F364019

General Info

Members Datasets Scaffolds Average Seq Length
253 176 253 222

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10000278|Ga0105247_1000027811
Length 248
Sequence VILYPAIDIHGGQAVRLLQGDYERETTYDADPVDAAARWAGEGAEILHVVDLDGAKAGAPRNLDAIGRIAAAVECPIQVGGGLRDASSVDAVLATGAARVVIGTAALRDPKFLAATLERHGDRVVVSVDARDGKVSLSGWTETSDVDVADAVADLGRRGVSRFLCTAIEVDGTMEGPALAELARIAAATPAQLIASGGVGTLSHLESLATLAQDHPNLEGAIVGRALYEKKFTVSQALTSLATPRNDG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 13.04
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000666 3300001977 Bacteria 5271
2 JGI24740J21852_10005027 3300001979 Bacteria 5615
3 JGI25404J52841_10003613 3300003659 Bacteria 3071
4 Ga0070683_100001863 3300005329 Bacteria 16460
5 Ga0070683_100006989 3300005329 Bacteria 9496
6 Ga0070677_10000929 3300005333 Bacteria 9566
7 Ga0070682_100000398 3300005337 Bacteria 29064
8 Ga0068868_100002153 3300005338 Bacteria 13606
9 Ga0070691_10000021 3300005341 Bacteria 45268
10 Ga0070661_100000616 3300005344 Bacteria 26479
11 Ga0070692_10084024 3300005345 Bacteria 1720
12 Ga0070668_100495663 3300005347 Bacteria 1057
13 Ga0070674_100000235 3300005356 Bacteria 27333
14 Ga0070674_100056248 3300005356 Bacteria 2728
15 Ga0070673_100002236 3300005364 Bacteria 11711
16 Ga0070688_100000027 3300005365 Bacteria 67477
17 Ga0070688_100000373 3300005365 Bacteria 22710
18 Ga0070659_100009327 3300005366 Bacteria 7207
19 Ga0070711_100000944 3300005439 Bacteria 15375
20 Ga0070663_100171987 3300005455 Bacteria 1675
21 Ga0070678_100161901 3300005456 Bacteria 1814
22 Ga0070681_10036375 3300005458 Bacteria 4944
23 Ga0068867_100000226 3300005459 Bacteria 36850
24 Ga0070685_10000665 3300005466 Bacteria 18706
25 Ga0070685_10000791 3300005466 Bacteria 17160
26 Ga0070706_100347891 3300005467 Bacteria 1382
27 Ga0070707_100008728 3300005468 Bacteria 9398
28 Ga0070684_100004796 3300005535 Bacteria 10332
29 Ga0070684_100076040 3300005535 Bacteria 2963
30 Ga0070684_100106959 3300005535 Bacteria 2505
31 Ga0070684_100321700 3300005535 Bacteria 1421
32 Ga0070693_100002588 3300005547 Bacteria 8331
33 Ga0070665_100000135 3300005548 Bacteria 138925
34 Ga0068855_100621890 3300005563 Bacteria 1163
35 Ga0068854_100000116 3300005578 Bacteria 54986
36 Ga0068854_100010644 3300005578 Bacteria 5969
37 Ga0068856_100032534 3300005614 Bacteria 5106
38 Ga0068852_100000056 3300005616 Bacteria 76111
39 Ga0068866_10000008 3300005718 Bacteria 117658
40 Ga0068851_10001239 3300005834 Bacteria 11087
41 Ga0068863_100003052 3300005841 Bacteria 16547
42 Ga0068863_100111984 3300005841 Bacteria 2599
43 Ga0068858_100000142 3300005842 Bacteria 75787
44 Ga0068858_100017173 3300005842 Bacteria 6791
45 Ga0081540_1000041 3300005983 Bacteria 136874
46 Ga0075433_10001387 3300006852 Bacteria 17846
47 Ga0068865_100000856 3300006881 Bacteria 17257
48 Ga0105245_10000141 3300009098 Bacteria 68413
49 Ga0105245_10000720 3300009098 Bacteria 29809
50 Ga0105245_10002008 3300009098 Bacteria 18469
51 Ga0105245_10002406 3300009098 Bacteria 16922
52 Ga0105247_10000278 3300009101 Bacteria 47180
53 Ga0105247_10153299 3300009101 Bacteria 1520
54 Ga0105242_10000533 3300009176 Bacteria 30003
55 Ga0105242_10001792 3300009176 Bacteria 16941
56 Ga0105242_10088987 3300009176 Bacteria 2594
57 Ga0105248_10000020 3300009177 Bacteria 284637
58 Ga0105238_10000055 3300009551 Bacteria 139232
59 Ga0105249_10000332 3300009553 Bacteria 47770
60 Ga0105249_10779421 3300009553 Bacteria 1019
61 Ga0105239_10145528 3300010375 Bacteria 2642
62 Ga0105239_10787507 3300010375 Bacteria 1089
63 Ga0157370_10050111 3300013104 Bacteria 3993
64 Ga0157369_10004884 3300013105 Bacteria 15723
65 Ga0157374_10107639 3300013296 Bacteria 2679
66 Ga0157378_10054231 3300013297 Bacteria 3570
