F364166

General Info

Members Datasets Scaffolds Average Seq Length
253 149 506 368

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10031886|Ga0265331_100318862
Length 396
Sequence MGGSEGPYYRIVDGMGSISNVKLPSQVAIWDQYAHQFPVRERLIYLNHAAVAPLCKPAAEAMKHLADDCMQFGSRHYKDWLDAYEGLRVAAARLVGADRSEIALVKNTSEGIATVAMGLDWKPGDRMVAFLEEFPANYYPWKRLEAQGIHVTWLSVEDPLDKIADAARGAKLLAISFVQFLSGYRAPIQAIGEICHANQCIYLVDAIQGLGAFPLDVKACHIDALAADGHKWLLGPEGCGILYINQALQDRVAPVEFGWTNVAGYNDYASRDMALREDAGRYECGTLNTIGCFGLRASIELLLEVGLGKIAPLVQNLGDRIANGVVNKGYELLGTRTPETGAGIVSFRKPGIEASEIVRKLAVAGISAAPRAGWVRTSPHFYIPPNDIDRMLEELP

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 21.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10031886 3300031250 Unclassified 2616
2 Ga0070683_100007583 3300005329 Bacteria 9176
3 Ga0070683_100025697 3300005329 Bacteria 5293
4 Ga0070666_10008014 3300005335 Bacteria 6534
5 Ga0070667_100023574 3300005367 Bacteria 5108
6 Ga0070663_100285287 3300005455 Bacteria 1317
7 Ga0070681_10000540 3300005458 Bacteria 31122
8 Ga0070681_10386505 3300005458 Bacteria 1310
9 Ga0068867_100009985 3300005459 Bacteria 6690
10 Ga0070699_100097749 3300005518 Bacteria 2572
11 Ga0070699_100146671 3300005518 Unclassified 2085
12 Ga0070679_100069916 3300005530 Unclassified 3502
13 Ga0070684_100008510 3300005535 Bacteria 8025
14 Ga0070684_100015376 3300005535 Bacteria 6232
15 Ga0070684_100130907 3300005535 Unclassified 2263
16 Ga0068853_100298823 3300005539 Bacteria 1488
17 Ga0070695_100248655 3300005545 Unclassified 1293
18 Ga0070696_100002788 3300005546 Bacteria 11598
19 Ga0068855_100019737 3300005563 Bacteria 8094
20 Ga0068855_100037106 3300005563 Bacteria 5798
21 Ga0068855_100057778 3300005563 Bacteria 4547
22 Ga0068855_100236532 3300005563 Unclassified 2043
23 Ga0068857_100091454 3300005577 Bacteria 2724
24 Ga0068856_100261727 3300005614 Bacteria 1745
25 Ga0068863_100044157 3300005841 Bacteria 4231
26 Ga0068863_100051473 3300005841 Bacteria 3904
27 Ga0068858_100049004 3300005842 Bacteria 3912
28 Ga0068860_100000959 3300005843 Bacteria 31907
29 Ga0070717_10004239 3300006028 Bacteria 10339
30 Ga0070717_10019110 3300006028 Bacteria 5367
31 Ga0070717_10029417 3300006028 Bacteria 4407
32 Ga0070717_10040590 3300006028 Bacteria 3791
33 Ga0070717_10158894 3300006028 Unclassified 1960
34 Ga0097621_100006772 3300006237 Bacteria 8138
35 Ga0097621_100088435 3300006237 Bacteria 2588
36 Ga0097621_100111126 3300006237 Bacteria 2316
37 Ga0068871_100004796 3300006358 Bacteria 9453
38 Ga0068871_100028566 3300006358 Bacteria 4373
39 Ga0068871_100118493 3300006358 Bacteria 2234
40 Ga0075431_100014684 3300006847 Bacteria 7926
41 Ga0075431_100045510 3300006847 Bacteria 4524
42 Ga0068865_100039389 3300006881 Bacteria 3205
43 Ga0075436_100001437 3300006914 Bacteria 16203
44 Ga0105240_10001221 3300009093 Bacteria 44698
45 Ga0105240_10004121 3300009093 Bacteria 22311
