F364019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 176 | 253 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10000278|Ga0105247_1000027811 |
| Length | 248 |
| Sequence | VILYPAIDIHGGQAVRLLQGDYERETTYDADPVDAAARWAGEGAEILHVVDLDGAKAGAPRNLDAIGRIAAAVECPIQVGGGLRDASSVDAVLATGAARVVIGTAALRDPKFLAATLERHGDRVVVSVDARDGKVSLSGWTETSDVDVADAVADLGRRGVSRFLCTAIEVDGTMEGPALAELARIAAATPAQLIASGGVGTLSHLESLATLAQDHPNLEGAIVGRALYEKKFTVSQALTSLATPRNDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 96 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 97 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 175 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 176 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 13.04 |
| Rhizosphere | 83.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000666 | 3300001977 | Bacteria | 5271 |
| 2 | JGI24740J21852_10005027 | 3300001979 | Bacteria | 5615 |
| 3 | JGI25404J52841_10003613 | 3300003659 | Bacteria | 3071 |
| 4 | Ga0070683_100001863 | 3300005329 | Bacteria | 16460 |
| 5 | Ga0070683_100006989 | 3300005329 | Bacteria | 9496 |
| 6 | Ga0070677_10000929 | 3300005333 | Bacteria | 9566 |
| 7 | Ga0070682_100000398 | 3300005337 | Bacteria | 29064 |
| 8 | Ga0068868_100002153 | 3300005338 | Bacteria | 13606 |
| 9 | Ga0070691_10000021 | 3300005341 | Bacteria | 45268 |
| 10 | Ga0070661_100000616 | 3300005344 | Bacteria | 26479 |
| 11 | Ga0070692_10084024 | 3300005345 | Bacteria | 1720 |
| 12 | Ga0070668_100495663 | 3300005347 | Bacteria | 1057 |
| 13 | Ga0070674_100000235 | 3300005356 | Bacteria | 27333 |
| 14 | Ga0070674_100056248 | 3300005356 | Bacteria | 2728 |
| 15 | Ga0070673_100002236 | 3300005364 | Bacteria | 11711 |
| 16 | Ga0070688_100000027 | 3300005365 | Bacteria | 67477 |
| 17 | Ga0070688_100000373 | 3300005365 | Bacteria | 22710 |
| 18 | Ga0070659_100009327 | 3300005366 | Bacteria | 7207 |
| 19 | Ga0070711_100000944 | 3300005439 | Bacteria | 15375 |
| 20 | Ga0070663_100171987 | 3300005455 | Bacteria | 1675 |
| 21 | Ga0070678_100161901 | 3300005456 | Bacteria | 1814 |
| 22 | Ga0070681_10036375 | 3300005458 | Bacteria | 4944 |
| 23 | Ga0068867_100000226 | 3300005459 | Bacteria | 36850 |
| 24 | Ga0070685_10000665 | 3300005466 | Bacteria | 18706 |
| 25 | Ga0070685_10000791 | 3300005466 | Bacteria | 17160 |
| 26 | Ga0070706_100347891 | 3300005467 | Bacteria | 1382 |
| 27 | Ga0070707_100008728 | 3300005468 | Bacteria | 9398 |
| 28 | Ga0070684_100004796 | 3300005535 | Bacteria | 10332 |
| 29 | Ga0070684_100076040 | 3300005535 | Bacteria | 2963 |
| 30 | Ga0070684_100106959 | 3300005535 | Bacteria | 2505 |
| 31 | Ga0070684_100321700 | 3300005535 | Bacteria | 1421 |
| 32 | Ga0070693_100002588 | 3300005547 | Bacteria | 8331 |
| 33 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 34 | Ga0068855_100621890 | 3300005563 | Bacteria | 1163 |
| 35 | Ga0068854_100000116 | 3300005578 | Bacteria | 54986 |
| 36 | Ga0068854_100010644 | 3300005578 | Bacteria | 5969 |
| 37 | Ga0068856_100032534 | 3300005614 | Bacteria | 5106 |
| 38 | Ga0068852_100000056 | 3300005616 | Bacteria | 76111 |
| 39 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 40 | Ga0068851_10001239 | 3300005834 | Bacteria | 11087 |
| 41 | Ga0068863_100003052 | 3300005841 | Bacteria | 16547 |
| 42 | Ga0068863_100111984 | 3300005841 | Bacteria | 2599 |
| 43 | Ga0068858_100000142 | 3300005842 | Bacteria | 75787 |
| 44 | Ga0068858_100017173 | 3300005842 | Bacteria | 6791 |
| 45 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 46 | Ga0075433_10001387 | 3300006852 | Bacteria | 17846 |
| 47 | Ga0068865_100000856 | 3300006881 | Bacteria | 17257 |
| 48 | Ga0105245_10000141 | 3300009098 | Bacteria | 68413 |
| 49 | Ga0105245_10000720 | 3300009098 | Bacteria | 29809 |
| 50 | Ga0105245_10002008 | 3300009098 | Bacteria | 18469 |
| 51 | Ga0105245_10002406 | 3300009098 | Bacteria | 16922 |
| 52 | Ga0105247_10000278 | 3300009101 | Bacteria | 47180 |
| 53 | Ga0105247_10153299 | 3300009101 | Bacteria | 1520 |
| 54 | Ga0105242_10000533 | 3300009176 | Bacteria | 30003 |
| 55 | Ga0105242_10001792 | 3300009176 | Bacteria | 16941 |
| 56 | Ga0105242_10088987 | 3300009176 | Bacteria | 2594 |
| 57 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 58 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 59 | Ga0105249_10000332 | 3300009553 | Bacteria | 47770 |
| 60 | Ga0105249_10779421 | 3300009553 | Bacteria | 1019 |
| 61 | Ga0105239_10145528 | 3300010375 | Bacteria | 2642 |
| 62 | Ga0105239_10787507 | 3300010375 | Bacteria | 1089 |
