F363933

General Info

Members Datasets Scaffolds Average Seq Length
253 152 506 235

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10008972|Ga0070717_100089727
Length 252
Sequence MTPFMDVPAPLIEVRDLYFQYEDGTQALEAVNFTLQPGETVALLGANGSGKTTFVLQLNGVLRGQGSITVCGLPMTKQTLPRIRSKIGMVFQDSDEQLFMPTVLEDVAFGPLNHGMPEEKAIAQAKLALDRAGLADVWNRAPYHLSAGEKRRVALAGVLAMEPEILVLDEPTTFLDPPAERNLLQLLQELPQAKLIVTHNVRLAASLASRAVFFEKGRLVASGSVDEIVRRFEWTYSDLPLADLRYSAQRRF

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 99.6
Stem 0
Stem Tuber 0
Unclassified 18.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10008972 3300006028 Bacteria 7498
2 Ga0070683_100000011 3300005329 Bacteria 283682
3 Ga0070683_100054545 3300005329 Bacteria 3706
4 Ga0070683_100213207 3300005329 Bacteria 1835
5 Ga0068869_100088878 3300005334 Unclassified 2319
6 Ga0070666_10359390 3300005335 Bacteria 1043
7 Ga0070680_100694675 3300005336 Unclassified 875
8 Ga0070671_100104081 3300005355 Unclassified 2382
9 Ga0070671_100196394 3300005355 Bacteria 1710
10 Ga0070671_100621864 3300005355 Unclassified 934
11 Ga0070673_100005892 3300005364 Bacteria 7909
12 Ga0070673_100226371 3300005364 Bacteria 1621
13 Ga0070659_100051815 3300005366 Bacteria 3227
14 Ga0070667_100588155 3300005367 Bacteria 1025
15 Ga0070667_100652919 3300005367 Bacteria 971
16 Ga0070709_10031137 3300005434 Bacteria 3207
17 Ga0070709_10068307 3300005434 Bacteria 2285
18 Ga0070714_100007467 3300005435 Bacteria 8513
19 Ga0070714_100246020 3300005435 Bacteria 1652
20 Ga0070713_100006799 3300005436 Bacteria 7969
21 Ga0070713_100021373 3300005436 Bacteria 4976
22 Ga0070713_100214640 3300005436 Bacteria 1744
23 Ga0070711_100019048 3300005439 Bacteria 4395
24 Ga0070694_100084288 3300005444 Bacteria 2217
25 Ga0070708_100051359 3300005445 Bacteria 3653
26 Ga0070678_100825847 3300005456 Unclassified 843
27 Ga0070662_100023427 3300005457 Bacteria 4241
28 Ga0070681_10005089 3300005458 Bacteria 12682
29 Ga0070681_10168593 3300005458 Bacteria 2112
30 Ga0070681_10208260 3300005458 Unclassified 1872
31 Ga0070685_10107090 3300005466 Bacteria 1716
32 Ga0070706_100047365 3300005467 Bacteria 3967
33 Ga0070699_100606484 3300005518 Unclassified 998
34 Ga0070679_100183560 3300005530 Bacteria 2064
35 Ga0070684_100000001 3300005535 Bacteria 300240
36 Ga0070684_100143327 3300005535 Bacteria 2162
37 Ga0070684_100278167 3300005535 Bacteria 1533
38 Ga0070697_100387729 3300005536 Unclassified 1211
39 Ga0070697_100425367 3300005536 Bacteria 1154
40 Ga0070693_100067921 3300005547 Bacteria 2091
41 Ga0070665_100553779 3300005548 Bacteria 1162
42 Ga0068855_100017971 3300005563 Bacteria 8497
43 Ga0068855_100127872 3300005563 Bacteria 2904
44 Ga0068855_100128246 3300005563 Unclassified 2899
45 Ga0070664_100266583 3300005564 Bacteria 1542
46 Ga0068857_100002100 3300005577 Bacteria 16180
47 Ga0068856_100136198 3300005614 Bacteria 2461
48 Ga0068852_100032667 3300005616 Bacteria 4312
49 Ga0068859_100110477 3300005617 Bacteria 2811
50 Ga0068859_100225696 3300005617 Bacteria 1961
51 Ga0068864_100167611 3300005618 Bacteria 2001