46 Ga0105240_10005585 3300009093 Bacteria 18689
47 Ga0105240_10018942 3300009093 Bacteria 9218
48 Ga0105240_10105525 3300009093 Bacteria 3420
49 Ga0105240_10192805 3300009093 Unclassified 2395
50 Ga0105240_10295855 3300009093 Bacteria 1854
51 Ga0105245_10007185 3300009098 Bacteria 9757
52 Ga0105245_10008299 3300009098 Bacteria 9073
53 Ga0105245_10126951 3300009098 Unclassified 2389
54 Ga0105247_10029543 3300009101 Bacteria 3322
55 Ga0105247_10054292 3300009101 Bacteria 2472
56 Ga0114129_10116704 3300009147 Bacteria 3678
57 Ga0105241_10014652 3300009174 Bacteria 5740
58 Ga0105241_10018679 3300009174 Bacteria 5104
59 Ga0105241_10035150 3300009174 Bacteria 3769
60 Ga0105242_10011856 3300009176 Bacteria 6709
61 Ga0105242_10019060 3300009176 Bacteria 5375
62 Ga0105248_10003696 3300009177 Bacteria 16953
63 Ga0105248_10012479 3300009177 Bacteria 9372
64 Ga0105248_10080486 3300009177 Unclassified 3661
65 Ga0105248_10130592 3300009177 Unclassified 2834
66 Ga0105237_10029456 3300009545 Bacteria 5581
67 Ga0105237_10052045 3300009545 Bacteria 4112
68 Ga0105238_10008445 3300009551 Bacteria 10311
69 Ga0105238_10040043 3300009551 Bacteria 4750
70 Ga0105238_10045972 3300009551 Unclassified 4408
71 Ga0105238_10102877 3300009551 Bacteria 2838
72 Ga0105239_10004875 3300010375 Bacteria 15884
73 Ga0105239_10013910 3300010375 Bacteria 8932
74 Ga0105239_10021195 3300010375 Bacteria 7165
75 Ga0105239_10024690 3300010375 Bacteria 6621
76 Ga0105239_10063834 3300010375 Unclassified 4043
77 Ga0157370_10021747 3300013104 Bacteria 6391
78 Ga0157370_10023666 3300013104 Bacteria 6096
79 Ga0157369_10053478 3300013105 Bacteria 4364
80 Ga0157369_10219542 3300013105 Unclassified 1990
81 Ga0157378_10002202 3300013297 Bacteria 17289
82 Ga0157378_10080672 3300013297 Bacteria 2940
83 Ga0157378_10379430 3300013297 Unclassified 1388
84 Ga0163162_10035870 3300013306 Bacteria 4941
85 Ga0163162_10428562 3300013306 Unclassified 1455
86 Ga0157372_10206986 3300013307 Bacteria 2273
87 Ga0157372_10308917 3300013307 Bacteria 1840
88 Ga0157375_10119360 3300013308 Bacteria 2745
89 Ga0163163_10019402 3300014325 Bacteria 6387
90 Ga0163163_10023004 3300014325 Bacteria 5909
91 Ga0163163_10125525 3300014325 Bacteria 2604
92 Ga0163163_10310694 3300014325 Bacteria 1629
93 Ga0157379_10369885 3300014968 Unclassified 1314
94 Ga0157376_10241862 3300014969 Unclassified 1682
95 Ga0213875_10014304 3300021388 Bacteria 3873
96 Ga0213875_10017100 3300021388 Bacteria 3509
97 Ga0207680_10085445 3300025903 Bacteria 1993
98 Ga0207707_10002578 3300025912 Bacteria 16234
99 Ga0207707_10005871 3300025912 Bacteria 10733
100 Ga0207707_10109760 3300025912 Bacteria 2411
101 Ga0207695_10001253 3300025913 Bacteria 43291
102 Ga0207695_10013652 3300025913 Bacteria 9672
103 Ga0207695_10022099 3300025913 Bacteria 7235
104 Ga0207695_10043561 3300025913 Unclassified 4783
105 Ga0207695_10097358 3300025913 Bacteria 2943