| 63 | Ga0157370_10050111 | 3300013104 | Bacteria | 3993 |
| 64 | Ga0157369_10004884 | 3300013105 | Bacteria | 15723 |
| 65 | Ga0157374_10107639 | 3300013296 | Bacteria | 2679 |
| 66 | Ga0157378_10054231 | 3300013297 | Bacteria | 3570 |
| 67 | Ga0157372_10006142 | 3300013307 | Bacteria | 12762 |
| 68 | Ga0157375_10000349 | 3300013308 | Bacteria | 41764 |
| 69 | Ga0157375_10006515 | 3300013308 | Bacteria | 10163 |
| 70 | Ga0157380_10000391 | 3300014326 | Bacteria | 26465 |
| 71 | Ga0157380_10006499 | 3300014326 | Bacteria | 8241 |
| 72 | Ga0157379_10003315 | 3300014968 | Bacteria | 13639 |
| 73 | Ga0157379_10254174 | 3300014968 | Bacteria | 1596 |
| 74 | Ga0206353_11082320 | 3300020082 | Bacteria | 1762 |
| 75 | Ga0207656_10000701 | 3300025321 | Bacteria | 10978 |
| 76 | Ga0207682_10000022 | 3300025893 | Bacteria | 62630 |
| 77 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 78 | Ga0207710_10000695 | 3300025900 | Bacteria | 18840 |
| 79 | Ga0207684_10344010 | 3300025910 | Bacteria | 1284 |
| 80 | Ga0207654_10046185 | 3300025911 | Bacteria | 2482 |
| 81 | Ga0207707_10060884 | 3300025912 | Bacteria | 3284 |
| 82 | Ga0207671_10311346 | 3300025914 | Bacteria | 1245 |
| 83 | Ga0207663_10029391 | 3300025916 | Bacteria | 3228 |
| 84 | Ga0207649_10000189 | 3300025920 | Bacteria | 50504 |
| 85 | Ga0207652_10001961 | 3300025921 | Bacteria | 17798 |
| 86 | Ga0207646_10008853 | 3300025922 | Bacteria | 10029 |
| 87 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 88 | Ga0207650_10082409 | 3300025925 | Bacteria | 2442 |
| 89 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 90 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 91 | Ga0207687_10000073 | 3300025927 | Bacteria | 73917 |
| 92 | Ga0207687_10002476 | 3300025927 | Bacteria | 12542 |
| 93 | Ga0207690_10028317 | 3300025932 | Bacteria | 3551 |
| 94 | Ga0207686_10000073 | 3300025934 | Bacteria | 92009 |
| 95 | Ga0207686_10002485 | 3300025934 | Bacteria | 10010 |
| 96 | Ga0207686_10059201 | 3300025934 | Bacteria | 2419 |
| 97 | Ga0207669_10000182 | 3300025937 | Bacteria | 29102 |
| 98 | Ga0207669_10069030 | 3300025937 | Bacteria | 2210 |
| 99 | Ga0207669_10223531 | 3300025937 | Bacteria | 1384 |
| 100 | Ga0207704_10000049 | 3300025938 | Bacteria | 83173 |
| 101 | Ga0207704_10286415 | 3300025938 | Bacteria | 1255 |
| 102 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 103 | Ga0207661_10000278 | 3300025944 | Bacteria | 32703 |
| 104 | Ga0207661_10000312 | 3300025944 | Bacteria | 30978 |
| 105 | Ga0207661_10002137 | 3300025944 | Bacteria | 13604 |
| 106 | Ga0207651_10000807 | 3300025960 | Bacteria | 13511 |
| 107 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 108 | Ga0207668_10307698 | 3300025972 | Bacteria | 1310 |
| 109 | Ga0207640_10000134 | 3300025981 | Bacteria | 54961 |
| 110 | Ga0207640_10003392 | 3300025981 | Bacteria | 8582 |
| 111 | Ga0207677_10000374 | 3300026023 | Bacteria | 31092 |
| 112 | Ga0207703_10000103 | 3300026035 | Bacteria | 99918 |
| 113 | Ga0207703_10001891 | 3300026035 | Bacteria | 18577 |
| 114 | Ga0207678_10129321 | 3300026067 | Bacteria | 2154 |
| 115 | Ga0207702_10000368 | 3300026078 | Bacteria | 51559 |
| 116 | Ga0207702_10025200 | 3300026078 | Bacteria | 4936 |
| 117 | Ga0207641_10002193 | 3300026088 | Bacteria | 18362 |
| 118 | Ga0207648_10000907 | 3300026089 | Bacteria | 33370 |
| 119 | Ga0207683_10148139 | 3300026121 | Bacteria | 2118 |
| 120 | Ga0207698_10000101 | 3300026142 | Bacteria | 54530 |
| 121 | Ga0207698_10774817 | 3300026142 | Bacteria | 960 |
| 122 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 123 | Ga0268264_10512639 | 3300028381 | Bacteria | 1171 |
| 124 | Ga0265326_10000514 | 3300028558 | Bacteria | 14873 |
| 125 | Ga0265319_1000105 | 3300028563 | Bacteria | 65502 |
| 126 | Ga0265322_10000029 | 3300028654 | Bacteria | 82867 |
| 127 | Ga0265338_10000507 | 3300028800 | Bacteria | 69026 |
| 128 | Ga0265324_10002839 | 3300029957 | Bacteria | 8532 |
| 129 | Ga0265328_10001443 | 3300031239 | Bacteria | 10944 |
| 130 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 131 | Ga0265325_10101184 | 3300031241 | Bacteria | 1410 |
| 132 | Ga0265329_10003728 | 3300031242 | Bacteria | 6562 |
| 133 | Ga0265339_10007254 | 3300031249 | Bacteria | 7183 |
| 134 | Ga0265331_10000839 | 3300031250 | Bacteria | 25044 |
| 135 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 136 | Ga0265316_10023033 | 3300031344 | Bacteria | 5239 |
| 137 | Ga0265314_10000361 | 3300031711 | Bacteria | 63269 |