52 Ga0068864_100418276 3300005618 Bacteria 1277
53 Ga0068863_100168181 3300005841 Bacteria 2102
54 Ga0068863_100284969 3300005841 Unclassified 1601
55 Ga0068858_100220992 3300005842 Bacteria 1794
56 Ga0068860_100205320 3300005843 Unclassified 1910
57 Ga0070717_10022166 3300006028 Bacteria 5017
58 Ga0075431_100005781 3300006847 Bacteria 12234
59 Ga0075433_10484600 3300006852 Bacteria 1089
60 Ga0068865_100077732 3300006881 Bacteria 2372
61 Ga0075436_100004212 3300006914 Bacteria 9869
62 Ga0097620_100110477 3300006931 Bacteria 2811
63 Ga0097620_100225706 3300006931 Bacteria 1961
64 Ga0105240_10329847 3300009093 Bacteria 1737
65 Ga0111539_10541937 3300009094 Archaea 1355
66 Ga0105245_10256200 3300009098 Bacteria 1702
67 Ga0105245_10282776 3300009098 Bacteria 1622
68 Ga0105245_10440680 3300009098 Unclassified 1309
69 Ga0105245_10647996 3300009098 Bacteria 1086
70 Ga0105243_10342115 3300009148 Bacteria 1371
71 Ga0105243_10692665 3300009148 Unclassified 992
72 Ga0105241_10087479 3300009174 Bacteria 2453
73 Ga0105242_10480536 3300009176 Bacteria 1177
74 Ga0105242_10845632 3300009176 Bacteria 910
75 Ga0105242_10907287 3300009176 Unclassified 882
76 Ga0105248_10007432 3300009177 Bacteria 12021
77 Ga0105248_10014348 3300009177 Bacteria 8718
78 Ga0105248_10225266 3300009177 Bacteria 2110
79 Ga0105238_10027321 3300009551 Bacteria 5813
80 Ga0105238_10032360 3300009551 Bacteria 5321
81 Ga0105249_10054525 3300009553 Unclassified 3656
82 Ga0105239_10020006 3300010375 Bacteria 7388
83 Ga0157369_10057321 3300013105 Bacteria 4203
84 Ga0157374_10083740 3300013296 Bacteria 3030
85 Ga0157374_10223141 3300013296 Unclassified 1850
86 Ga0157374_10716909 3300013296 Bacteria 1014
87 Ga0157378_10411125 3300013297 Bacteria 1335
88 Ga0163162_10131893 3300013306 Bacteria 2607
89 Ga0163162_10162084 3300013306 Unclassified 2358
90 Ga0163162_10237881 3300013306 Bacteria 1951
91 Ga0157372_10006473 3300013307 Bacteria 12467
92 Ga0157372_10109435 3300013307 Bacteria 3164
93 Ga0157375_10298288 3300013308 Bacteria 1775
94 Ga0157375_10722387 3300013308 Bacteria 1149
95 Ga0157375_11271916 3300013308 Bacteria 864
96 Ga0157375_11338883 3300013308 Unclassified 842
97 Ga0163163_10039737 3300014325 Bacteria 4593
98 Ga0163163_10059061 3300014325 Bacteria 3793
99 Ga0163163_10076864 3300014325 Bacteria 3334
100 Ga0163163_10220065 3300014325 Bacteria 1947
101 Ga0163163_10805727 3300014325 Bacteria 1003
102 Ga0157379_10049567 3300014968 Bacteria 3750
103 Ga0157379_10317089 3300014968 Unclassified 1423
104 Ga0157376_10079576 3300014969 Bacteria 2810
105 Ga0157376_10979326 3300014969 Bacteria 867
106 Ga0207699_10033963 3300025906 Bacteria 2888
107 Ga0207645_10129331 3300025907 Unclassified 1643
108 Ga0207654_10068268 3300025911 Bacteria 2103
109 Ga0207707_10016148 3300025912 Bacteria 6513
110 Ga0207707_10019610 3300025912 Bacteria 5901
111 Ga0207707_10140722 3300025912 Bacteria 2110
112 Ga0207695_10320985 3300025913 Bacteria 1438
113 Ga0207663_10012587 3300025916 Bacteria 4580
114 Ga0207652_10146715 3300025921 Unclassified 2112
