F363948

General Info

Members Datasets Scaffolds Average Seq Length
253 176 506 230

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10079292|Ga0075369_100792922
Length 265
Sequence MVGVFNDLNEGVAIMKEKQKDTASTTSTAGTKGDRVAIITGGSRGLGAALATDLVGDGWTVVIDARDAATLAATAARIRTDAITSGRLIEVAGDVSDAAHRTALVQTARAAGSLELVVNNASVLGPSPLHHLGEHPLDALGQIFDVNVVAPLGLIQLALPDLRHNRGTVIDVSSDAAVEGYSSKAALDQVSKVLAAEENDVRIYAFDPGDMRTEMHQQAFPGEDISDRPPPETVVPAVRALLATSPPSGRYRAADLLANIARAES

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0
Rhizoplane 4.74
Rhizosphere 83.4
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10079292 3300006186 Bacteria 1455
2 JGI24738J21930_10033875 3300002075 Bacteria 1041
3 JGI25406J46586_10001575 3300003203 Bacteria 10764
4 Ga0070683_100175552 3300005329 Bacteria 2034
5 Ga0070680_100466585 3300005336 Bacteria 1079
6 Ga0068868_100064655 3300005338 Bacteria 2905
7 Ga0070660_100122485 3300005339 Bacteria 2076
8 Ga0070673_100261671 3300005364 Bacteria 1511
9 Ga0070714_100000009 3300005435 Bacteria 270991
10 Ga0070714_100012472 3300005435 Bacteria 6786
11 Ga0070714_100022982 3300005435 Bacteria 5117
12 Ga0070714_100076180 3300005435 Bacteria 2912
13 Ga0070714_100188799 3300005435 Bacteria 1879
14 Ga0070714_100273432 3300005435 Bacteria 1567
15 Ga0070713_100152537 3300005436 Bacteria 2057
16 Ga0070710_10033042 3300005437 Bacteria 2807
17 Ga0070710_10421000 3300005437 Bacteria 899
18 Ga0070701_10414925 3300005438 Bacteria 856
19 Ga0070705_100215501 3300005440 Bacteria 1326
20 Ga0070700_100154798 3300005441 Bacteria 1572
21 Ga0070678_100028268 3300005456 Bacteria 3822
22 Ga0070681_10006131 3300005458 Bacteria 11671
23 Ga0070681_10604727 3300005458 Bacteria 1011
24 Ga0068867_100438589 3300005459 Bacteria 1110
25 Ga0070706_100030874 3300005467 Bacteria 4939
26 Ga0070707_100089542 3300005468 Bacteria 2978
27 Ga0070684_100620707 3300005535 Bacteria 1006
28 Ga0070696_100265093 3300005546 Bacteria 1304
29 Ga0070693_100085730 3300005547 Bacteria 1888
30 Ga0070665_100073247 3300005548 Bacteria 3432
31 Ga0068855_100117172 3300005563 Bacteria 3052
32 Ga0068852_100739986 3300005616 Bacteria 995
33 Ga0068864_100428329 3300005618 Bacteria 1262
34 Ga0068858_100095977 3300005842 Bacteria 2762
35 Ga0068860_100148183 3300005843 Bacteria 2259
36 Ga0081539_10113105 3300005985 Bacteria 1362
37 Ga0070717_10005654 3300006028 Bacteria 9133
38 Ga0070717_10018875 3300006028 Bacteria 5395
39 Ga0070717_10048957 3300006028 Bacteria 3468
40 Ga0070717_10073588 3300006028 Bacteria 2856
41 Ga0070717_10121965 3300006028 Bacteria 2234
42 Ga0070717_10154910 3300006028 Bacteria 1984
43 Ga0070717_10180388 3300006028 Bacteria 1840
44 Ga0075365_10012837 3300006038 Bacteria 4990
45 Ga0075365_10032694 3300006038 Bacteria 3347
46 Ga0075365_10098514 3300006038 Unclassified 2000
47 Ga0075368_10007835 3300006042 Bacteria 3785