| 138 | Ga0307415_100104794 | 3300032126 | Bacteria | 2084 |
| 139 | Ga0373937_0033843 | 3300036401 | Bacteria | 4645 |
| 140 | Ga0466963_0000008 | 3300044694 | Bacteria | 74916 |
| 141 | Ga0466957_0011461 | 3300044842 | Bacteria | 5116 |
| 142 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 143 | Ga0495592_0003688 | 3300046454 | Bacteria | 11039 |
| 144 | Ga0495603_0002286 | 3300046455 | Bacteria | 11264 |
| 145 | Ga0495603_0003584 | 3300046455 | Bacteria | 9243 |
| 146 | Ga0495629_0007301 | 3300046459 | Bacteria | 8140 |
| 147 | Ga0495641_0010982 | 3300046461 | Bacteria | 5199 |
| 148 | Ga0495653_0048925 | 3300046463 | Bacteria | 3260 |
| 149 | Ga0495653_0060202 | 3300046463 | Bacteria | 2878 |
| 150 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 151 | Ga0495582_0152781 | 3300046473 | Bacteria | 1311 |
| 152 | Ga0495662_0000304 | 3300046476 | Bacteria | 21364 |
| 153 | Ga0495662_0034404 | 3300046476 | Bacteria | 2446 |
| 154 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 155 | Ga0495618_0000091 | 3300046514 | Bacteria | 64654 |
| 156 | Ga0495628_0009218 | 3300046516 | Bacteria | 8434 |
| 157 | Ga0495628_0022401 | 3300046516 | Bacteria | 5189 |
| 158 | Ga0495628_0325158 | 3300046516 | Bacteria | 1134 |
| 159 | Ga0495630_0000075 | 3300046517 | Bacteria | 77378 |
| 160 | Ga0495630_0000454 | 3300046517 | Bacteria | 31035 |
| 161 | Ga0495630_0539916 | 3300046517 | Bacteria | 894 |
| 162 | Ga0495644_0000176 | 3300046523 | Bacteria | 30116 |
| 163 | Ga0495652_0077900 | 3300046529 | Bacteria | 2746 |
| 164 | Ga0495640_0031442 | 3300046533 | Bacteria | 3788 |
| 165 | Ga0495586_0003640 | 3300046535 | Bacteria | 8261 |
| 166 | Ga0495587_0034876 | 3300046536 | Bacteria | 3033 |
| 167 | Ga0495621_0000973 | 3300046539 | Bacteria | 7304 |
| 168 | Ga0495645_0079497 | 3300046543 | Bacteria | 2355 |
| 169 | Ga0495645_0188534 | 3300046543 | Bacteria | 1407 |
| 170 | Ga0495622_0000021 | 3300046557 | Bacteria | 162267 |
| 171 | Ga0495668_0062124 | 3300046616 | Bacteria | 2059 |
| 172 | Ga0495634_0002062 | 3300046642 | Bacteria | 16995 |
| 173 | Ga0495634_0006592 | 3300046642 | Bacteria | 8806 |
| 174 | Ga0495657_0002416 | 3300046675 | Bacteria | 15729 |
| 175 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 176 | Ga0495658_0010671 | 3300046683 | Bacteria | 4600 |
| 177 | Ga0495669_0000143 | 3300046684 | Bacteria | 45428 |
| 178 | Ga0495613_0003350 | 3300046689 | Bacteria | 11976 |
| 179 | Ga0495613_0117504 | 3300046689 | Bacteria | 1912 |
| 180 | Ga0495613_0127523 | 3300046689 | Bacteria | 1824 |
| 181 | Ga0495624_0009962 | 3300046690 | Bacteria | 6571 |
| 182 | Ga0495600_0002071 | 3300046809 | Bacteria | 11318 |
| 183 | Ga0495581_0021800 | 3300047315 | Bacteria | 3712 |
| 184 | Ga0495604_0042490 | 3300047317 | Bacteria | 3562 |
| 185 | Ga0495674_0000059 | 3300047319 | Bacteria | 73353 |
| 186 | Ga0495676_0326226 | 3300047321 | Bacteria | 1030 |
| 187 | Ga0495676_0329910 | 3300047321 | Bacteria | 1023 |
| 188 | Ga0495680_0000212 | 3300047322 | Bacteria | 63418 |
| 189 | Ga0495680_0093126 | 3300047322 | Bacteria | 2256 |
| 190 | Ga0495685_003922 | 3300047447 | Bacteria | 4775 |
| 191 | Ga0495593_0018850 | 3300047673 | Bacteria | 3873 |
| 192 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 193 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 194 | Ga0496102_0000522 | 3300048905 | Bacteria | 41862 |
| 195 | Ga0496102_0559211 | 3300048905 | Bacteria | 1067 |
| 196 | Ga0496103_0000174 | 3300048906 | Bacteria | 67124 |
| 197 | Ga0496103_0007177 | 3300048906 | Bacteria | 6644 |
| 198 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 199 | Ga0496104_0001566 | 3300048907 | Bacteria | 19685 |
| 200 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 201 | Ga0496105_0014608 | 3300048908 | Bacteria | 6253 |
| 202 | Ga0496105_0030922 | 3300048908 | Bacteria | 4389 |
| 203 | Ga0496106_0000062 | 3300048909 | Bacteria | 85769 |
| 204 | Ga0496106_0143412 | 3300048909 | Bacteria | 1880 |
| 205 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 206 | Ga0496107_0068721 | 3300048910 | Bacteria | 2571 |
| 207 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 208 | Ga0496108_0000137 | 3300048911 | Bacteria | 70783 |
| 209 | Ga0496108_0002452 | 3300048911 | Bacteria | 14837 |
| 210 | Ga0496108_0030696 | 3300048911 | Bacteria | 4453 |
| 211 | Ga0496108_0399265 | 3300048911 | Bacteria | 1201 |
| 212 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 213 | Ga0496109_0000088 | 3300048912 | Bacteria | 94877 |