115 Ga0207652_10604081 3300025921 Unclassified 983
116 Ga0207687_10603581 3300025927 Bacteria 925
117 Ga0207700_10011480 3300025928 Bacteria 5650
118 Ga0207700_10298026 3300025928 Bacteria 1391
119 Ga0207664_10000744 3300025929 Bacteria 22168
120 Ga0207644_10081023 3300025931 Bacteria 2398
121 Ga0207690_10022784 3300025932 Bacteria 3900
122 Ga0207706_10096138 3300025933 Bacteria 2605
123 Ga0207686_10031250 3300025934 Bacteria 3159
124 Ga0207686_10084918 3300025934 Unclassified 2075
125 Ga0207686_10698368 3300025934 Bacteria 806
126 Ga0207709_10661544 3300025935 Bacteria 832
127 Ga0207670_10062454 3300025936 Unclassified 2546
128 Ga0207704_10006489 3300025938 Bacteria 5459
129 Ga0207704_10109671 3300025938 Bacteria 1862
130 Ga0207665_10200234 3300025939 Bacteria 1455
131 Ga0207711_10010654 3300025941 Bacteria 7646
132 Ga0207711_10161827 3300025941 Bacteria 2027
133 Ga0207711_10231372 3300025941 Bacteria 1693
134 Ga0207711_10774630 3300025941 Unclassified 894
135 Ga0207661_10000016 3300025944 Bacteria 305159
136 Ga0207661_10056369 3300025944 Bacteria 3154
137 Ga0207679_10460023 3300025945 Bacteria 1130
138 Ga0207667_10151722 3300025949 Bacteria 2385
139 Ga0207667_10342519 3300025949 Bacteria 1525
140 Ga0207651_10009599 3300025960 Bacteria 5310
141 Ga0207651_10197959 3300025960 Bacteria 1608
142 Ga0207712_10117979 3300025961 Bacteria 2002
143 Ga0207658_10441223 3300025986 Unclassified 1151
144 Ga0207677_10170111 3300026023 Bacteria 1703
145 Ga0207703_10201496 3300026035 Bacteria 1769
146 Ga0207703_10398473 3300026035 Unclassified 1277
147 Ga0207639_10048635 3300026041 Bacteria 3211
148 Ga0207702_10084292 3300026078 Unclassified 2767
149 Ga0207702_10399924 3300026078 Bacteria 1324
150 Ga0207641_10104877 3300026088 Bacteria 2496
151 Ga0207676_10117926 3300026095 Bacteria 2233
152 Ga0207676_10133871 3300026095 Bacteria 2112
153 Ga0207676_10879704 3300026095 Unclassified 878
154 Ga0207674_10023392 3300026116 Bacteria 6620
155 Ga0207683_10362389 3300026121 Bacteria 1331
156 Ga0207698_10278392 3300026142 Bacteria 1546
157 Ga0268266_10232937 3300028379 Unclassified 1697
158 Ga0268264_10089869 3300028381 Unclassified 2645
159 Ga0265338_10039944 3300028800 Bacteria 4415
160 Ga0265324_10008458 3300029957 Bacteria 4089
161 Ga0265332_10072175 3300031238 Unclassified 1470
162 Ga0265328_10010271 3300031239 Bacteria 3774
163 Ga0265320_10002817 3300031240 Bacteria 11964
164 Ga0265325_10080059 3300031241 Bacteria 1625
165 Ga0265331_10001828 3300031250 Bacteria 15074
166 Ga0265316_10002004 3300031344 Bacteria 21457
167 Ga0265316_10009329 3300031344 Bacteria 9040
168 Ga0265316_10014169 3300031344 Bacteria 7034
169 Ga0265316_10136702 3300031344 Bacteria 1843
170 Ga0265342_10050786 3300031712 Bacteria 2475
171 Ga0373923_0156655 3300035111 Bacteria 1037
172 Ga0373945_0131006 3300035116 Bacteria 1004
173 Ga0373954_0015839 3300035118 Unclassified 3372
174 Ga0373954_0034696 3300035118 Bacteria 2338
175 Ga0373954_0065989 3300035118 Bacteria 1713
176 Ga0373956_0092945 3300035119 Unclassified 1393