106 Ga0207695_10185328 3300025913 Unclassified 2001
107 Ga0207671_10015333 3300025914 Bacteria 6004
108 Ga0207657_10014726 3300025919 Bacteria 7615
109 Ga0207649_10153462 3300025920 Bacteria 1589
110 Ga0207652_10241545 3300025921 Bacteria 1628
111 Ga0207652_10259342 3300025921 Bacteria 1568
112 Ga0207694_10002133 3300025924 Bacteria 16255
113 Ga0207694_10027534 3300025924 Bacteria 4329
114 Ga0207694_10176904 3300025924 Unclassified 1729
115 Ga0207687_10015165 3300025927 Bacteria 5050
116 Ga0207687_10039572 3300025927 Unclassified 3229
117 Ga0207687_10212533 3300025927 Unclassified 1518
118 Ga0207700_10072447 3300025928 Bacteria 2657
119 Ga0207700_10147916 3300025928 Bacteria 1938
120 Ga0207686_10027248 3300025934 Bacteria 3344
121 Ga0207686_10041581 3300025934 Bacteria 2804
122 Ga0207686_10133475 3300025934 Bacteria 1706
123 Ga0207709_10015875 3300025935 Unclassified 4180
124 Ga0207704_10020716 3300025938 Bacteria 3485
125 Ga0207711_10056977 3300025941 Bacteria 3359
126 Ga0207711_10168779 3300025941 Bacteria 1985
127 Ga0207661_10004933 3300025944 Bacteria 9357
128 Ga0207661_10022595 3300025944 Bacteria 4740
129 Ga0207661_10025783 3300025944 Bacteria 4473
130 Ga0207661_10099124 3300025944 Bacteria 2443
131 Ga0207679_10307218 3300025945 Bacteria 1369
132 Ga0207667_10006635 3300025949 Bacteria 13988
133 Ga0207667_10257747 3300025949 Unclassified 1784
134 Ga0207658_10025201 3300025986 Bacteria 4164
135 Ga0207703_10005818 3300026035 Bacteria 9877
136 Ga0207702_10013008 3300026078 Bacteria 6921
137 Ga0207702_10037772 3300026078 Bacteria 4043
138 Ga0207702_10163617 3300026078 Bacteria 2034
139 Ga0207641_10008866 3300026088 Bacteria 8306
140 Ga0207648_10005862 3300026089 Bacteria 12294
141 Ga0207674_10003813 3300026116 Bacteria 18377
142 Ga0207674_10008558 3300026116 Bacteria 11799
143 Ga0207683_10098582 3300026121 Bacteria 2607
144 Ga0268266_10011572 3300028379 Bacteria 7658
145 Ga0268264_10003149 3300028381 Bacteria 14293
146 Ga0268264_10129181 3300028381 Unclassified 2237
147 Ga0265323_10001561 3300028653 Bacteria 11073
148 Ga0265338_10027274 3300028800 Bacteria 5733
149 Ga0265338_10173441 3300028800 Viruses 1651
150 Ga0265762_1005964 3300030760 Unclassified 2183
151 Ga0265330_10059605 3300031235 Bacteria 1662
152 Ga0265332_10025726 3300031238 Bacteria 2583
153 Ga0265320_10023004 3300031240 Bacteria 3325
154 Ga0265325_10004982 3300031241 Bacteria 8276
155 Ga0265325_10069900 3300031241 Bacteria 1765
156 Ga0265329_10014587 3300031242 Bacteria 2770
157 Ga0265340_10021428 3300031247 Bacteria 3315
158 Ga0265339_10013259 3300031249 Bacteria 5000
159 Ga0265331_10070988 3300031250 Bacteria 1629
160 Ga0265316_10108545 3300031344 Unclassified 2104
161 Ga0265316_10196036 3300031344 Unclassified 1499
162 Ga0265314_10004381 3300031711 Bacteria 13131
163 Ga0265342_10030528 3300031712 Bacteria 3339
164 Ga0265342_10108235 3300031712 Unclassified 1576