48 Ga0075363_100043538 3300006048 Bacteria 2375
49 Ga0075363_100106665 3300006048 Bacteria 1554
50 Ga0075364_10028097 3300006051 Bacteria 3599
51 Ga0075364_10327091 3300006051 Bacteria 1044
52 Ga0070716_100123351 3300006173 Bacteria 1625
53 Ga0070716_100479495 3300006173 Bacteria 913
54 Ga0070712_100243195 3300006175 Bacteria 1434
55 Ga0070712_100423557 3300006175 Bacteria 1104
56 Ga0075367_10070284 3300006178 Bacteria 2104
57 Ga0097621_100042414 3300006237 Bacteria 3664
58 Ga0068871_100168765 3300006358 Bacteria 1875
59 Ga0111539_10232677 3300009094 Bacteria 2146
60 Ga0105245_10042347 3300009098 Bacteria 4062
61 Ga0105245_10070390 3300009098 Bacteria 3174
62 Ga0105245_10085972 3300009098 Bacteria 2883
63 Ga0105247_10043361 3300009101 Bacteria 2756
64 Ga0105247_10144132 3300009101 Bacteria 1564
65 Ga0114129_10997684 3300009147 Bacteria 1055
66 Ga0105237_10584114 3300009545 Bacteria 1124
67 Ga0105238_10300630 3300009551 Bacteria 1588
68 Ga0105238_10821977 3300009551 Bacteria 945
69 Ga0105249_10225680 3300009553 Bacteria 1845
70 Ga0105239_10531098 3300010375 Bacteria 1339
71 Ga0157378_10508177 3300013297 Bacteria 1205
72 Ga0157372_10189901 3300013307 Bacteria 2379
73 Ga0157375_10106388 3300013308 Bacteria 2897
74 Ga0157375_10243493 3300013308 Bacteria 1958
75 Ga0163163_10122662 3300014325 Bacteria 2633
76 Ga0157379_10006155 3300014968 Bacteria 10332
77 Ga0157376_10081632 3300014969 Bacteria 2776
78 Ga0213876_10018056 3300021384 Bacteria 3722
79 Ga0213875_10052153 3300021388 Bacteria 1916
80 Ga0207710_10022074 3300025900 Bacteria 2730
81 Ga0207710_10152106 3300025900 Bacteria 1123
82 Ga0207699_10464054 3300025906 Bacteria 910
83 Ga0207684_10013802 3300025910 Bacteria 6978
84 Ga0207707_10484584 3300025912 Bacteria 1056
85 Ga0207707_10770262 3300025912 Bacteria 803
86 Ga0207695_10565622 3300025913 Bacteria 1018
87 Ga0207693_10000849 3300025915 Bacteria 27274
88 Ga0207693_10410042 3300025915 Bacteria 1059
89 Ga0207663_10015167 3300025916 Bacteria 4243
90 Ga0207660_10072139 3300025917 Bacteria 2514
91 Ga0207657_10161895 3300025919 Bacteria 1817
92 Ga0207652_10171696 3300025921 Bacteria 1946
93 Ga0207646_10172922 3300025922 Bacteria 1951
94 Ga0207681_10292701 3300025923 Bacteria 1286
95 Ga0207694_10143505 3300025924 Bacteria 1921
96 Ga0207694_10276585 3300025924 Bacteria 1378
97 Ga0207687_10020241 3300025927 Bacteria 4414
98 Ga0207700_10088976 3300025928 Bacteria 2433
99 Ga0207700_10555585 3300025928 Bacteria 1019
100 Ga0207664_10000050 3300025929 Bacteria 133818
101 Ga0207664_10015287 3300025929 Bacteria 5565
102 Ga0207664_10100517 3300025929 Bacteria 2388
103 Ga0207664_10174639 3300025929 Bacteria 1841
104 Ga0207664_10192319 3300025929 Bacteria 1757
105 Ga0207664_10538565 3300025929 Bacteria 1047
106 Ga0207665_10002932 3300025939 Bacteria 11430
107 Ga0207661_10103085 3300025944 Bacteria 2401