177 Ga0373956_0174311 3300035119 Bacteria 1016
178 Ga0373943_0116926 3300035170 Bacteria 1413
179 Ga0373955_0094774 3300035172 Bacteria 1706
180 Ga0373935_0006092 3300035692 Bacteria 7172
181 Ga0373935_0073922 3300035692 Bacteria 2203
182 Ga0373927_0004285 3300035695 Bacteria 10016
183 Ga0373927_0004287 3300035695 Bacteria 10011
184 Ga0373927_0004863 3300035695 Bacteria 9344
185 Ga0373927_0050492 3300035695 Bacteria 2690
186 Ga0373933_0279292 3300035724 Bacteria 1079
187 Ga0373947_0513110 3300035725 Unclassified 815
188 Ga0373937_0002521 3300036401 Bacteria 15208
189 Ga0373937_0015410 3300036401 Bacteria 6759
190 Ga0373937_0031624 3300036401 Bacteria 4797
191 Ga0373937_0193644 3300036401 Bacteria 1911
192 Ga0373925_0000960 3300037068 Bacteria 26220
193 Ga0373925_0032159 3300037068 Unclassified 3860
194 Ga0373925_0109934 3300037068 Unclassified 2128
195 Ga0373925_0207988 3300037068 Unclassified 1558
196 Ga0373925_0784053 3300037068 Unclassified 786
197 Ga0451577_0000082 3300042876 Bacteria 214418
198 Ga0453684_0006566 3300044712 Bacteria 22011
199 Ga0453684_0247009 3300044712 Bacteria 2051
200 Ga0451576_0076531 3300045051 Unclassified 3482
201 Ga0495592_0031375 3300046454 Bacteria 4016
202 Ga0495592_0414489 3300046454 Unclassified 851
203 Ga0495651_0149496 3300046462 Bacteria 1685
204 Ga0495580_0003067 3300046472 Bacteria 14309
205 Ga0495580_0012856 3300046472 Bacteria 6415
206 Ga0495580_0028484 3300046472 Bacteria 4060
207 Ga0495582_0005078 3300046473 Bacteria 7372
208 Ga0495664_0001207 3300046477 Bacteria 13502
209 Ga0495628_0038687 3300046516 Bacteria 3816
210 Ga0495628_0392413 3300046516 Bacteria 1015
211 Ga0495652_0058149 3300046529 Bacteria 3275
212 Ga0495652_0419948 3300046529 Bacteria 943
213 Ga0495665_0325540 3300046531 Bacteria 784
214 Ga0495640_0156275 3300046533 Bacteria 1464
215 Ga0495587_0257779 3300046536 Bacteria 980
216 Ga0495645_0004118 3300046543 Bacteria 9929
217 Ga0495645_0113856 3300046543 Bacteria 1912
218 Ga0495645_0213404 3300046543 Unclassified 1302
219 Ga0495645_0214222 3300046543 Bacteria 1299
220 Ga0495645_0258939 3300046543 Bacteria 1153
221 Ga0495645_0476410 3300046543 Bacteria 784
222 Ga0495667_0097271 3300046559 Unclassified 1906
223 Ga0495667_0252058 3300046559 Bacteria 1123
224 Ga0495635_0169772 3300046663 Bacteria 1484
225 Ga0495657_0140177 3300046675 Bacteria 1508
226 Ga0495599_0074359 3300046678 Bacteria 2121
227 Ga0495623_0162721 3300046679 Bacteria 1310
228 Ga0495646_0003605 3300046680 Bacteria 9667
229 Ga0495658_0013480 3300046683 Bacteria 4161
230 Ga0495613_0139295 3300046689 Bacteria 1734
231 Ga0495613_0218905 3300046689 Bacteria 1337
232 Ga0495600_0102636 3300046809 Bacteria 1864
233 Ga0495604_0064829 3300047317 Bacteria 2782
234 Ga0495674_0007307 3300047319 Bacteria 10563
235 Ga0495674_0035310 3300047319 Bacteria 4512
236 Ga0495674_0047490 3300047319 Bacteria 3807
237 Ga0495674_0053318 3300047319 Unclassified 3556
238 Ga0495674_0076751 3300047319 Bacteria 2873
239 Ga0495674_0109930 3300047319 Bacteria 2338
240 Ga0495674_0330755 3300047319 Bacteria 1240