165 Ga0373926_0019328 3300035083 Bacteria 2348
166 Ga0373943_0061977 3300035170 Unclassified 1871
167 Ga0373955_0040979 3300035172 Bacteria 2480
168 Ga0373935_0094909 3300035692 Unclassified 1958
169 Ga0373927_0008710 3300035695 Bacteria 6816
170 Ga0373927_0011888 3300035695 Bacteria 5796
171 Ga0373927_0012100 3300035695 Bacteria 5739
172 Ga0373927_0198048 3300035695 Unclassified 1318
173 Ga0373933_0032930 3300035724 Bacteria 3013
174 Ga0373947_0015820 3300035725 Unclassified 4333
175 Ga0373947_0043766 3300035725 Bacteria 2675
176 Ga0373947_0077848 3300035725 Bacteria 2046
177 Ga0373947_0154139 3300035725 Unclassified 1482
178 Ga0373937_0060971 3300036401 Bacteria 3467
179 Ga0373925_0000656 3300037068 Bacteria 32516
180 Ga0373925_0093450 3300037068 Bacteria 2302
181 Ga0373925_0150562 3300037068 Unclassified 1827
182 Ga0436364_0527022 3300037853 Bacteria 3780
183 Ga0436364_0998402 3300037853 Bacteria 13863
184 Ga0436364_1418043 3300037853 Bacteria 2429
185 Ga0436364_1421314 3300037853 Bacteria 1203
186 Ga0436365_0408432 3300039437 Unclassified 3224
187 Ga0436365_1203486 3300039437 Unclassified 1960
188 Ga0451576_0036052 3300045051 Bacteria 5246
189 Ga0495592_0002900 3300046454 Bacteria 12200
190 Ga0495651_0042684 3300046462 Unclassified 3520
191 Ga0495653_0029375 3300046463 Unclassified 4389
192 Ga0495580_0001281 3300046472 Bacteria 22162
193 Ga0495580_0018462 3300046472 Bacteria 5192
194 Ga0495580_0028623 3300046472 Bacteria 4049
195 Ga0495580_0032375 3300046472 Unclassified 3774
196 Ga0495582_0168656 3300046473 Unclassified 1246
197 Ga0495662_0001283 3300046476 Bacteria 12414
198 Ga0495664_0177517 3300046477 Bacteria 1292
199 Ga0495608_0098215 3300046511 Unclassified 1890
200 Ga0495618_0047549 3300046514 Unclassified 2708
201 Ga0495628_0001601 3300046516 Bacteria 20755
202 Ga0495630_0008118 3300046517 Bacteria 7544
203 Ga0495652_0008585 3300046529 Bacteria 9317
204 Ga0495665_0036025 3300046531 Unclassified 2642
205 Ga0495640_0018349 3300046533 Bacteria 5193
206 Ga0495586_0091274 3300046535 Unclassified 1683
207 Ga0495587_0082485 3300046536 Unclassified 1863
208 Ga0495645_0009814 3300046543 Bacteria 6696
209 Ga0495645_0017089 3300046543 Bacteria 5196
210 Ga0495645_0127856 3300046543 Unclassified 1784
211 Ga0495667_0199098 3300046559 Bacteria 1282
212 Ga0495634_0017192 3300046642 Viruses 5165
213 Ga0495635_0003174 3300046663 Bacteria 11326
214 Ga0495599_0016656 3300046678 Unclassified 4565
215 Ga0495623_0015809 3300046679 Unclassified 4878
216 Ga0495623_0121388 3300046679 Bacteria 1573
217 Ga0495646_0147394 3300046680 Bacteria 1311
218 Ga0495613_0101345 3300046689 Bacteria 2080
219 Ga0495624_0126219 3300046690 Unclassified 1570
220 Ga0495600_0162142 3300046809 Bacteria 1445
221 Ga0495604_0049501 3300047317 Unclassified 3265
222 Ga0495674_0002515 3300047319 Bacteria 17838
223 Ga0495674_0002584 3300047319 Bacteria 17626