| 214 | Ga0496109_0000218 | 3300048912 | Bacteria | 56316 |
| 215 | Ga0496109_0006784 | 3300048912 | Bacteria | 9645 |
| 216 | Ga0496109_0179529 | 3300048912 | Bacteria | 1988 |
| 217 | Ga0496109_0645711 | 3300048912 | Bacteria | 995 |
| 218 | Ga0496110_0008595 | 3300048913 | Bacteria | 8223 |
| 219 | Ga0496111_0004875 | 3300048914 | Bacteria | 8519 |
| 220 | Ga0496111_0062027 | 3300048914 | Bacteria | 2711 |
| 221 | Ga0496111_0089603 | 3300048914 | Bacteria | 2253 |
| 222 | Ga0496112_0108686 | 3300048915 | Bacteria | 2744 |
| 223 | Ga0496113_0374604 | 3300048916 | Bacteria | 1142 |
| 224 | Ga0496114_0009804 | 3300048917 | Bacteria | 7611 |
| 225 | Ga0496118_0270316 | 3300048921 | Bacteria | 953 |
| 226 | Ga0496119_0013376 | 3300048922 | Bacteria | 6547 |
| 227 | Ga0496119_0022041 | 3300048922 | Bacteria | 4578 |
| 228 | Ga0496120_0008785 | 3300048923 | Bacteria | 7261 |
| 229 | Ga0496121_0019917 | 3300048924 | Bacteria | 6677 |
| 230 | Ga0496125_0079612 | 3300048928 | Bacteria | 2513 |
| 231 | Ga0501042_0037609 | 3300049578 | Bacteria | 3435 |
| 232 | Ga0501068_0488156 | 3300049584 | Bacteria | 798 |
| 233 | Ga0501070_0087307 | 3300049586 | Bacteria | 2582 |
| 234 | Ga0501075_0004637 | 3300049591 | Bacteria | 9327 |
| 235 | Ga0501076_0088349 | 3300049592 | Bacteria | 2491 |
| 236 | nmdc:mga0rr50_616862_c1 | 3300050513 | Bacteria | 925 |
| 237 | nmdc:mga0a205_521_c1 | 3300050515 | Bacteria | 18797 |
| 238 | Ga0495601_0006880 | 3300053077 | Bacteria | 6662 |
| 239 | Ga0495601_0013268 | 3300053077 | Bacteria | 4953 |
| 240 | Ga0495601_0015093 | 3300053077 | Bacteria | 4665 |
| 241 | Ga0495612_0001034 | 3300053078 | Bacteria | 11410 |
| 242 | Ga0495612_0002167 | 3300053078 | Bacteria | 8080 |
| 243 | Ga0495612_0037711 | 3300053078 | Bacteria | 1963 |
| 244 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 245 | Ga0495655_0001079 | 3300053083 | Bacteria | 4215 |
| 246 | Ga0495595_0000178 | 3300053084 | Bacteria | 25404 |
| 247 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 248 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 249 | Ga0495619_0000084 | 3300053085 | Bacteria | 70164 |
| 250 | Ga0495619_0000680 | 3300053085 | Bacteria | 22263 |
| 251 | Ga0500641_0006156 | 3300053096 | Bacteria | 4253 |
| 252 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 253 | Ga0501082_0527142 | 3300060353 | Bacteria | 1033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10050111 | Ga0157370_100501113 | 187 |
| 2 | 3300005455 | Ga0070663_100171987 | Ga0070663_1001719872 | 188 |
| 3 | 3300005842 | Ga0068858_100017173 | Ga0068858_1000171733 | 188 |
| 4 | 3300009176 | Ga0105242_10088987 | Ga0105242_100889873 | 188 |
| 5 | 3300025934 | Ga0207686_10059201 | Ga0207686_100592013 | 188 |
| 6 | 3300026035 | Ga0207703_10000103 | Ga0207703_1000010311 | 188 |
| 7 | 3300026067 | Ga0207678_10129321 | Ga0207678_101293213 | 188 |
| 8 | 3300046516 | Ga0495628_0022401 | Ga0495628_0022401_292_1014 | 189 |
| 9 | 3300053085 | Ga0495619_0000010 | Ga0495619_0000010_7537_8262 | 189 |
| 10 | 3300006852 | Ga0075433_10001387 | Ga0075433_1000138716 | 190 |
| 11 | 3300013308 | Ga0157375_10000349 | Ga0157375_1000034910 | 190 |
| 12 | 3300050515 | nmdc:mga0a205_521_c1 | nmdc:mga0a205_521_c1_7049_7795 | 190 |
| 13 | 3300048911 | Ga0496108_0002452 | Ga0496108_0002452_7399_8121 | 191 |
| 14 | 3300048912 | Ga0496109_0000218 | Ga0496109_0000218_48209_48931 | 191 |
| 15 | 3300050513 | nmdc:mga0rr50_616862_c1 | nmdc:mga0rr50_616862_c1_140_859 | 198 |
| 16 | 3300053078 | Ga0495612_0001034 | Ga0495612_0001034_7593_8318 | 198 |
| 17 | 3300047322 | Ga0495680_0093126 | Ga0495680_0093126_616_1335 | 199 |
| 18 | 3300005333 | Ga0070677_10000929 | Ga0070677_100009292 | 200 |
| 19 | 3300005548 | Ga0070665_100000135 | Ga0070665_100000135132 | 200 |
| 20 | 3300005842 | Ga0068858_100000142 | Ga0068858_10000014280 | 200 |
| 21 | 3300009098 | Ga0105245_10000720 | Ga0105245_1000072012 | 200 |
| 22 | 3300025893 | Ga0207682_10000022 | Ga0207682_1000002212 | 200 |
| 23 | 3300025927 | Ga0207687_10000032 | Ga0207687_10000032133 | 200 |
| 24 | 3300026035 | Ga0207703_10001891 | Ga0207703_1000189120 | 200 |
| 25 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056281 | 200 |
| 26 | 3300046684 | Ga0495669_0000143 | Ga0495669_0000143_36135_36857 | 200 |
| 27 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_241475_242200 | 200 |
| 28 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_8563_9288 | 200 |
| 29 | 3300048928 | Ga0496125_0079612 | Ga0496125_0079612_962_1687 | 200 |