241 Ga0495680_0197102 3300047322 Bacteria 1446
242 Ga0495680_0308152 3300047322 Unclassified 1110
243 Ga0495684_0021623 3300047471 Bacteria 4953
244 Ga0495684_0070857 3300047471 Bacteria 2649
245 Ga0495684_0143104 3300047471 Unclassified 1792
246 Ga0495602_0161186 3300048088 Bacteria 1751
247 Ga0496115_0372546 3300048918 Unclassified 1162
248 Ga0501034_0220795 3300049571 Bacteria 1848
249 nmdc:mga05p37_81403_c1 3300050507 Bacteria 3988
250 nmdc:mga06r32_74749_c1 3300050510 Bacteria 3286
251 nmdc:mga0n895_244977_c1 3300050512 Bacteria 1819
252 nmdc:mga08x19_3311_c1 3300050514 Bacteria 9630
253 Ga0501082_0000242 3300060353 Bacteria 47791
254 Ga0070717_10008972
255 Ga0070683_100000011
256 Ga0070683_100054545
257 Ga0070683_100213207
258 Ga0068869_100088878
259 Ga0070666_10359390
260 Ga0070680_100694675
261 Ga0070671_100104081
262 Ga0070671_100196394
263 Ga0070671_100621864
264 Ga0070673_100005892
265 Ga0070673_100226371
266 Ga0070659_100051815
267 Ga0070667_100588155
268 Ga0070667_100652919
269 Ga0070709_10031137
270 Ga0070709_10068307
271 Ga0070714_100007467
272 Ga0070714_100246020
273 Ga0070713_100006799
274 Ga0070713_100021373
275 Ga0070713_100214640
276 Ga0070711_100019048
277 Ga0070694_100084288
278 Ga0070708_100051359
279 Ga0070678_100825847
280 Ga0070662_100023427
281 Ga0070681_10005089
282 Ga0070681_10168593
283 Ga0070681_10208260
284 Ga0070685_10107090
285 Ga0070706_100047365
286 Ga0070699_100606484
287 Ga0070679_100183560
288 Ga0070684_100000001
289 Ga0070684_100143327
290 Ga0070684_100278167
291 Ga0070697_100387729
292 Ga0070697_100425367
293 Ga0070693_100067921
294 Ga0070665_100553779
295 Ga0068855_100017971
296 Ga0068855_100127872
297 Ga0068855_100128246
298 Ga0070664_100266583
299 Ga0068857_100002100
300 Ga0068856_100136198
301 Ga0068852_100032667
302 Ga0068859_100110477
303 Ga0068859_100225696
304 Ga0068864_100167611
305 Ga0068864_100418276
306 Ga0068863_100168181
307 Ga0068863_100284969
308 Ga0068858_100220992
309 Ga0068860_100205320
310 Ga0070717_10022166
311 Ga0075431_100005781
312 Ga0075433_10484600
313 Ga0068865_100077732
314 Ga0075436_100004212
315 Ga0097620_100110477
316 Ga0097620_100225706
317 Ga0105240_10329847
318 Ga0111539_10541937
319 Ga0105245_10256200
320 Ga0105245_10282776
321 Ga0105245_10440680
322 Ga0105245_10647996
323 Ga0105243_10342115
324 Ga0105243_10692665
325 Ga0105241_10087479
326 Ga0105242_10480536
327 Ga0105242_10845632
328 Ga0105242_10907287
329 Ga0105248_10007432
330 Ga0105248_10014348
331 Ga0105248_10225266
332 Ga0105238_10027321
333 Ga0105238_10032360
334 Ga0105249_10054525
335 Ga0105239_10020006
336 Ga0157369_10057321
337 Ga0157374_10083740
338 Ga0157374_10223141
339 Ga0157374_10716909
340 Ga0157378_10411125
341 Ga0163162_10131893
342 Ga0163162_10162084
343 Ga0163162_10237881
344 Ga0157372_10006473
345 Ga0157372_10109435
346 Ga0157375_10298288
347 Ga0157375_10722387
348 Ga0157375_11271916
349 Ga0157375_11338883
350 Ga0163163_10039737
351 Ga0163163_10059061
352 Ga0163163_10076864
353 Ga0163163_10220065
354 Ga0163163_10805727
355 Ga0157379_10049567