108 Ga0207667_10093785 3300025949 Bacteria 3100
109 Ga0207677_10035226 3300026023 Bacteria 3249
110 Ga0207703_10043727 3300026035 Bacteria 3596
111 Ga0207708_10365431 3300026075 Bacteria 1187
112 Ga0207641_10118434 3300026088 Bacteria 2359
113 Ga0207641_10833602 3300026088 Bacteria 913
114 Ga0207676_10036940 3300026095 Bacteria 3719
115 Ga0207674_10068896 3300026116 Bacteria 3559
116 Ga0207683_10520811 3300026121 Bacteria 1099
117 Ga0207698_10661419 3300026142 Bacteria 1036
118 Ga0268266_10062298 3300028379 Bacteria 3219
119 Ga0268266_10314187 3300028379 Bacteria 1465
120 Ga0268266_10399092 3300028379 Bacteria 1300
121 Ga0268265_10093898 3300028380 Bacteria 2405
122 Ga0268264_10247072 3300028381 Bacteria 1656
123 Ga0307512_10010569 3300030522 Bacteria 8794
124 Ga0265327_10001231 3300031251 Bacteria 34376
125 Ga0373923_0078282 3300035111 Bacteria 1430
126 Ga0373957_0046658 3300035120 Bacteria 1645
127 Ga0373946_0014648 3300035171 Bacteria 2959
128 Ga0373935_0185136 3300035692 Bacteria 1431
129 Ga0373933_0051550 3300035724 Bacteria 2460
130 Ga0373947_0292667 3300035725 Bacteria 1084
131 Ga0373925_0630397 3300037068 Bacteria 883
132 Ga0436364_0377807 3300037853 Bacteria 2212
133 Ga0436364_1018509 3300037853 Bacteria 1959
134 Ga0436364_1187765 3300037853 Bacteria 36833
135 Ga0436365_0251786 3300039437 Bacteria 4974
136 Ga0436365_1410273 3300039437 Bacteria 9974
137 Ga0436363_0390175 3300039450 Bacteria 759
138 Ga0436363_0425736 3300039450 Bacteria 2069
139 Ga0436363_1200884 3300039450 Bacteria 4436
140 Ga0436362_1222249 3300039453 Bacteria 4354
141 Ga0466969_0223479 3300044656 Bacteria 856
142 Ga0466972_0001928 3300044658 Bacteria 10180
143 Ga0466972_0173721 3300044658 Bacteria 1011
144 Ga0466972_0254278 3300044658 Bacteria 821
145 Ga0466965_0013911 3300044683 Bacteria 3804
146 Ga0466965_0057356 3300044683 Bacteria 1941
147 Ga0466966_0003018 3300044684 Bacteria 11102
148 Ga0466966_0007218 3300044684 Bacteria 7365
149 Ga0466961_0000965 3300044693 Bacteria 17796
150 Ga0466961_0073153 3300044693 Bacteria 2174
151 Ga0466961_0074256 3300044693 Bacteria 2156
152 Ga0466963_0030365 3300044694 Bacteria 3487
153 Ga0466963_0291166 3300044694 Bacteria 1148
154 Ga0466963_0295475 3300044694 Bacteria 1139
155 Ga0466971_0020886 3300044719 Bacteria 2911
156 Ga0466971_0137062 3300044719 Bacteria 1139
157 Ga0466971_0281156 3300044719 Bacteria 796
158 Ga0466968_0019611 3300044735 Bacteria 2723
159 Ga0466968_0225048 3300044735 Bacteria 885
160 Ga0466970_0006008 3300044765 Bacteria 6053
161 Ga0466970_0190233 3300044765 Bacteria 1140
162 Ga0466957_0006829 3300044842 Bacteria 6449
163 Ga0466957_0029413 3300044842 Bacteria 3277
164 Ga0466959_0043436 3300045049 Bacteria 3313
165 Ga0466958_0010186 3300045836 Bacteria 5258
166 Ga0466958_0060731 3300045836 Bacteria 2301
167 Ga0466958_0560774 3300045836 Bacteria 742