| 30 | 3300005341 | Ga0070691_10000021 | Ga0070691_1000002110 | 201 |
| 31 | 3300005578 | Ga0068854_100010644 | Ga0068854_1000106447 | 201 |
| 32 | 3300009553 | Ga0105249_10000332 | Ga0105249_1000033211 | 201 |
| 33 | 3300014968 | Ga0157379_10003315 | Ga0157379_1000331512 | 201 |
| 34 | 3300025961 | Ga0207712_10000058 | Ga0207712_1000005811 | 201 |
| 35 | 3300025981 | Ga0207640_10003392 | Ga0207640_100033928 | 201 |
| 36 | 3300046523 | Ga0495644_0000176 | Ga0495644_0000176_20868_21596 | 201 |
| 37 | 3300046459 | Ga0495629_0007301 | Ga0495629_0007301_7350_8081 | 202 |
| 38 | 3300047321 | Ga0495676_0329910 | Ga0495676_0329910_201_923 | 202 |
| 39 | 3300048917 | Ga0496114_0009804 | Ga0496114_0009804_5149_5871 | 202 |
| 40 | 3300053077 | Ga0495601_0015093 | Ga0495601_0015093_1059_1787 | 204 |
| 41 | 3300046517 | Ga0495630_0539916 | Ga0495630_0539916_131_862 | 205 |
| 42 | 3300053078 | Ga0495612_0037711 | Ga0495612_0037711_1194_1916 | 205 |
| 43 | 3300003659 | JGI25404J52841_10003613 | JGI25404J52841_100036132 | 206 |
| 44 | 3300005983 | Ga0081540_1000041 | Ga0081540_100004197 | 206 |
| 45 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_167982_168707 | 206 |
| 46 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_167982_168707 | 206 |
| 47 | 3300048909 | Ga0496106_0000062 | Ga0496106_0000062_76514_77239 | 206 |
| 48 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_139131_139856 | 206 |
| 49 | 3300049578 | Ga0501042_0037609 | Ga0501042_0037609_936_1664 | 207 |
| 50 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_7633_8370 | 210 |
| 51 | 3300046616 | Ga0495668_0062124 | Ga0495668_0062124_1182_1910 | 210 |
| 52 | 3300046535 | Ga0495586_0003640 | Ga0495586_0003640_2741_3466 | 211 |
| 53 | 3300009551 | Ga0105238_10000055 | Ga0105238_10000055130 | 212 |
| 54 | 3300025924 | Ga0207694_10000063 | Ga0207694_1000006312 | 212 |
| 55 | 3300046516 | Ga0495628_0009218 | Ga0495628_0009218_5825_6559 | 212 |
| 56 | 3300046675 | Ga0495657_0002416 | Ga0495657_0002416_9814_10548 | 212 |
| 57 | 3300048907 | Ga0496104_0001566 | Ga0496104_0001566_8825_9553 | 212 |
| 58 | 3300048908 | Ga0496105_0014608 | Ga0496105_0014608_4749_5477 | 212 |
| 59 | 3300049591 | Ga0501075_0004637 | Ga0501075_0004637_8357_9085 | 212 |
| 60 | 3300001979 | JGI24740J21852_10005027 | JGI24740J21852_100050277 | 213 |
| 61 | 3300005366 | Ga0070659_100009327 | Ga0070659_1000093273 | 213 |
| 62 | 3300005841 | Ga0068863_100003052 | Ga0068863_10000305212 | 213 |
| 63 | 3300010375 | Ga0105239_10787507 | Ga0105239_107875072 | 213 |
| 64 | 3300025914 | Ga0207671_10311346 | Ga0207671_103113462 | 213 |
| 65 | 3300025932 | Ga0207690_10028317 | Ga0207690_100283173 | 213 |
| 66 | 3300026088 | Ga0207641_10002193 | Ga0207641_1000219312 | 213 |
| 67 | 3300046476 | Ga0495662_0034404 | Ga0495662_0034404_803_1528 | 213 |
| 68 | 3300046689 | Ga0495613_0117504 | Ga0495613_0117504_834_1556 | 213 |
| 69 | 3300047315 | Ga0495581_0021800 | Ga0495581_0021800_1781_2509 | 213 |
| 70 | 3300047322 | Ga0495680_0000212 | Ga0495680_0000212_10174_10902 | 213 |
| 71 | 3300048908 | Ga0496105_0030922 | Ga0496105_0030922_555_1277 | 213 |
| 72 | 3300048909 | Ga0496106_0143412 | Ga0496106_0143412_753_1475 | 213 |
| 73 | 3300048910 | Ga0496107_0068721 | Ga0496107_0068721_692_1414 | 213 |
| 74 | 3300048911 | Ga0496108_0399265 | Ga0496108_0399265_383_1105 | 213 |
| 75 | 3300048922 | Ga0496119_0022041 | Ga0496119_0022041_2525_3247 | 213 |
| 76 | 3300048924 | Ga0496121_0019917 | Ga0496121_0019917_769_1491 | 213 |
| 77 | 3300005329 | Ga0070683_100006989 | Ga0070683_10000698912 | 214 |
| 78 | 3300005459 | Ga0068867_100000226 | Ga0068867_10000022639 | 214 |
| 79 | 3300005535 | Ga0070684_100076040 | Ga0070684_1000760403 | 214 |
| 80 | 3300009098 | Ga0105245_10002406 | Ga0105245_100024067 | 214 |
| 81 | 3300009176 | Ga0105242_10000533 | Ga0105242_1000053327 | 214 |
| 82 | 3300009553 | Ga0105249_10779421 | Ga0105249_107794212 | 214 |
| 83 | 3300025927 | Ga0207687_10002476 | Ga0207687_1000247611 | 214 |
| 84 | 3300025934 | Ga0207686_10000073 | Ga0207686_10000073104 | 214 |
| 85 | 3300025937 | Ga0207669_10223531 | Ga0207669_102235312 | 214 |
| 86 | 3300025944 | Ga0207661_10002137 | Ga0207661_1000213710 | 214 |
| 87 | 3300026089 | Ga0207648_10000907 | Ga0207648_1000090737 | 214 |
| 88 | 3300028558 | Ga0265326_10000514 | Ga0265326_1000051414 | 214 |
| 89 | 3300028563 | Ga0265319_1000105 | Ga0265319_10001059 | 214 |
| 90 | 3300028654 | Ga0265322_10000029 | Ga0265322_1000002984 | 214 |