67 Ga0157372_10006142 3300013307 Bacteria 12762
68 Ga0157375_10000349 3300013308 Bacteria 41764
69 Ga0157375_10006515 3300013308 Bacteria 10163
70 Ga0157380_10000391 3300014326 Bacteria 26465
71 Ga0157380_10006499 3300014326 Bacteria 8241
72 Ga0157379_10003315 3300014968 Bacteria 13639
73 Ga0157379_10254174 3300014968 Bacteria 1596
74 Ga0206353_11082320 3300020082 Bacteria 1762
75 Ga0207656_10000701 3300025321 Bacteria 10978
76 Ga0207682_10000022 3300025893 Bacteria 62630
77 Ga0207642_10000002 3300025899 Bacteria 658166
78 Ga0207710_10000695 3300025900 Bacteria 18840
79 Ga0207684_10344010 3300025910 Bacteria 1284
80 Ga0207654_10046185 3300025911 Bacteria 2482
81 Ga0207707_10060884 3300025912 Bacteria 3284
82 Ga0207671_10311346 3300025914 Bacteria 1245
83 Ga0207663_10029391 3300025916 Bacteria 3228
84 Ga0207649_10000189 3300025920 Bacteria 50504
85 Ga0207652_10001961 3300025921 Bacteria 17798
86 Ga0207646_10008853 3300025922 Bacteria 10029
87 Ga0207694_10000063 3300025924 Bacteria 139700
88 Ga0207650_10082409 3300025925 Bacteria 2442
89 Ga0207687_10000032 3300025927 Bacteria 143196
90 Ga0207687_10000036 3300025927 Bacteria 121934
91 Ga0207687_10000073 3300025927 Bacteria 73917
92 Ga0207687_10002476 3300025927 Bacteria 12542
93 Ga0207690_10028317 3300025932 Bacteria 3551
94 Ga0207686_10000073 3300025934 Bacteria 92009
95 Ga0207686_10002485 3300025934 Bacteria 10010
96 Ga0207686_10059201 3300025934 Bacteria 2419
97 Ga0207669_10000182 3300025937 Bacteria 29102
98 Ga0207669_10069030 3300025937 Bacteria 2210
99 Ga0207669_10223531 3300025937 Bacteria 1384
100 Ga0207704_10000049 3300025938 Bacteria 83173
101 Ga0207704_10286415 3300025938 Bacteria 1255
102 Ga0207711_10000006 3300025941 Bacteria 792692
103 Ga0207661_10000278 3300025944 Bacteria 32703
104 Ga0207661_10000312 3300025944 Bacteria 30978
105 Ga0207661_10002137 3300025944 Bacteria 13604
106 Ga0207651_10000807 3300025960 Bacteria 13511
107 Ga0207712_10000058 3300025961 Bacteria 140948
108 Ga0207668_10307698 3300025972 Bacteria 1310
109 Ga0207640_10000134 3300025981 Bacteria 54961
110 Ga0207640_10003392 3300025981 Bacteria 8582
111 Ga0207677_10000374 3300026023 Bacteria 31092
112 Ga0207703_10000103 3300026035 Bacteria 99918
113 Ga0207703_10001891 3300026035 Bacteria 18577
114 Ga0207678_10129321 3300026067 Bacteria 2154
115 Ga0207702_10000368 3300026078 Bacteria 51559
116 Ga0207702_10025200 3300026078 Bacteria 4936
117 Ga0207641_10002193 3300026088 Bacteria 18362
118 Ga0207648_10000907 3300026089 Bacteria 33370
119 Ga0207683_10148139 3300026121 Bacteria 2118
120 Ga0207698_10000101 3300026142 Bacteria 54530
121 Ga0207698_10774817 3300026142 Bacteria 960
122 Ga0268266_10000056 3300028379 Bacteria 289176
123 Ga0268264_10512639 3300028381 Bacteria 1171
124 Ga0265326_10000514 3300028558 Bacteria 14873
125 Ga0265319_1000105 3300028563 Bacteria 65502
126 Ga0265322_10000029 3300028654 Bacteria 82867
127 Ga0265338_10000507 3300028800 Bacteria 69026
128 Ga0265324_10002839 3300029957 Bacteria 8532
129 Ga0265328_10001443 3300031239 Bacteria 10944
130 Ga0265320_10000011 3300031240 Bacteria 249534
131 Ga0265325_10101184 3300031241 Bacteria 1410
132 Ga0265329_10003728 3300031242 Bacteria 6562
133 Ga0265339_10007254 3300031249 Bacteria 7183
134 Ga0265331_10000839 3300031250 Bacteria 25044
135 Ga0265327_10000015 3300031251 Bacteria 496677
136 Ga0265316_10023033 3300031344 Bacteria 5239
137 Ga0265314_10000361 3300031711 Bacteria 63269
138 Ga0307415_100104794 3300032126 Bacteria 2084
139 Ga0373937_0033843 3300036401 Bacteria 4645
140 Ga0466963_0000008 3300044694 Bacteria 74916
141 Ga0466957_0011461 3300044842 Bacteria 5116
142 Ga0466967_0000001 3300045976 Bacteria 229823
143 Ga0495592_0003688 3300046454 Bacteria 11039