168 Ga0466967_0005155 3300045976 Bacteria 8989
169 Ga0466967_0009143 3300045976 Bacteria 7330
170 Ga0466967_0036605 3300045976 Bacteria 4191
171 Ga0466967_0350268 3300045976 Bacteria 1429
172 Ga0466967_0420076 3300045976 Bacteria 1303
173 Ga0466967_0565418 3300045976 Bacteria 1120
174 Ga0495592_0021821 3300046454 Bacteria 4871
175 Ga0495629_0141583 3300046459 Bacteria 1673
176 Ga0495629_0452819 3300046459 Bacteria 869
177 Ga0495651_0007060 3300046462 Bacteria 8587
178 Ga0495653_0052448 3300046463 Bacteria 3125
179 Ga0495580_0046548 3300046472 Bacteria 3077
180 Ga0495582_0033025 3300046473 Bacteria 2844
181 Ga0495662_0023061 3300046476 Bacteria 3005
182 Ga0495664_0095201 3300046477 Bacteria 1792
183 Ga0495608_0027816 3300046511 Bacteria 3845
184 Ga0495618_0034480 3300046514 Bacteria 3173
185 Ga0495628_0294395 3300046516 Bacteria 1202
186 Ga0495630_0058712 3300046517 Bacteria 2884
187 Ga0495652_0065424 3300046529 Bacteria 3054
188 Ga0495652_0265982 3300046529 Bacteria 1263
189 Ga0495640_0110749 3300046533 Bacteria 1794
190 Ga0495586_0090428 3300046535 Bacteria 1690
191 Ga0495587_0001976 3300046536 Bacteria 13683
192 Ga0495667_0011166 3300046559 Bacteria 6079
193 Ga0495634_0037539 3300046642 Bacteria 3309
194 Ga0495635_0104536 3300046663 Bacteria 1935
195 Ga0495657_0122383 3300046675 Bacteria 1637
196 Ga0495599_0005704 3300046678 Bacteria 7469
197 Ga0495624_0136862 3300046690 Bacteria 1501
198 Ga0495600_0022258 3300046809 Bacteria 4068
199 Ga0495604_0350813 3300047317 Bacteria 980
200 Ga0495674_0357550 3300047319 Bacteria 1184
201 Ga0495676_0143983 3300047321 Bacteria 1705
202 Ga0495676_0246875 3300047321 Bacteria 1219
203 Ga0495676_0302093 3300047321 Bacteria 1079
204 Ga0495680_0026870 3300047322 Bacteria 4738
205 Ga0495675_0380816 3300047444 Bacteria 825
206 Ga0495684_0008302 3300047471 Bacteria 8044
207 Ga0496102_0128403 3300048905 Bacteria 2371
208 Ga0496103_0103834 3300048906 Bacteria 1801
209 Ga0496104_0016910 3300048907 Bacteria 6634
210 Ga0496108_0013521 3300048911 Bacteria 6661
211 Ga0496108_0280172 3300048911 Bacteria 1451
212 Ga0496108_0825229 3300048911 Bacteria 799
213 Ga0496109_0016617 3300048912 Bacteria 6436
214 Ga0496111_0067500 3300048914 Bacteria 2598
215 Ga0496111_0122632 3300048914 Bacteria 1920
216 Ga0496112_0001816 3300048915 Bacteria 16800
217 Ga0496112_0119942 3300048915 Bacteria 2600
218 Ga0496114_0614545 3300048917 Bacteria 958
219 Ga0496118_0000652 3300048921 Bacteria 56676
220 Ga0501034_0017986 3300049571 Bacteria 7251
221 Ga0501038_0186416 3300049574 Bacteria 1672
222 Ga0501039_0053924 3300049575 Bacteria 3112
223 Ga0501041_0043672 3300049577 Bacteria 2725
224 Ga0501041_0095116 3300049577 Bacteria 1841
225 Ga0501042_0166748 3300049578 Bacteria 1589
226 Ga0501043_0234739 3300049579 Bacteria 1416
227 Ga0501071_0042877 3300049587 Bacteria 3243