| 91 | 3300028800 | Ga0265338_10000507 | Ga0265338_1000050765 | 214 |
| 92 | 3300029957 | Ga0265324_10002839 | Ga0265324_100028394 | 214 |
| 93 | 3300031239 | Ga0265328_10001443 | Ga0265328_100014438 | 214 |
| 94 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011260 | 214 |
| 95 | 3300031241 | Ga0265325_10101184 | Ga0265325_101011841 | 214 |
| 96 | 3300031242 | Ga0265329_10003728 | Ga0265329_100037285 | 214 |
| 97 | 3300031249 | Ga0265339_10007254 | Ga0265339_100072548 | 214 |
| 98 | 3300031250 | Ga0265331_10000839 | Ga0265331_1000083922 | 214 |
| 99 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015368 | 214 |
| 100 | 3300031344 | Ga0265316_10023033 | Ga0265316_100230336 | 214 |
| 101 | 3300031711 | Ga0265314_10000361 | Ga0265314_1000036170 | 214 |
| 102 | 3300044694 | Ga0466963_0000008 | Ga0466963_0000008_65683_66408 | 214 |
| 103 | 3300046455 | Ga0495603_0002286 | Ga0495603_0002286_1680_2402 | 214 |
| 104 | 3300046455 | Ga0495603_0003584 | Ga0495603_0003584_1106_1831 | 214 |
| 105 | 3300046463 | Ga0495653_0060202 | Ga0495653_0060202_1168_1890 | 214 |
| 106 | 3300046514 | Ga0495618_0000091 | Ga0495618_0000091_10455_11180 | 214 |
| 107 | 3300046516 | Ga0495628_0325158 | Ga0495628_0325158_165_887 | 214 |
| 108 | 3300046543 | Ga0495645_0079497 | Ga0495645_0079497_65_787 | 214 |
| 109 | 3300046543 | Ga0495645_0188534 | Ga0495645_0188534_141_863 | 214 |
| 110 | 3300046689 | Ga0495613_0003350 | Ga0495613_0003350_10303_11025 | 214 |
| 111 | 3300046690 | Ga0495624_0009962 | Ga0495624_0009962_4087_4809 | 214 |
| 112 | 3300046809 | Ga0495600_0002071 | Ga0495600_0002071_8671_9396 | 214 |
| 113 | 3300047447 | Ga0495685_003922 | Ga0495685_003922_2726_3454 | 214 |
| 114 | 3300048914 | Ga0496111_0089603 | Ga0496111_0089603_694_1416 | 214 |
| 115 | 3300048923 | Ga0496120_0008785 | Ga0496120_0008785_6255_6977 | 214 |
| 116 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_304348_305082 | 214 |
| 117 | 3300053084 | Ga0495595_0000178 | Ga0495595_0000178_20193_20915 | 214 |
| 118 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_393017_393751 | 214 |
| 119 | 3300005364 | Ga0070673_100002236 | Ga0070673_1000022363 | 215 |
| 120 | 3300013296 | Ga0157374_10107639 | Ga0157374_101076393 | 215 |
| 121 | 3300025960 | Ga0207651_10000807 | Ga0207651_100008075 | 215 |
| 122 | 3300046642 | Ga0495634_0006592 | Ga0495634_0006592_6630_7355 | 215 |
| 123 | 3300053085 | Ga0495619_0000047 | Ga0495619_0000047_7726_8448 | 215 |
| 124 | 3300005344 | Ga0070661_100000616 | Ga0070661_10000061623 | 216 |
| 125 | 3300005345 | Ga0070692_10084024 | Ga0070692_100840242 | 216 |
| 126 | 3300005365 | Ga0070688_100000027 | Ga0070688_10000002769 | 216 |
| 127 | 3300005456 | Ga0070678_100161901 | Ga0070678_1001619012 | 216 |
| 128 | 3300005466 | Ga0070685_10000791 | Ga0070685_1000079114 | 216 |
| 129 | 3300013307 | Ga0157372_10006142 | Ga0157372_100061426 | 216 |
| 130 | 3300013308 | Ga0157375_10006515 | Ga0157375_1000651513 | 216 |
| 131 | 3300025920 | Ga0207649_10000189 | Ga0207649_100001899 | 216 |
| 132 | 3300026121 | Ga0207683_10148139 | Ga0207683_101481392 | 216 |
| 133 | 3300044842 | Ga0466957_0011461 | Ga0466957_0011461_3675_4397 | 216 |
| 134 | 3300046454 | Ga0495592_0003688 | Ga0495592_0003688_880_1602 | 216 |
| 135 | 3300046539 | Ga0495621_0000973 | Ga0495621_0000973_5498_6229 | 216 |
| 136 | 3300047673 | Ga0495593_0018850 | Ga0495593_0018850_3054_3800 | 216 |
| 137 | 3300049584 | Ga0501068_0488156 | Ga0501068_0488156_41_778 | 216 |
| 138 | 3300049586 | Ga0501070_0087307 | Ga0501070_0087307_209_934 | 216 |
| 139 | 3300049592 | Ga0501076_0088349 | Ga0501076_0088349_848_1576 | 216 |
| 140 | 3300005337 | Ga0070682_100000398 | Ga0070682_10000039811 | 217 |
| 141 | 3300005338 | Ga0068868_100002153 | Ga0068868_10000215311 | 217 |
| 142 | 3300005578 | Ga0068854_100000116 | Ga0068854_10000011654 | 217 |
| 143 | 3300014326 | Ga0157380_10006499 | Ga0157380_1000649911 | 217 |
| 144 | 3300014968 | Ga0157379_10254174 | Ga0157379_102541742 | 217 |
| 145 | 3300025938 | Ga0207704_10286415 | Ga0207704_102864152 | 217 |
| 146 | 3300025981 | Ga0207640_10000134 | Ga0207640_1000013455 | 217 |
| 147 | 3300026023 | Ga0207677_10000374 | Ga0207677_1000037430 | 217 |
| 148 | 3300032126 | Ga0307415_100104794 | Ga0307415_1001047942 | 217 |
| 149 | 3300046476 | Ga0495662_0000304 | Ga0495662_0000304_3497_4219 | 217 |
| 150 | 3300048905 | Ga0496102_0559211 | Ga0496102_0559211_60_782 | 217 |
| 151 | 3300005356 | Ga0070674_100056248 | Ga0070674_1000562484 | 218 |