144 Ga0495603_0002286 3300046455 Bacteria 11264
145 Ga0495603_0003584 3300046455 Bacteria 9243
146 Ga0495629_0007301 3300046459 Bacteria 8140
147 Ga0495641_0010982 3300046461 Bacteria 5199
148 Ga0495653_0048925 3300046463 Bacteria 3260
149 Ga0495653_0060202 3300046463 Bacteria 2878
150 Ga0495582_0000001 3300046473 Bacteria 252434
151 Ga0495582_0152781 3300046473 Bacteria 1311
152 Ga0495662_0000304 3300046476 Bacteria 21364
153 Ga0495662_0034404 3300046476 Bacteria 2446
154 Ga0495594_0000011 3300046499 Bacteria 118444
155 Ga0495618_0000091 3300046514 Bacteria 64654
156 Ga0495628_0009218 3300046516 Bacteria 8434
157 Ga0495628_0022401 3300046516 Bacteria 5189
158 Ga0495628_0325158 3300046516 Bacteria 1134
159 Ga0495630_0000075 3300046517 Bacteria 77378
160 Ga0495630_0000454 3300046517 Bacteria 31035
161 Ga0495630_0539916 3300046517 Bacteria 894
162 Ga0495644_0000176 3300046523 Bacteria 30116
163 Ga0495652_0077900 3300046529 Bacteria 2746
164 Ga0495640_0031442 3300046533 Bacteria 3788
165 Ga0495586_0003640 3300046535 Bacteria 8261
166 Ga0495587_0034876 3300046536 Bacteria 3033
167 Ga0495621_0000973 3300046539 Bacteria 7304
168 Ga0495645_0079497 3300046543 Bacteria 2355
169 Ga0495645_0188534 3300046543 Bacteria 1407
170 Ga0495622_0000021 3300046557 Bacteria 162267
171 Ga0495668_0062124 3300046616 Bacteria 2059
172 Ga0495634_0002062 3300046642 Bacteria 16995
173 Ga0495634_0006592 3300046642 Bacteria 8806
174 Ga0495657_0002416 3300046675 Bacteria 15729
175 Ga0495658_0000002 3300046683 Bacteria 309651
176 Ga0495658_0010671 3300046683 Bacteria 4600
177 Ga0495669_0000143 3300046684 Bacteria 45428
178 Ga0495613_0003350 3300046689 Bacteria 11976
179 Ga0495613_0117504 3300046689 Bacteria 1912
180 Ga0495613_0127523 3300046689 Bacteria 1824
181 Ga0495624_0009962 3300046690 Bacteria 6571
182 Ga0495600_0002071 3300046809 Bacteria 11318
183 Ga0495581_0021800 3300047315 Bacteria 3712
184 Ga0495604_0042490 3300047317 Bacteria 3562
185 Ga0495674_0000059 3300047319 Bacteria 73353
186 Ga0495676_0326226 3300047321 Bacteria 1030
187 Ga0495676_0329910 3300047321 Bacteria 1023
188 Ga0495680_0000212 3300047322 Bacteria 63418
189 Ga0495680_0093126 3300047322 Bacteria 2256
190 Ga0495685_003922 3300047447 Bacteria 4775
191 Ga0495593_0018850 3300047673 Bacteria 3873
192 Ga0496100_0000013 3300048903 Bacteria 177476
193 Ga0496101_0000035 3300048904 Bacteria 177237
194 Ga0496102_0000522 3300048905 Bacteria 41862
195 Ga0496102_0559211 3300048905 Bacteria 1067
196 Ga0496103_0000174 3300048906 Bacteria 67124
197 Ga0496103_0007177 3300048906 Bacteria 6644
198 Ga0496104_0000015 3300048907 Bacteria 374530
199 Ga0496104_0001566 3300048907 Bacteria 19685
200 Ga0496105_0000004 3300048908 Bacteria 475798
201 Ga0496105_0014608 3300048908 Bacteria 6253
202 Ga0496105_0030922 3300048908 Bacteria 4389
203 Ga0496106_0000062 3300048909 Bacteria 85769
204 Ga0496106_0143412 3300048909 Bacteria 1880
205 Ga0496107_0000020 3300048910 Bacteria 148990
206 Ga0496107_0068721 3300048910 Bacteria 2571
207 Ga0496108_0000006 3300048911 Bacteria 469473
208 Ga0496108_0000137 3300048911 Bacteria 70783
209 Ga0496108_0002452 3300048911 Bacteria 14837
210 Ga0496108_0030696 3300048911 Bacteria 4453
211 Ga0496108_0399265 3300048911 Bacteria 1201
212 Ga0496109_0000009 3300048912 Bacteria 236561
213 Ga0496109_0000088 3300048912 Bacteria 94877
214 Ga0496109_0000218 3300048912 Bacteria 56316
215 Ga0496109_0006784 3300048912 Bacteria 9645
216 Ga0496109_0179529 3300048912 Bacteria 1988
217 Ga0496109_0645711 3300048912 Bacteria 995
218 Ga0496110_0008595 3300048913 Bacteria 8223
219 Ga0496111_0004875 3300048914 Bacteria 8519
220 Ga0496111_0062027 3300048914 Bacteria 2711
221 Ga0496111_0089603 3300048914 Bacteria 2253
222 Ga0496112_0108686 3300048915 Bacteria 2744