228 Ga0501072_0100905 3300049588 Bacteria 2294
229 Ga0501075_0060384 3300049591 Bacteria 2857
230 Ga0501076_0071989 3300049592 Bacteria 2766
231 Ga0501079_0128990 3300049741 Bacteria 1968
232 Ga0501083_0404023 3300049744 Bacteria 889
233 Ga0501045_0081310 3300049824 Bacteria 2389
234 nmdc:mga03n38_186519_c1 3300050490 Bacteria 1066
235 nmdc:mga03n38_188793_c1 3300050490 Bacteria 1060
236 nmdc:mga03n38_218942_c1 3300050490 Bacteria 993
237 nmdc:mga00v17_75135_c1 3300050491 Bacteria 2101
238 nmdc:mga0yw44_54894_c1 3300050492 Bacteria 2423
239 nmdc:mga06z11_503131_c1 3300050494 Bacteria 734
240 nmdc:mga0rr50_255030_c1 3300050513 Bacteria 1458
241 Ga0495601_0145560 3300053077 Bacteria 1546
242 Ga0495601_0310084 3300053077 Bacteria 1028
243 Ga0495612_0080249 3300053078 Bacteria 1370
244 Ga0495619_0012611 3300053085 Bacteria 5320
245 Ga0495619_0073491 3300053085 Bacteria 2291
246 Ga0500566_0000162 3300053094 Bacteria 34256
247 Ga0500577_0141652 3300053142 Bacteria 1014
248 Ga0501084_0120125 3300054114 Bacteria 2210
249 Ga0501084_0193721 3300054114 Bacteria 1715
250 Ga0501082_0206073 3300060353 Bacteria 1711
251 Ga0501082_0455287 3300060353 Bacteria 1118
252 Ga0466962_0030242 3300061719 Bacteria 2593
253 Ga0530510_0010640 3300061734 Bacteria 6452
254 Ga0075369_10079292
255 JGI24738J21930_10033875
256 JGI25406J46586_10001575
257 Ga0070683_100175552
258 Ga0070680_100466585
259 Ga0068868_100064655
260 Ga0070660_100122485
261 Ga0070673_100261671
262 Ga0070714_100000009
263 Ga0070714_100012472
264 Ga0070714_100022982
265 Ga0070714_100076180
266 Ga0070714_100188799
267 Ga0070714_100273432
268 Ga0070713_100152537
269 Ga0070710_10033042
270 Ga0070710_10421000
271 Ga0070701_10414925
272 Ga0070705_100215501
273 Ga0070700_100154798
274 Ga0070678_100028268
275 Ga0070681_10006131
276 Ga0070681_10604727
277 Ga0068867_100438589
278 Ga0070706_100030874
279 Ga0070707_100089542
280 Ga0070684_100620707
281 Ga0070696_100265093
282 Ga0070693_100085730
283 Ga0070665_100073247
284 Ga0068855_100117172
285 Ga0068852_100739986
286 Ga0068864_100428329
287 Ga0068858_100095977
288 Ga0068860_100148183
289 Ga0081539_10113105
290 Ga0070717_10005654
291 Ga0070717_10018875
292 Ga0070717_10048957
293 Ga0070717_10073588
294 Ga0070717_10121965
295 Ga0070717_10154910
296 Ga0070717_10180388
297 Ga0075365_10012837
298 Ga0075365_10032694
299 Ga0075365_10098514
300 Ga0075368_10007835
301 Ga0075363_100043538
302 Ga0075363_100106665
303 Ga0075364_10028097
304 Ga0075364_10327091
305 Ga0070716_100123351
306 Ga0070716_100479495
307 Ga0070712_100243195
308 Ga0070712_100423557
309 Ga0075367_10070284
310 Ga0097621_100042414
311 Ga0068871_100168765
312 Ga0111539_10232677
313 Ga0105245_10042347
314 Ga0105245_10070390
315 Ga0105245_10085972
316 Ga0105247_10043361
317 Ga0105247_10144132
318 Ga0114129_10997684
319 Ga0105237_10584114