| 152 | 3300020082 | Ga0206353_11082320 | Ga0206353_110823201 | 218 |
| 153 | 3300025937 | Ga0207669_10069030 | Ga0207669_100690303 | 218 |
| 154 | 3300046529 | Ga0495652_0077900 | Ga0495652_0077900_1232_1960 | 218 |
| 155 | 3300046642 | Ga0495634_0002062 | Ga0495634_0002062_594_1319 | 218 |
| 156 | 3300048905 | Ga0496102_0000522 | Ga0496102_0000522_33421_34149 | 218 |
| 157 | 3300048906 | Ga0496103_0000174 | Ga0496103_0000174_6893_7621 | 218 |
| 158 | 3300048921 | Ga0496118_0270316 | Ga0496118_0270316_79_807 | 218 |
| 159 | 3300053077 | Ga0495601_0006880 | Ga0495601_0006880_5552_6280 | 218 |
| 160 | 3300005439 | Ga0070711_100000944 | Ga0070711_10000094415 | 219 |
| 161 | 3300005547 | Ga0070693_100002588 | Ga0070693_10000258812 | 219 |
| 162 | 3300025916 | Ga0207663_10029391 | Ga0207663_100293913 | 219 |
| 163 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_82041_82778 | 219 |
| 164 | 3300046557 | Ga0495622_0000021 | Ga0495622_0000021_152442_153179 | 219 |
| 165 | 3300009176 | Ga0105242_10001792 | Ga0105242_100017929 | 220 |
| 166 | 3300025934 | Ga0207686_10002485 | Ga0207686_100024855 | 220 |
| 167 | 3300005347 | Ga0070668_100495663 | Ga0070668_1004956632 | 224 |
| 168 | 3300005467 | Ga0070706_100347891 | Ga0070706_1003478911 | 224 |
| 169 | 3300005468 | Ga0070707_100008728 | Ga0070707_1000087288 | 224 |
| 170 | 3300005841 | Ga0068863_100111984 | Ga0068863_1001119842 | 224 |
| 171 | 3300009101 | Ga0105247_10153299 | Ga0105247_101532992 | 224 |
| 172 | 3300025910 | Ga0207684_10344010 | Ga0207684_103440102 | 224 |
| 173 | 3300025922 | Ga0207646_10008853 | Ga0207646_100088535 | 224 |
| 174 | 3300025972 | Ga0207668_10307698 | Ga0207668_103076982 | 224 |
| 175 | 3300048906 | Ga0496103_0007177 | Ga0496103_0007177_231_968 | 224 |
| 176 | 3300005614 | Ga0068856_100032534 | Ga0068856_1000325342 | 228 |
| 177 | 3300026078 | Ga0207702_10025200 | Ga0207702_100252005 | 228 |
| 178 | 3300046689 | Ga0495613_0127523 | Ga0495613_0127523_724_1452 | 230 |
| 179 | 3300036401 | Ga0373937_0033843 | Ga0373937_0033843_2656_3408 | 231 |
| 180 | 3300047317 | Ga0495604_0042490 | Ga0495604_0042490_1579_2331 | 231 |
| 181 | 3300053085 | Ga0495619_0000084 | Ga0495619_0000084_68526_69257 | 232 |
| 182 | 3300001977 | JGI24746J21847_1000666 | JGI24746J21847_10006664 | 239 |
| 183 | 3300005329 | Ga0070683_100001863 | Ga0070683_10000186315 | 239 |
| 184 | 3300005356 | Ga0070674_100000235 | Ga0070674_10000023511 | 239 |
| 185 | 3300005365 | Ga0070688_100000373 | Ga0070688_10000037325 | 239 |
| 186 | 3300005458 | Ga0070681_10036375 | Ga0070681_100363756 | 239 |
| 187 | 3300005466 | Ga0070685_10000665 | Ga0070685_1000066514 | 239 |
| 188 | 3300005535 | Ga0070684_100004796 | Ga0070684_1000047966 | 239 |
| 189 | 3300005535 | Ga0070684_100106959 | Ga0070684_1001069594 | 239 |
| 190 | 3300005535 | Ga0070684_100321700 | Ga0070684_1003217001 | 239 |
| 191 | 3300005563 | Ga0068855_100621890 | Ga0068855_1006218901 | 239 |
| 192 | 3300005616 | Ga0068852_100000056 | Ga0068852_10000005610 | 239 |
| 193 | 3300005718 | Ga0068866_10000008 | Ga0068866_1000000811 | 239 |
| 194 | 3300005834 | Ga0068851_10001239 | Ga0068851_100012392 | 239 |
| 195 | 3300006881 | Ga0068865_100000856 | Ga0068865_10000085613 | 239 |
| 196 | 3300009098 | Ga0105245_10000141 | Ga0105245_1000014168 | 239 |
| 197 | 3300009098 | Ga0105245_10002008 | Ga0105245_1000200812 | 239 |
| 198 | 3300009101 | Ga0105247_10000278 | Ga0105247_1000027811 | 239 |
| 199 | 3300009177 | Ga0105248_10000020 | Ga0105248_1000002010 | 239 |
| 200 | 3300010375 | Ga0105239_10145528 | Ga0105239_101455282 | 239 |
| 201 | 3300013105 | Ga0157369_10004884 | Ga0157369_1000488410 | 239 |
| 202 | 3300013297 | Ga0157378_10054231 | Ga0157378_100542314 | 239 |
| 203 | 3300014326 | Ga0157380_10000391 | Ga0157380_100003913 | 239 |
| 204 | 3300025321 | Ga0207656_10000701 | Ga0207656_100007012 | 239 |
| 205 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002658 | 239 |
| 206 | 3300025900 | Ga0207710_10000695 | Ga0207710_100006959 | 239 |
| 207 | 3300025911 | Ga0207654_10046185 | Ga0207654_100461852 | 239 |
| 208 | 3300025912 | Ga0207707_10060884 | Ga0207707_100608842 | 239 |
| 209 | 3300025921 | Ga0207652_10001961 | Ga0207652_1000196115 | 239 |
| 210 | 3300025925 | Ga0207650_10082409 | Ga0207650_100824092 | 239 |
| 211 | 3300025927 | Ga0207687_10000036 | Ga0207687_1000003610 | 239 |
| 212 | 3300025927 | Ga0207687_10000073 | Ga0207687_1000007312 | 239 |
| 213 | 3300025937 | Ga0207669_10000182 | Ga0207669_1000018211 | 239 |