223 Ga0496113_0374604 3300048916 Bacteria 1142
224 Ga0496114_0009804 3300048917 Bacteria 7611
225 Ga0496118_0270316 3300048921 Bacteria 953
226 Ga0496119_0013376 3300048922 Bacteria 6547
227 Ga0496119_0022041 3300048922 Bacteria 4578
228 Ga0496120_0008785 3300048923 Bacteria 7261
229 Ga0496121_0019917 3300048924 Bacteria 6677
230 Ga0496125_0079612 3300048928 Bacteria 2513
231 Ga0501042_0037609 3300049578 Bacteria 3435
232 Ga0501068_0488156 3300049584 Bacteria 798
233 Ga0501070_0087307 3300049586 Bacteria 2582
234 Ga0501075_0004637 3300049591 Bacteria 9327
235 Ga0501076_0088349 3300049592 Bacteria 2491
236 nmdc:mga0rr50_616862_c1 3300050513 Bacteria 925
237 nmdc:mga0a205_521_c1 3300050515 Bacteria 18797
238 Ga0495601_0006880 3300053077 Bacteria 6662
239 Ga0495601_0013268 3300053077 Bacteria 4953
240 Ga0495601_0015093 3300053077 Bacteria 4665
241 Ga0495612_0001034 3300053078 Bacteria 11410
242 Ga0495612_0002167 3300053078 Bacteria 8080
243 Ga0495612_0037711 3300053078 Bacteria 1963
244 Ga0495655_0000002 3300053083 Bacteria 312752
245 Ga0495655_0001079 3300053083 Bacteria 4215
246 Ga0495595_0000178 3300053084 Bacteria 25404
247 Ga0495619_0000010 3300053085 Bacteria 302390
248 Ga0495619_0000047 3300053085 Bacteria 102152
249 Ga0495619_0000084 3300053085 Bacteria 70164
250 Ga0495619_0000680 3300053085 Bacteria 22263
251 Ga0500641_0006156 3300053096 Bacteria 4253
252 Ga0500628_000001 3300053129 Bacteria 564074
253 Ga0501082_0527142 3300060353 Bacteria 1033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10050111 Ga0157370_100501113 187
2 3300005455 Ga0070663_100171987 Ga0070663_1001719872 188
3 3300005842 Ga0068858_100017173 Ga0068858_1000171733 188
4 3300009176 Ga0105242_10088987 Ga0105242_100889873 188
5 3300025934 Ga0207686_10059201 Ga0207686_100592013 188
6 3300026035 Ga0207703_10000103 Ga0207703_1000010311 188
7 3300026067 Ga0207678_10129321 Ga0207678_101293213 188
8 3300046516 Ga0495628_0022401 Ga0495628_0022401_292_1014 189
9 3300053085 Ga0495619_0000010 Ga0495619_0000010_7537_8262 189
10 3300006852 Ga0075433_10001387 Ga0075433_1000138716 190
11 3300013308 Ga0157375_10000349 Ga0157375_1000034910 190
12 3300050515 nmdc:mga0a205_521_c1 nmdc:mga0a205_521_c1_7049_7795 190
13 3300048911 Ga0496108_0002452 Ga0496108_0002452_7399_8121 191
14 3300048912 Ga0496109_0000218 Ga0496109_0000218_48209_48931 191
15 3300050513 nmdc:mga0rr50_616862_c1 nmdc:mga0rr50_616862_c1_140_859 198
16 3300053078 Ga0495612_0001034 Ga0495612_0001034_7593_8318 198
17 3300047322 Ga0495680_0093126 Ga0495680_0093126_616_1335 199
18 3300005333 Ga0070677_10000929 Ga0070677_100009292 200
19 3300005548 Ga0070665_100000135 Ga0070665_100000135132 200
20 3300005842 Ga0068858_100000142 Ga0068858_10000014280 200
21 3300009098 Ga0105245_10000720 Ga0105245_1000072012 200
22 3300025893 Ga0207682_10000022 Ga0207682_1000002212 200
23 3300025927 Ga0207687_10000032 Ga0207687_10000032133 200
24 3300026035 Ga0207703_10001891 Ga0207703_1000189120 200
25 3300028379 Ga0268266_10000056 Ga0268266_10000056281 200
26 3300046684 Ga0495669_0000143 Ga0495669_0000143_36135_36857 200
27 3300048911 Ga0496108_0000006 Ga0496108_0000006_241475_242200 200
28 3300048912 Ga0496109_0000009 Ga0496109_0000009_8563_9288 200
29 3300048928 Ga0496125_0079612 Ga0496125_0079612_962_1687 200
30 3300005341 Ga0070691_10000021 Ga0070691_1000002110 201
31 3300005578 Ga0068854_100010644 Ga0068854_1000106447 201
32 3300009553 Ga0105249_10000332 Ga0105249_1000033211 201
33 3300014968 Ga0157379_10003315 Ga0157379_1000331512 201
34 3300025961 Ga0207712_10000058 Ga0207712_1000005811 201
35 3300025981 Ga0207640_10003392 Ga0207640_100033928 201
36 3300046523 Ga0495644_0000176 Ga0495644_0000176_20868_21596 201