320 Ga0105238_10300630
321 Ga0105238_10821977
322 Ga0105249_10225680
323 Ga0105239_10531098
324 Ga0157378_10508177
325 Ga0157372_10189901
326 Ga0157375_10106388
327 Ga0157375_10243493
328 Ga0163163_10122662
329 Ga0157379_10006155
330 Ga0157376_10081632
331 Ga0213876_10018056
332 Ga0213875_10052153
333 Ga0207710_10022074
334 Ga0207710_10152106
335 Ga0207699_10464054
336 Ga0207684_10013802
337 Ga0207707_10484584
338 Ga0207707_10770262
339 Ga0207695_10565622
340 Ga0207693_10000849
341 Ga0207693_10410042
342 Ga0207663_10015167
343 Ga0207660_10072139
344 Ga0207657_10161895
345 Ga0207652_10171696
346 Ga0207646_10172922
347 Ga0207681_10292701
348 Ga0207694_10143505
349 Ga0207694_10276585
350 Ga0207687_10020241
351 Ga0207700_10088976
352 Ga0207700_10555585
353 Ga0207664_10000050
354 Ga0207664_10015287
355 Ga0207664_10100517
356 Ga0207664_10174639
357 Ga0207664_10192319
358 Ga0207664_10538565
359 Ga0207665_10002932
360 Ga0207661_10103085
361 Ga0207667_10093785
362 Ga0207677_10035226
363 Ga0207703_10043727
364 Ga0207708_10365431
365 Ga0207641_10118434
366 Ga0207641_10833602
367 Ga0207676_10036940
368 Ga0207674_10068896
369 Ga0207683_10520811
370 Ga0207698_10661419
371 Ga0268266_10062298
372 Ga0268266_10314187
373 Ga0268266_10399092
374 Ga0268265_10093898
375 Ga0268264_10247072
376 Ga0307512_10010569
377 Ga0265327_10001231
378 Ga0373923_0078282
379 Ga0373957_0046658
380 Ga0373946_0014648
381 Ga0373935_0185136
382 Ga0373933_0051550
383 Ga0373947_0292667
384 Ga0373925_0630397
385 Ga0436364_0377807
386 Ga0436364_1018509
387 Ga0436364_1187765
388 Ga0436365_0251786
389 Ga0436365_1410273
390 Ga0436363_0390175
391 Ga0436363_0425736
392 Ga0436363_1200884
393 Ga0436362_1222249
394 Ga0466969_0223479
395 Ga0466972_0001928
396 Ga0466972_0173721
397 Ga0466972_0254278
398 Ga0466965_0013911
399 Ga0466965_0057356
400 Ga0466966_0003018
401 Ga0466966_0007218
402 Ga0466961_0000965
403 Ga0466961_0073153
404 Ga0466961_0074256
405 Ga0466963_0030365
406 Ga0466963_0291166
407 Ga0466963_0295475
408 Ga0466971_0020886
409 Ga0466971_0137062
410 Ga0466971_0281156
411 Ga0466968_0019611
412 Ga0466968_0225048
413 Ga0466970_0006008
414 Ga0466970_0190233
415 Ga0466957_0006829
416 Ga0466957_0029413
417 Ga0466959_0043436
418 Ga0466958_0010186
419 Ga0466958_0060731
420 Ga0466958_0560774
421 Ga0466967_0005155
422 Ga0466967_0009143
423 Ga0466967_0036605
424 Ga0466967_0350268
425 Ga0466967_0420076
426 Ga0466967_0565418
427 Ga0495592_0021821
428 Ga0495629_0141583
429 Ga0495629_0452819
430 Ga0495651_0007060
431 Ga0495653_0052448
432 Ga0495580_0046548
433 Ga0495582_0033025
434 Ga0495662_0023061
435 Ga0495664_0095201
436 Ga0495608_0027816
437 Ga0495618_0034480
438 Ga0495628_0294395
439 Ga0495630_0058712
440 Ga0495652_0065424
441 Ga0495652_0265982
442 Ga0495640_0110749
443 Ga0495586_0090428
444 Ga0495587_0001976
445 Ga0495667_0011166