224 Ga0495680_0006774 3300047322 Bacteria 10583
225 Ga0495684_0043526 3300047471 Unclassified 3438
226 Ga0495684_0058128 3300047471 Bacteria 2946
227 Ga0495684_0099422 3300047471 Unclassified 2199
228 Ga0495684_0174800 3300047471 Bacteria 1594
229 Ga0495602_0050298 3300048088 Bacteria 3725
230 Ga0496126_0026310 3300048929 Bacteria 5581
231 Ga0501032_0003420 3300049569 Bacteria 12156
232 Ga0501033_0050086 3300049570 Bacteria 3099
233 Ga0501038_0003666 3300049574 Bacteria 14310
234 Ga0501039_0034059 3300049575 Bacteria 3930
235 Ga0501046_0003236 3300049580 Bacteria 14965
236 Ga0501048_0060643 3300049582 Unclassified 2680
237 Ga0501067_0000291 3300049583 Bacteria 27391
238 Ga0501068_0000416 3300049584 Bacteria 21586
239 Ga0501069_0008145 3300049585 Bacteria 5505
240 Ga0501070_0009612 3300049586 Bacteria 8169
241 Ga0501072_0009610 3300049588 Bacteria 7354
242 Ga0501077_0001952 3300049593 Bacteria 12489
243 Ga0501080_0008009 3300049742 Bacteria 9576
244 Ga0501083_0005117 3300049744 Bacteria 9283
245 Ga0501035_0134297 3300049822 Bacteria 2155
246 Ga0501044_0005158 3300049823 Bacteria 14564
247 nmdc:mga05p37_563129_c1 3300050507 Bacteria 1294
248 nmdc:mga06r32_38617_c1 3300050510 Bacteria 4525
249 nmdc:mga08x19_2273_c1 3300050514 Bacteria 11695
250 nmdc:mga08x19_65014_c1 3300050514 Bacteria 2368
251 Ga0501084_0000401 3300054114 Bacteria 33405
252 Ga0501082_0002159 3300060353 Bacteria 17232
253 Ga0501082_0003344 3300060353 Bacteria 14005
254 Ga0265331_10031886
255 Ga0070683_100007583
256 Ga0070683_100025697
257 Ga0070666_10008014
258 Ga0070667_100023574
259 Ga0070663_100285287
260 Ga0070681_10000540
261 Ga0070681_10386505
262 Ga0068867_100009985
263 Ga0070699_100097749
264 Ga0070699_100146671
265 Ga0070679_100069916
266 Ga0070684_100008510
267 Ga0070684_100015376
268 Ga0070684_100130907
269 Ga0068853_100298823
270 Ga0070695_100248655
271 Ga0070696_100002788
272 Ga0068855_100019737
273 Ga0068855_100037106
274 Ga0068855_100057778
275 Ga0068855_100236532
276 Ga0068857_100091454
277 Ga0068856_100261727
278 Ga0068863_100044157
279 Ga0068863_100051473
280 Ga0068858_100049004
281 Ga0068860_100000959
282 Ga0070717_10004239
283 Ga0070717_10019110
284 Ga0070717_10029417
285 Ga0070717_10040590
286 Ga0070717_10158894
287 Ga0097621_100006772
288 Ga0097621_100088435
289 Ga0097621_100111126
290 Ga0068871_100004796
291 Ga0068871_100028566
292 Ga0068871_100118493
293 Ga0075431_100014684
294 Ga0075431_100045510
295 Ga0068865_100039389
296 Ga0075436_100001437
297 Ga0105240_10001221
298 Ga0105240_10004121
299 Ga0105240_10005585
300 Ga0105240_10018942
301 Ga0105240_10105525
302 Ga0105240_10192805
303 Ga0105240_10295855
304 Ga0105245_10007185
305 Ga0105245_10008299
306 Ga0105245_10126951
307 Ga0105247_10029543
308 Ga0105247_10054292
309 Ga0114129_10116704
310 Ga0105241_10014652
311 Ga0105241_10018679
312 Ga0105241_10035150
313 Ga0105242_10011856