37 3300046459 Ga0495629_0007301 Ga0495629_0007301_7350_8081 202
38 3300047321 Ga0495676_0329910 Ga0495676_0329910_201_923 202
39 3300048917 Ga0496114_0009804 Ga0496114_0009804_5149_5871 202
40 3300053077 Ga0495601_0015093 Ga0495601_0015093_1059_1787 204
41 3300046517 Ga0495630_0539916 Ga0495630_0539916_131_862 205
42 3300053078 Ga0495612_0037711 Ga0495612_0037711_1194_1916 205
43 3300003659 JGI25404J52841_10003613 JGI25404J52841_100036132 206
44 3300005983 Ga0081540_1000041 Ga0081540_100004197 206
45 3300048903 Ga0496100_0000013 Ga0496100_0000013_167982_168707 206
46 3300048904 Ga0496101_0000035 Ga0496101_0000035_167982_168707 206
47 3300048909 Ga0496106_0000062 Ga0496106_0000062_76514_77239 206
48 3300048910 Ga0496107_0000020 Ga0496107_0000020_139131_139856 206
49 3300049578 Ga0501042_0037609 Ga0501042_0037609_936_1664 207
50 3300045976 Ga0466967_0000001 Ga0466967_0000001_7633_8370 210
51 3300046616 Ga0495668_0062124 Ga0495668_0062124_1182_1910 210
52 3300046535 Ga0495586_0003640 Ga0495586_0003640_2741_3466 211
53 3300009551 Ga0105238_10000055 Ga0105238_10000055130 212
54 3300025924 Ga0207694_10000063 Ga0207694_1000006312 212
55 3300046516 Ga0495628_0009218 Ga0495628_0009218_5825_6559 212
56 3300046675 Ga0495657_0002416 Ga0495657_0002416_9814_10548 212
57 3300048907 Ga0496104_0001566 Ga0496104_0001566_8825_9553 212
58 3300048908 Ga0496105_0014608 Ga0496105_0014608_4749_5477 212
59 3300049591 Ga0501075_0004637 Ga0501075_0004637_8357_9085 212
60 3300001979 JGI24740J21852_10005027 JGI24740J21852_100050277 213
61 3300005366 Ga0070659_100009327 Ga0070659_1000093273 213
62 3300005841 Ga0068863_100003052 Ga0068863_10000305212 213
63 3300010375 Ga0105239_10787507 Ga0105239_107875072 213
64 3300025914 Ga0207671_10311346 Ga0207671_103113462 213
65 3300025932 Ga0207690_10028317 Ga0207690_100283173 213
66 3300026088 Ga0207641_10002193 Ga0207641_1000219312 213
67 3300046476 Ga0495662_0034404 Ga0495662_0034404_803_1528 213
68 3300046689 Ga0495613_0117504 Ga0495613_0117504_834_1556 213
69 3300047315 Ga0495581_0021800 Ga0495581_0021800_1781_2509 213
70 3300047322 Ga0495680_0000212 Ga0495680_0000212_10174_10902 213
71 3300048908 Ga0496105_0030922 Ga0496105_0030922_555_1277 213
72 3300048909 Ga0496106_0143412 Ga0496106_0143412_753_1475 213
73 3300048910 Ga0496107_0068721 Ga0496107_0068721_692_1414 213
74 3300048911 Ga0496108_0399265 Ga0496108_0399265_383_1105 213
75 3300048922 Ga0496119_0022041 Ga0496119_0022041_2525_3247 213
76 3300048924 Ga0496121_0019917 Ga0496121_0019917_769_1491 213
77 3300005329 Ga0070683_100006989 Ga0070683_10000698912 214
78 3300005459 Ga0068867_100000226 Ga0068867_10000022639 214
79 3300005535 Ga0070684_100076040 Ga0070684_1000760403 214
80 3300009098 Ga0105245_10002406 Ga0105245_100024067 214
81 3300009176 Ga0105242_10000533 Ga0105242_1000053327 214
82 3300009553 Ga0105249_10779421 Ga0105249_107794212 214
83 3300025927 Ga0207687_10002476 Ga0207687_1000247611 214
84 3300025934 Ga0207686_10000073 Ga0207686_10000073104 214
85 3300025937 Ga0207669_10223531 Ga0207669_102235312 214
86 3300025944 Ga0207661_10002137 Ga0207661_1000213710 214
87 3300026089 Ga0207648_10000907 Ga0207648_1000090737 214
88 3300028558 Ga0265326_10000514 Ga0265326_1000051414 214
89 3300028563 Ga0265319_1000105 Ga0265319_10001059 214
90 3300028654 Ga0265322_10000029 Ga0265322_1000002984 214
91 3300028800 Ga0265338_10000507 Ga0265338_1000050765 214
92 3300029957 Ga0265324_10002839 Ga0265324_100028394 214
93 3300031239 Ga0265328_10001443 Ga0265328_100014438 214
94 3300031240 Ga0265320_10000011 Ga0265320_10000011260 214
95 3300031241 Ga0265325_10101184 Ga0265325_101011841 214
96 3300031242 Ga0265329_10003728 Ga0265329_100037285 214
97 3300031249 Ga0265339_10007254 Ga0265339_100072548 214