446 Ga0495634_0037539
447 Ga0495635_0104536
448 Ga0495657_0122383
449 Ga0495599_0005704
450 Ga0495624_0136862
451 Ga0495600_0022258
452 Ga0495604_0350813
453 Ga0495674_0357550
454 Ga0495676_0143983
455 Ga0495676_0246875
456 Ga0495676_0302093
457 Ga0495680_0026870
458 Ga0495675_0380816
459 Ga0495684_0008302
460 Ga0496102_0128403
461 Ga0496103_0103834
462 Ga0496104_0016910
463 Ga0496108_0013521
464 Ga0496108_0280172
465 Ga0496108_0825229
466 Ga0496109_0016617
467 Ga0496111_0067500
468 Ga0496111_0122632
469 Ga0496112_0001816
470 Ga0496112_0119942
471 Ga0496114_0614545
472 Ga0496118_0000652
473 Ga0501034_0017986
474 Ga0501038_0186416
475 Ga0501039_0053924
476 Ga0501041_0043672
477 Ga0501041_0095116
478 Ga0501042_0166748
479 Ga0501043_0234739
480 Ga0501071_0042877
481 Ga0501072_0100905
482 Ga0501075_0060384
483 Ga0501076_0071989
484 Ga0501079_0128990
485 Ga0501083_0404023
486 Ga0501045_0081310
487 nmdc:mga03n38_186519_c1
488 nmdc:mga03n38_188793_c1
489 nmdc:mga03n38_218942_c1
490 nmdc:mga00v17_75135_c1
491 nmdc:mga0yw44_54894_c1
492 nmdc:mga06z11_503131_c1
493 nmdc:mga0rr50_255030_c1
494 Ga0495601_0145560
495 Ga0495601_0310084
496 Ga0495612_0080249
497 Ga0495619_0012611
498 Ga0495619_0073491
499 Ga0500566_0000162
500 Ga0500577_0141652
501 Ga0501084_0120125
502 Ga0501084_0193721
503 Ga0501082_0206073
504 Ga0501082_0455287
505 Ga0466962_0030242
506 Ga0530510_0010640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

224

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

230

0.86

PF08659

KR

KR domain

36

196

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1t-assembly1.cif.gz_A-2 crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 0.9173 2 220
4bms-assembly1.cif.gz_A short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph 0.9145 2 220
6b9u-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh 0.9144 2 219
6y4d-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with nadp+ 0.9138 2 219
1xr3-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase with nadp and the inhibitor isoniazid bound 0.9113 2 219
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 2 53 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 2 184 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 2 156 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9288 2 161 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9263 1 199 3.40.50.720
ID Description Score Start End GO Terms
AF-C7Q6M4-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9945 2 228 GO:0016491
AF-A0A7Y6AAJ5-F1-model_v4 SDR family oxidoreductase 0.9932 1 229 GO:0016491
AF-A0A1H3NBW6-F1-model_v4 Short-chain dehydrogenase 0.9931 1 222 GO:0016491
AF-A0A6L4A094-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9893 2 200 GO:0016491
AF-A0A7Y6AAJ5-F1-model_v4 SDR family oxidoreductase 0.9889 1 229 GO:0016491

Map