314 Ga0105242_10019060
315 Ga0105248_10003696
316 Ga0105248_10012479
317 Ga0105248_10080486
318 Ga0105248_10130592
319 Ga0105237_10029456
320 Ga0105237_10052045
321 Ga0105238_10008445
322 Ga0105238_10040043
323 Ga0105238_10045972
324 Ga0105238_10102877
325 Ga0105239_10004875
326 Ga0105239_10013910
327 Ga0105239_10021195
328 Ga0105239_10024690
329 Ga0105239_10063834
330 Ga0157370_10021747
331 Ga0157370_10023666
332 Ga0157369_10053478
333 Ga0157369_10219542
334 Ga0157378_10002202
335 Ga0157378_10080672
336 Ga0157378_10379430
337 Ga0163162_10035870
338 Ga0163162_10428562
339 Ga0157372_10206986
340 Ga0157372_10308917
341 Ga0157375_10119360
342 Ga0163163_10019402
343 Ga0163163_10023004
344 Ga0163163_10125525
345 Ga0163163_10310694
346 Ga0157379_10369885
347 Ga0157376_10241862
348 Ga0213875_10014304
349 Ga0213875_10017100
350 Ga0207680_10085445
351 Ga0207707_10002578
352 Ga0207707_10005871
353 Ga0207707_10109760
354 Ga0207695_10001253
355 Ga0207695_10013652
356 Ga0207695_10022099
357 Ga0207695_10043561
358 Ga0207695_10097358
359 Ga0207695_10185328
360 Ga0207671_10015333
361 Ga0207657_10014726
362 Ga0207649_10153462
363 Ga0207652_10241545
364 Ga0207652_10259342
365 Ga0207694_10002133
366 Ga0207694_10027534
367 Ga0207694_10176904
368 Ga0207687_10015165
369 Ga0207687_10039572
370 Ga0207687_10212533
371 Ga0207700_10072447
372 Ga0207700_10147916
373 Ga0207686_10027248
374 Ga0207686_10041581
375 Ga0207686_10133475
376 Ga0207709_10015875
377 Ga0207704_10020716
378 Ga0207711_10056977
379 Ga0207711_10168779
380 Ga0207661_10004933
381 Ga0207661_10022595
382 Ga0207661_10025783
383 Ga0207661_10099124
384 Ga0207679_10307218
385 Ga0207667_10006635
386 Ga0207667_10257747
387 Ga0207658_10025201
388 Ga0207703_10005818
389 Ga0207702_10013008
390 Ga0207702_10037772
391 Ga0207702_10163617
392 Ga0207641_10008866
393 Ga0207648_10005862
394 Ga0207674_10003813
395 Ga0207674_10008558
396 Ga0207683_10098582
397 Ga0268266_10011572
398 Ga0268264_10003149
399 Ga0268264_10129181
400 Ga0265323_10001561
401 Ga0265338_10027274
402 Ga0265338_10173441
403 Ga0265762_1005964
404 Ga0265330_10059605
405 Ga0265332_10025726
406 Ga0265320_10023004
407 Ga0265325_10004982
408 Ga0265325_10069900
409 Ga0265329_10014587
410 Ga0265340_10021428
411 Ga0265339_10013259
412 Ga0265331_10070988
413 Ga0265316_10108545
414 Ga0265316_10196036
415 Ga0265314_10004381
416 Ga0265342_10030528
417 Ga0265342_10108235
418 Ga0373926_0019328
419 Ga0373943_0061977
420 Ga0373955_0040979
421 Ga0373935_0094909
422 Ga0373927_0008710
423 Ga0373927_0011888
424 Ga0373927_0012100
425 Ga0373927_0198048
426 Ga0373933_0032930
427 Ga0373947_0015820
428 Ga0373947_0043766
429 Ga0373947_0077848
430 Ga0373947_0154139
431 Ga0373937_0060971
432 Ga0373925_0000656
433 Ga0373925_0093450
434 Ga0373925_0150562
435 Ga0436364_0527022
436 Ga0436364_0998402
437 Ga0436364_1418043
438 Ga0436364_1421314
439 Ga0436365_0408432
440 Ga0436365_1203486
441 Ga0451576_0036052
442 Ga0495592_0002900
443 Ga0495651_0042684
444 Ga0495653_0029375
445 Ga0495580_0001281
446 Ga0495580_0018462
447 Ga0495580_0028623
448 Ga0495580_0032375
449 Ga0495582_0168656
450 Ga0495662_0001283
451 Ga0495664_0177517
452 Ga0495608_0098215
453 Ga0495618_0047549
454 Ga0495628_0001601
455 Ga0495630_0008118
456 Ga0495652_0008585
457 Ga0495665_0036025
458 Ga0495640_0018349
459 Ga0495586_0091274
460 Ga0495587_0082485
461 Ga0495645_0009814
462 Ga0495645_0017089
463 Ga0495645_0127856
464 Ga0495667_0199098
465 Ga0495634_0017192
466 Ga0495635_0003174
467 Ga0495599_0016656
468 Ga0495623_0015809
469 Ga0495623_0121388
470 Ga0495646_0147394
471 Ga0495613_0101345
472 Ga0495624_0126219
473 Ga0495600_0162142
474 Ga0495604_0049501
475 Ga0495674_0002515
476 Ga0495674_0002584
477 Ga0495680_0006774
478 Ga0495684_0043526
479 Ga0495684_0058128
480 Ga0495684_0099422
481 Ga0495684_0174800
482 Ga0495602_0050298
483 Ga0496126_0026310
484 Ga0501032_0003420
485 Ga0501033_0050086
486 Ga0501038_0003666
487 Ga0501039_0034059
488 Ga0501046_0003236
489 Ga0501048_0060643
490 Ga0501067_0000291
491 Ga0501068_0000416
492 Ga0501069_0008145
493 Ga0501070_0009612
494 Ga0501072_0009610
495 Ga0501077_0001952
496 Ga0501080_0008009
497 Ga0501083_0005117
498 Ga0501035_0134297
499 Ga0501044_0005158
500 nmdc:mga05p37_563129_c1
501 nmdc:mga06r32_38617_c1
502 nmdc:mga08x19_2273_c1
503 nmdc:mga08x19_65014_c1
504 Ga0501084_0000401
505 Ga0501082_0002159
506 Ga0501082_0003344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

44

380

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.9193 21 379
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.9117 22 379
5b7s-assembly1.cif.gz_A apo structure of cysteine desulfurase from thermococcus onnurineus na1 0.9102 22 379
7tlq-assembly1.cif.gz_A structure of atopobium parvulum sufs c375s 0.9059 19 380
7tlq-assembly1.cif.gz_B structure of atopobium parvulum sufs c375s 0.9041 19 380
ID Description Score Start End Superfamily
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9021 44 284 3.40.640.10
1elqB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9014 44 290 3.40.640.10
3caiB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8924 300 380 3.90.1150.10
af_P9WQ67_288_398_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8906 300 380 3.90.1150.10
af_Q2FXV4_28_254_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8881 64 288 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A517XMZ5-F1-model_v4 Putative cysteine desulfurase (EC 2.8.1.7) 0.9614 16 380 GO:0031071
AF-A0A0S7X133-F1-model_v4 Aminotransferase class V domain-containing protein 0.955 32 381
AF-A0A3D4Z214-F1-model_v4 Aminotransferase 0.954 16 380 GO:0008483
AF-A0A3L7TVT5-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9535 16 380 GO:0008483
AF-A0A455SWA8-F1-model_v4 Cysteine desulfurase 0.9535 18 380

Map