98 3300031250 Ga0265331_10000839 Ga0265331_1000083922 214
99 3300031251 Ga0265327_10000015 Ga0265327_10000015368 214
100 3300031344 Ga0265316_10023033 Ga0265316_100230336 214
101 3300031711 Ga0265314_10000361 Ga0265314_1000036170 214
102 3300044694 Ga0466963_0000008 Ga0466963_0000008_65683_66408 214
103 3300046455 Ga0495603_0002286 Ga0495603_0002286_1680_2402 214
104 3300046455 Ga0495603_0003584 Ga0495603_0003584_1106_1831 214
105 3300046463 Ga0495653_0060202 Ga0495653_0060202_1168_1890 214
106 3300046514 Ga0495618_0000091 Ga0495618_0000091_10455_11180 214
107 3300046516 Ga0495628_0325158 Ga0495628_0325158_165_887 214
108 3300046543 Ga0495645_0079497 Ga0495645_0079497_65_787 214
109 3300046543 Ga0495645_0188534 Ga0495645_0188534_141_863 214
110 3300046689 Ga0495613_0003350 Ga0495613_0003350_10303_11025 214
111 3300046690 Ga0495624_0009962 Ga0495624_0009962_4087_4809 214
112 3300046809 Ga0495600_0002071 Ga0495600_0002071_8671_9396 214
113 3300047447 Ga0495685_003922 Ga0495685_003922_2726_3454 214
114 3300048914 Ga0496111_0089603 Ga0496111_0089603_694_1416 214
115 3300048923 Ga0496120_0008785 Ga0496120_0008785_6255_6977 214
116 3300053083 Ga0495655_0000002 Ga0495655_0000002_304348_305082 214
117 3300053084 Ga0495595_0000178 Ga0495595_0000178_20193_20915 214
118 3300053129 Ga0500628_000001 Ga0500628_000001_393017_393751 214
119 3300005364 Ga0070673_100002236 Ga0070673_1000022363 215
120 3300013296 Ga0157374_10107639 Ga0157374_101076393 215
121 3300025960 Ga0207651_10000807 Ga0207651_100008075 215
122 3300046642 Ga0495634_0006592 Ga0495634_0006592_6630_7355 215
123 3300053085 Ga0495619_0000047 Ga0495619_0000047_7726_8448 215
124 3300005344 Ga0070661_100000616 Ga0070661_10000061623 216
125 3300005345 Ga0070692_10084024 Ga0070692_100840242 216
126 3300005365 Ga0070688_100000027 Ga0070688_10000002769 216
127 3300005456 Ga0070678_100161901 Ga0070678_1001619012 216
128 3300005466 Ga0070685_10000791 Ga0070685_1000079114 216
129 3300013307 Ga0157372_10006142 Ga0157372_100061426 216
130 3300013308 Ga0157375_10006515 Ga0157375_1000651513 216
131 3300025920 Ga0207649_10000189 Ga0207649_100001899 216
132 3300026121 Ga0207683_10148139 Ga0207683_101481392 216
133 3300044842 Ga0466957_0011461 Ga0466957_0011461_3675_4397 216
134 3300046454 Ga0495592_0003688 Ga0495592_0003688_880_1602 216
135 3300046539 Ga0495621_0000973 Ga0495621_0000973_5498_6229 216
136 3300047673 Ga0495593_0018850 Ga0495593_0018850_3054_3800 216
137 3300049584 Ga0501068_0488156 Ga0501068_0488156_41_778 216
138 3300049586 Ga0501070_0087307 Ga0501070_0087307_209_934 216
139 3300049592 Ga0501076_0088349 Ga0501076_0088349_848_1576 216
140 3300005337 Ga0070682_100000398 Ga0070682_10000039811 217
141 3300005338 Ga0068868_100002153 Ga0068868_10000215311 217
142 3300005578 Ga0068854_100000116 Ga0068854_10000011654 217
143 3300014326 Ga0157380_10006499 Ga0157380_1000649911 217
144 3300014968 Ga0157379_10254174 Ga0157379_102541742 217
145 3300025938 Ga0207704_10286415 Ga0207704_102864152 217
146 3300025981 Ga0207640_10000134 Ga0207640_1000013455 217
147 3300026023 Ga0207677_10000374 Ga0207677_1000037430 217
148 3300032126 Ga0307415_100104794 Ga0307415_1001047942 217
149 3300046476 Ga0495662_0000304 Ga0495662_0000304_3497_4219 217
150 3300048905 Ga0496102_0559211 Ga0496102_0559211_60_782 217
151 3300005356 Ga0070674_100056248 Ga0070674_1000562484 218
152 3300020082 Ga0206353_11082320 Ga0206353_110823201 218
153 3300025937 Ga0207669_10069030 Ga0207669_100690303 218
154 3300046529 Ga0495652_0077900 Ga0495652_0077900_1232_1960 218
155 3300046642 Ga0495634_0002062 Ga0495634_0002062_594_1319 218
156 3300048905 Ga0496102_0000522 Ga0496102_0000522_33421_34149 218
157 3300048906 Ga0496103_0000174 Ga0496103_0000174_6893_7621 218
158 3300048921 Ga0496118_0270316 Ga0496118_0270316_79_807 218
159 3300053077 Ga0495601_0006880 Ga0495601_0006880_5552_6280 218
160 3300005439 Ga0070711_100000944 Ga0070711_10000094415 219
161 3300005547 Ga0070693_100002588 Ga0070693_10000258812 219
162 3300025916 Ga0207663_10029391 Ga0207663_100293913 219
163 3300046499 Ga0495594_0000011 Ga0495594_0000011_82041_82778 219
164 3300046557 Ga0495622_0000021 Ga0495622_0000021_152442_153179 219
165 3300009176 Ga0105242_10001792 Ga0105242_100017929 220
166 3300025934 Ga0207686_10002485 Ga0207686_100024855 220
167 3300005347 Ga0070668_100495663 Ga0070668_1004956632 224
168 3300005467 Ga0070706_100347891 Ga0070706_1003478911 224
169 3300005468 Ga0070707_100008728 Ga0070707_1000087288 224
170 3300005841 Ga0068863_100111984 Ga0068863_1001119842 224
171 3300009101 Ga0105247_10153299 Ga0105247_101532992 224
172 3300025910 Ga0207684_10344010 Ga0207684_103440102 224
173 3300025922 Ga0207646_10008853 Ga0207646_100088535 224
174 3300025972 Ga0207668_10307698 Ga0207668_103076982 224
175 3300048906 Ga0496103_0007177 Ga0496103_0007177_231_968 224
176 3300005614 Ga0068856_100032534 Ga0068856_1000325342 228
177 3300026078 Ga0207702_10025200 Ga0207702_100252005 228
178 3300046689 Ga0495613_0127523 Ga0495613_0127523_724_1452 230
179 3300036401 Ga0373937_0033843 Ga0373937_0033843_2656_3408 231
180 3300047317 Ga0495604_0042490 Ga0495604_0042490_1579_2331 231
181 3300053085 Ga0495619_0000084 Ga0495619_0000084_68526_69257 232
182 3300001977 JGI24746J21847_1000666 JGI24746J21847_10006664 239
183 3300005329 Ga0070683_100001863 Ga0070683_10000186315 239
184 3300005356 Ga0070674_100000235 Ga0070674_10000023511 239
185 3300005365 Ga0070688_100000373 Ga0070688_10000037325 239
186 3300005458 Ga0070681_10036375 Ga0070681_100363756 239
187 3300005466 Ga0070685_10000665 Ga0070685_1000066514 239
188 3300005535 Ga0070684_100004796 Ga0070684_1000047966 239
189 3300005535 Ga0070684_100106959 Ga0070684_1001069594 239
190 3300005535 Ga0070684_100321700 Ga0070684_1003217001 239
191 3300005563 Ga0068855_100621890 Ga0068855_1006218901 239
192 3300005616 Ga0068852_100000056 Ga0068852_10000005610 239
193 3300005718 Ga0068866_10000008 Ga0068866_1000000811 239
194 3300005834 Ga0068851_10001239 Ga0068851_100012392 239
195 3300006881 Ga0068865_100000856 Ga0068865_10000085613 239
196 3300009098 Ga0105245_10000141 Ga0105245_1000014168 239
197 3300009098 Ga0105245_10002008 Ga0105245_1000200812 239
198 3300009101 Ga0105247_10000278 Ga0105247_1000027811 239
199 3300009177 Ga0105248_10000020 Ga0105248_1000002010 239
200 3300010375 Ga0105239_10145528 Ga0105239_101455282 239
201 3300013105 Ga0157369_10004884 Ga0157369_1000488410 239
202 3300013297 Ga0157378_10054231 Ga0157378_100542314 239
203 3300014326 Ga0157380_10000391 Ga0157380_100003913 239
204 3300025321 Ga0207656_10000701 Ga0207656_100007012 239
205 3300025899 Ga0207642_10000002 Ga0207642_10000002658 239
206 3300025900 Ga0207710_10000695 Ga0207710_100006959 239
207 3300025911 Ga0207654_10046185 Ga0207654_100461852 239
208 3300025912 Ga0207707_10060884 Ga0207707_100608842 239
209 3300025921 Ga0207652_10001961 Ga0207652_1000196115 239
210 3300025925 Ga0207650_10082409 Ga0207650_100824092 239
211 3300025927 Ga0207687_10000036 Ga0207687_1000003610 239
212 3300025927 Ga0207687_10000073 Ga0207687_1000007312 239
213 3300025937 Ga0207669_10000182 Ga0207669_1000018211 239
214 3300025938 Ga0207704_10000049 Ga0207704_1000004983 239
215 3300025941 Ga0207711_10000006 Ga0207711_10000006365 239
216 3300025944 Ga0207661_10000278 Ga0207661_1000027811 239
217 3300025944 Ga0207661_10000312 Ga0207661_1000031235 239
218 3300026078 Ga0207702_10000368 Ga0207702_1000036852 239
219 3300026142 Ga0207698_10000101 Ga0207698_1000010110 239