| 214 | 3300025938 | Ga0207704_10000049 | Ga0207704_1000004983 | 239 |
| 215 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006365 | 239 |
| 216 | 3300025944 | Ga0207661_10000278 | Ga0207661_1000027811 | 239 |
| 217 | 3300025944 | Ga0207661_10000312 | Ga0207661_1000031235 | 239 |
| 218 | 3300026078 | Ga0207702_10000368 | Ga0207702_1000036852 | 239 |
| 219 | 3300026142 | Ga0207698_10000101 | Ga0207698_1000010110 | 239 |
| 220 | 3300026142 | Ga0207698_10774817 | Ga0207698_107748172 | 239 |
| 221 | 3300028381 | Ga0268264_10512639 | Ga0268264_105126392 | 239 |
| 222 | 3300046461 | Ga0495641_0010982 | Ga0495641_0010982_659_1381 | 239 |
| 223 | 3300046463 | Ga0495653_0048925 | Ga0495653_0048925_2254_2988 | 239 |
| 224 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_175678_176403 | 239 |
| 225 | 3300046473 | Ga0495582_0152781 | Ga0495582_0152781_407_1132 | 239 |
| 226 | 3300046517 | Ga0495630_0000075 | Ga0495630_0000075_69907_70629 | 239 |
| 227 | 3300046517 | Ga0495630_0000454 | Ga0495630_0000454_21571_22296 | 239 |
| 228 | 3300046533 | Ga0495640_0031442 | Ga0495640_0031442_125_853 | 239 |
| 229 | 3300046536 | Ga0495587_0034876 | Ga0495587_0034876_953_1681 | 239 |
| 230 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_299284_300009 | 239 |
| 231 | 3300046683 | Ga0495658_0010671 | Ga0495658_0010671_3194_3916 | 239 |
| 232 | 3300047319 | Ga0495674_0000059 | Ga0495674_0000059_38419_39147 | 239 |
| 233 | 3300047321 | Ga0495676_0326226 | Ga0495676_0326226_85_807 | 239 |
| 234 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_365235_365972 | 239 |
| 235 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_109827_110564 | 239 |
| 236 | 3300048911 | Ga0496108_0000137 | Ga0496108_0000137_8696_9427 | 239 |
| 237 | 3300048911 | Ga0496108_0030696 | Ga0496108_0030696_1600_2325 | 239 |
| 238 | 3300048912 | Ga0496109_0000088 | Ga0496109_0000088_7497_8228 | 239 |
| 239 | 3300048912 | Ga0496109_0006784 | Ga0496109_0006784_1029_1754 | 239 |
| 240 | 3300048912 | Ga0496109_0179529 | Ga0496109_0179529_459_1187 | 239 |
| 241 | 3300048912 | Ga0496109_0645711 | Ga0496109_0645711_88_813 | 239 |
| 242 | 3300048913 | Ga0496110_0008595 | Ga0496110_0008595_4369_5091 | 239 |
| 243 | 3300048914 | Ga0496111_0004875 | Ga0496111_0004875_7667_8392 | 239 |
| 244 | 3300048914 | Ga0496111_0062027 | Ga0496111_0062027_769_1491 | 239 |
| 245 | 3300048915 | Ga0496112_0108686 | Ga0496112_0108686_911_1636 | 239 |
| 246 | 3300048916 | Ga0496113_0374604 | Ga0496113_0374604_290_1015 | 239 |
| 247 | 3300048922 | Ga0496119_0013376 | Ga0496119_0013376_1352_2089 | 239 |
| 248 | 3300053077 | Ga0495601_0013268 | Ga0495601_0013268_2269_2994 | 239 |
| 249 | 3300053078 | Ga0495612_0002167 | Ga0495612_0002167_3330_4052 | 239 |
| 250 | 3300053083 | Ga0495655_0001079 | Ga0495655_0001079_987_1715 | 239 |
| 251 | 3300053085 | Ga0495619_0000680 | Ga0495619_0000680_8116_8841 | 239 |
| 252 | 3300053096 | Ga0500641_0006156 | Ga0500641_0006156_1061_1789 | 239 |
| 253 | 3300060353 | Ga0501082_0527142 | Ga0501082_0527142_226_951 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.9472 | 1 | 239 |
| 4w9t-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9458 | 1 | 239 |
| 4x2r-assembly1.cif.gz_A | crystal structure of pria from actinomyces urogenitalis | 0.9414 | 1 | 238 |
| 4tx9-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sviceus with degraded profar | 0.9366 | 1 | 238 |
| 4x9s-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9361 | 1 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9473 | 1 | 238 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9413 | 1 | 238 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.936 | 2 | 238 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9358 | 1 | 238 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9247 | 2 | 238 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V3P5-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9852 | 1 | 238 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A068NW20-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9776 | 1 | 236 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A7Y5XVW1-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.977 | 1 | 238 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A838V3P5-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.977 | 1 | 238 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A536CER5-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) | 0.9768 | 75 | 238 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar