bacteria 7264
237 Ga0495613_0211825 3300046689 Bacteria 1363
238 Ga0495613_0276347 3300046689 Unclassified 1167
239 Ga0495581_0127742 3300047315 Bacteria 1481
240 Ga0495636_0151759 3300047318 Bacteria 1040
241 Ga0495674_0136796 3300047319 Bacteria 2061
242 Ga0495674_0399204 3300047319 Bacteria 1110
243 Ga0495674_0473645 3300047319 Bacteria 1004
244 Ga0495674_0696526 3300047319 Unclassified 798
245 Ga0495675_0273950 3300047444 Bacteria 1008
246 Ga0495684_0034036 3300047471 Unclassified 3909
247 Ga0495684_0204468 3300047471 Bacteria 1454
248 Ga0495614_0053681 3300048089 Unclassified 1728
249 Ga0496102_0185579 3300048905 Bacteria 1960
250 Ga0496106_0432010 3300048909 Bacteria 1058
251 Ga0496112_0436536 3300048915 Unclassified 1248
252 nmdc:mga08x19_130055_c1 3300050514 Bacteria 1693
253 Ga0495601_0058993 3300053077 Unclassified 2433
254 Ga0373927_0011923
255 Ga0070658_10073878
256 Ga0070658_10637391
257 Ga0070683_100019143
258 Ga0070683_100815980
259 Ga0070660_100055622
260 Ga0070660_100585218
261 Ga0070671_100047701
262 Ga0070709_10376557
263 Ga0070714_100609923
264 Ga0070714_100838716
265 Ga0070714_100961016
266 Ga0070713_100778967
267 Ga0070711_100880931
268 Ga0070711_101479660
269 Ga0070705_100125080
270 Ga0070663_100276649
271 Ga0070681_10021920
272 Ga0070681_10114548
273 Ga0070681_10415290
274 Ga0070681_10719319
275 Ga0068867_100648751
276 Ga0070706_100321560
277 Ga0070698_100092150
278 Ga0070698_100333278
279 Ga0070699_100206998
280 Ga0070679_100049403
281 Ga0070679_100236323
282 Ga0070679_100765358
283 Ga0070684_100122987
284 Ga0070684_100903651
285 Ga0070697_100938468
286 Ga0070696_100061374
287 Ga0070693_100091065
288 Ga0070665_100137983
289 Ga0070665_101279862
290 Ga0070704_100049717
291 Ga0068855_100104327
292 Ga0068855_100618118
293 Ga0068855_100903954
294 Ga0070664_101480106
295 Ga0068857_100408041
296 Ga0068857_100514824
297 Ga0068857_101436789
298 Ga0068854_100701266
299 Ga0068854_101201502
300 Ga0068856_100009990
301 Ga0068852_100122185
302 Ga0068859_100355740
303 Ga0068864_100345777
304 Ga0068863_100400542
305 Ga0068858_100500435
306 Ga0068860_100058834
307 Ga0070717_10029765
308 Ga0097621_100094299
309 Ga0068871_100061332
310 Ga0068871_100078623
311 Ga0068865_100015555
312 Ga0075436_100017251
313 Ga0097620_100355759
314 Ga0105240_10050846
315 Ga0105240_10427134
316 Ga0105240_11270383
317 Ga0105245_10091123
318 Ga0105245_10249400
319 Ga0105243_10400802
320 Ga0105243_10714105
321 Ga0105241_10454931
322 Ga0105242_10028501
323 Ga0105242_10147762
324 Ga0105242_10297391
325 Ga0105242_10301672
326 Ga0105248_11015043
327 Ga0105248_11805697
328 Ga0105237_10372092
329 Ga0105237_11456673
330 Ga0105238_10002189
331 Ga0105238_10012536
332 Ga0105238_10039319
333 Ga0105238_10088515
334 Ga0105238_10153523
335 Ga0105238_10208519
336 Ga0105238_10683337
337 Ga0105249_10313348
338 Ga0099796_10008394
339 Ga0105239_10068908
340 Ga0105239_10077172
341 Ga0105239_10093954
342 Ga0105239_10146467
343 Ga0105239_10767677
344 Ga0105239_12145085
345 Ga0105246_10130903
346 Ga0157373_11001089
347 Ga0157371_10101253
348 Ga0157370_10295767
349 Ga0157369_10000563
350 Ga0157369_10180425
351 Ga0157369_10557287
352 Ga0157369_10850819
353 Ga0157374_10426616
354 Ga0157374_10748096
355 Ga0157378_10001295
356 Ga0157378_10395860
357 Ga0157378_11107398
358 Ga0163162_10007531
359 Ga0163162_10371332
360 Ga0163162_10505587
361 Ga0163162_11299534
362 Ga0157372_10101383
363 Ga0157372_10148733
364 Ga0157372_10316482
365 Ga0157372_10443747
366 Ga0157372_10557591
367 Ga0157375_10186613
368 Ga0157375_10411434
369 Ga0157375_10900348
370 Ga0163163_10001591
371 Ga0163163_10055690
372 Ga0163163_10282537
373 Ga0157376_10819871
374 Ga0213872_10008448
375 Ga0213872_10055850
376 Ga0224572_1012462
377 Ga0207680_10808692
378 Ga0207705_10148001
379 Ga0207705_10407210
380 Ga0207684_10105499
381 Ga0207684_10470398
382 Ga0207707_10114965
383 Ga0207707_10266374
384 Ga0207707_10456724
385 Ga0207695_10241689
386 Ga0207695_10652674
387 Ga0207695_10881761
388 Ga0207671_10962677
389 Ga0207693_10255093
390 Ga0207663_10567866
391 Ga0207663_10720539
392 Ga0207657_10057003
393 Ga0207649_10106301
394 Ga0207649_10680282
395 Ga0207652_10131849
396 Ga0207652_10344134
397 Ga0207646_10476803
398 Ga0207694_10124789
399 Ga0207694_10283680
400 Ga0207694_10357833
401 Ga0207687_11289486
402 Ga0207700_10581642
403 Ga0207700_11282955
404 Ga0207664_10422121
405 Ga0207664_10610259
406 Ga0207706_10309936
407 Ga0207686_10003948
408 Ga0207686_10773509
409 Ga0207704_10137138
410 Ga0207661_10030577
411 Ga0207661_10757065
412 Ga0207667_10072794
413 Ga0207667_10161605
414 Ga0207667_10474149
415 Ga0207667_10701001
416 Ga0207640_10612128
417 Ga0207640_10688043
418 Ga0207678_10640331
419 Ga0207702_10079792
420 Ga0207641_10230989
421 Ga0207641_10647245
422 Ga0207676_10020361
423 Ga0207676_11380237
424 Ga0207674_10859804
425 Ga0207698_10014077
426 Ga0268266_10081894
427 Ga0265338_10153693
428 Ga0265316_10225977
429 Ga0373926_0182994
430 Ga0373934_0061820
431 Ga0373934_0078636
432 Ga0373923_0428052
433 Ga0373945_0420294
434 Ga0373954_0044481
435 Ga0373954_0340867
436 Ga0373956_0371906
437 Ga0373943_0128113
438 Ga0373943_0409428
439 Ga0373946_0554270
440 Ga0373924_0310405
441 Ga0373935_0187756
442 Ga0373927_0020246
443 Ga0373927_0754101
444 Ga0373933_0074216
445 Ga0373947_0118430
446 Ga0373937_0025649
447 Ga0373937_0027342
448 Ga0373937_0371458
449 Ga0373925_0022076
450 Ga0373925_0082639
451 Ga0373925_0205558
452 Ga0436360_0206406
453 Ga0436361_0391530
454 Ga0436361_0454590
455 Ga0436361_0932413
456 Ga0436361_0991327
457 Ga0436361_1023732
458 Ga0495603_0252161
459 Ga0495629_0071799
460 Ga0495651_0110542
461 Ga0495651_0400802
462 Ga0495651_0667836
463 Ga0495653_0434089
464 Ga0495580_0001011
465 Ga0495580_0069568
466 Ga0495580_0455602
467 Ga0495580_0709258
468 Ga0495582_0163101
469 Ga0495639_0088984
470 Ga0495639_0404954
471 Ga0495594_0024846
472 Ga0495594_0156026
473 Ga0495665_0062393
474 Ga0495665_0128494
475 Ga0495665_0153220
476 Ga0495665_0334540
477 Ga0495587_0457240
478 Ga0495645_0232321
479 Ga0495645_0486703
480 Ga0495622_0091917
481 Ga0495667_0090963
482 Ga0495667_0378548
483 Ga0495635_0155030
484 Ga0495623_0433720
485 Ga0495646_0293182
486 Ga0495647_0091901
487 Ga0495658_0025992
488 Ga0495669_0113924
489 Ga0495613_0009373
490 Ga0495613_0211825
491 Ga0495613_0276347
492 Ga0495581_0127742
493 Ga0495636_0151759
494 Ga0495674_0136796
495 Ga0495674_0399204
496 Ga0495674_0473645
497 Ga0495674_0696526
498 Ga0495675_0273950
499 Ga0495684_0034036
500 Ga0495684_0204468
501 Ga0495614_0053681
502 Ga0496102_0185579
503 Ga0496106_0432010
504 Ga0496112_0436536
505 nmdc:mga08x19_130055_c1
506 Ga0495601_0058993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qij-assembly1.cif.gz_A primitive-monoclinic crystal structure of the ferm domain of protein 4.1r 0.7718 10 128
3qij-assembly2.cif.gz_B primitive-monoclinic crystal structure of the ferm domain of protein 4.1r 0.746 8 128
3voq-assembly1.cif.gz_B crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit 0.7325 10 128
2v76-assembly1.cif.gz_A crystal structure of the human dok1 ptb domain 0.7292 24 128
3voq-assembly1.cif.gz_A crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit 0.7097 10 131
ID Description Score Start End Superfamily
af_F1Q823_211_249_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.8288 25 50 2.20.70.10
af_Q54NQ1_172_254_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7937 10 125 2.30.29.30
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7869 10 128 2.30.29.30
af_Q99MZ6_2005_2100_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7626 10 128 2.30.29.30
af_Q54NQ1_172_254_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7593 10 125 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V9N705-F1-model_v4 Uncharacterized protein 0.827 1 50
AF-A0A3R9NUB2-F1-model_v4 Pilus formation protein N-terminal domain-containing protein 0.8003 3 140
AF-A0A7C5EVE6-F1-model_v4 Uncharacterized protein 0.7829 1 139
AF-A0A2N9M0Z1-F1-model_v4 Uncharacterized protein 0.778 3 140
AF-A0A7X2TYQ8-F1-model_v4 Uncharacterized protein 0.7756 10 140

Map