220 3300026142 Ga0207698_10774817 Ga0207698_107748172 239
221 3300028381 Ga0268264_10512639 Ga0268264_105126392 239
222 3300046461 Ga0495641_0010982 Ga0495641_0010982_659_1381 239
223 3300046463 Ga0495653_0048925 Ga0495653_0048925_2254_2988 239
224 3300046473 Ga0495582_0000001 Ga0495582_0000001_175678_176403 239
225 3300046473 Ga0495582_0152781 Ga0495582_0152781_407_1132 239
226 3300046517 Ga0495630_0000075 Ga0495630_0000075_69907_70629 239
227 3300046517 Ga0495630_0000454 Ga0495630_0000454_21571_22296 239
228 3300046533 Ga0495640_0031442 Ga0495640_0031442_125_853 239
229 3300046536 Ga0495587_0034876 Ga0495587_0034876_953_1681 239
230 3300046683 Ga0495658_0000002 Ga0495658_0000002_299284_300009 239
231 3300046683 Ga0495658_0010671 Ga0495658_0010671_3194_3916 239
232 3300047319 Ga0495674_0000059 Ga0495674_0000059_38419_39147 239
233 3300047321 Ga0495676_0326226 Ga0495676_0326226_85_807 239
234 3300048907 Ga0496104_0000015 Ga0496104_0000015_365235_365972 239
235 3300048908 Ga0496105_0000004 Ga0496105_0000004_109827_110564 239
236 3300048911 Ga0496108_0000137 Ga0496108_0000137_8696_9427 239
237 3300048911 Ga0496108_0030696 Ga0496108_0030696_1600_2325 239
238 3300048912 Ga0496109_0000088 Ga0496109_0000088_7497_8228 239
239 3300048912 Ga0496109_0006784 Ga0496109_0006784_1029_1754 239
240 3300048912 Ga0496109_0179529 Ga0496109_0179529_459_1187 239
241 3300048912 Ga0496109_0645711 Ga0496109_0645711_88_813 239
242 3300048913 Ga0496110_0008595 Ga0496110_0008595_4369_5091 239
243 3300048914 Ga0496111_0004875 Ga0496111_0004875_7667_8392 239
244 3300048914 Ga0496111_0062027 Ga0496111_0062027_769_1491 239
245 3300048915 Ga0496112_0108686 Ga0496112_0108686_911_1636 239
246 3300048916 Ga0496113_0374604 Ga0496113_0374604_290_1015 239
247 3300048922 Ga0496119_0013376 Ga0496119_0013376_1352_2089 239
248 3300053077 Ga0495601_0013268 Ga0495601_0013268_2269_2994 239
249 3300053078 Ga0495612_0002167 Ga0495612_0002167_3330_4052 239
250 3300053083 Ga0495655_0001079 Ga0495655_0001079_987_1715 239
251 3300053085 Ga0495619_0000680 Ga0495619_0000680_8116_8841 239
252 3300053096 Ga0500641_0006156 Ga0500641_0006156_1061_1789 239
253 3300060353 Ga0501082_0527142 Ga0501082_0527142_226_951 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

2

233

0.98

PF01207

Dus

Dihydrouridine synthase (Dus)

32

131

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9472 1 239
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9458 1 239
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9414 1 238
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9366 1 238
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9361 1 238
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9473 1 238 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9413 1 238 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.936 2 238 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9358 1 238 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9247 2 238 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A838V3P5-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9852 1 238 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A068NW20-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9776 1 236 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A7Y5XVW1-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.977 1 238 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A838V3P5-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.977 1 238 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A536CER5-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) 0.9768 75 238 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.49 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map