356 Ga0157379_10317089
357 Ga0157376_10079576
358 Ga0157376_10979326
359 Ga0207699_10033963
360 Ga0207645_10129331
361 Ga0207654_10068268
362 Ga0207707_10016148
363 Ga0207707_10019610
364 Ga0207707_10140722
365 Ga0207695_10320985
366 Ga0207663_10012587
367 Ga0207652_10146715
368 Ga0207652_10604081
369 Ga0207687_10603581
370 Ga0207700_10011480
371 Ga0207700_10298026
372 Ga0207664_10000744
373 Ga0207644_10081023
374 Ga0207690_10022784
375 Ga0207706_10096138
376 Ga0207686_10031250
377 Ga0207686_10084918
378 Ga0207686_10698368
379 Ga0207709_10661544
380 Ga0207670_10062454
381 Ga0207704_10006489
382 Ga0207704_10109671
383 Ga0207665_10200234
384 Ga0207711_10010654
385 Ga0207711_10161827
386 Ga0207711_10231372
387 Ga0207711_10774630
388 Ga0207661_10000016
389 Ga0207661_10056369
390 Ga0207679_10460023
391 Ga0207667_10151722
392 Ga0207667_10342519
393 Ga0207651_10009599
394 Ga0207651_10197959
395 Ga0207712_10117979
396 Ga0207658_10441223
397 Ga0207677_10170111
398 Ga0207703_10201496
399 Ga0207703_10398473
400 Ga0207639_10048635
401 Ga0207702_10084292
402 Ga0207702_10399924
403 Ga0207641_10104877
404 Ga0207676_10117926
405 Ga0207676_10133871
406 Ga0207676_10879704
407 Ga0207674_10023392
408 Ga0207683_10362389
409 Ga0207698_10278392
410 Ga0268266_10232937
411 Ga0268264_10089869
412 Ga0265338_10039944
413 Ga0265324_10008458
414 Ga0265332_10072175
415 Ga0265328_10010271
416 Ga0265320_10002817
417 Ga0265325_10080059
418 Ga0265331_10001828
419 Ga0265316_10002004
420 Ga0265316_10009329
421 Ga0265316_10014169
422 Ga0265316_10136702
423 Ga0265342_10050786
424 Ga0373923_0156655
425 Ga0373945_0131006
426 Ga0373954_0015839
427 Ga0373954_0034696
428 Ga0373954_0065989
429 Ga0373956_0092945
430 Ga0373956_0174311
431 Ga0373943_0116926
432 Ga0373955_0094774
433 Ga0373935_0006092
434 Ga0373935_0073922
435 Ga0373927_0004285
436 Ga0373927_0004287
437 Ga0373927_0004863
438 Ga0373927_0050492
439 Ga0373933_0279292
440 Ga0373947_0513110
441 Ga0373937_0002521
442 Ga0373937_0015410
443 Ga0373937_0031624
444 Ga0373937_0193644
445 Ga0373925_0000960
446 Ga0373925_0032159
447 Ga0373925_0109934
448 Ga0373925_0207988
449 Ga0373925_0784053
450 Ga0451577_0000082
451 Ga0453684_0006566
452 Ga0453684_0247009
453 Ga0451576_0076531
454 Ga0495592_0031375
455 Ga0495592_0414489
456 Ga0495651_0149496
457 Ga0495580_0003067
458 Ga0495580_0012856
459 Ga0495580_0028484
460 Ga0495582_0005078
461 Ga0495664_0001207
462 Ga0495628_0038687
463 Ga0495628_0392413
464 Ga0495652_0058149
465 Ga0495652_0419948
466 Ga0495665_0325540
467 Ga0495640_0156275
468 Ga0495587_0257779
469 Ga0495645_0004118
470 Ga0495645_0113856
471 Ga0495645_0213404
472 Ga0495645_0214222
473 Ga0495645_0258939
474 Ga0495645_0476410
475 Ga0495667_0097271
476 Ga0495667_0252058
477 Ga0495635_0169772
478 Ga0495657_0140177
479 Ga0495599_0074359
480 Ga0495623_0162721
481 Ga0495646_0003605
482 Ga0495658_0013480
483 Ga0495613_0139295
484 Ga0495613_0218905
485 Ga0495600_0102636
486 Ga0495604_0064829
487 Ga0495674_0007307
488 Ga0495674_0035310
489 Ga0495674_0047490
490 Ga0495674_0053318
491 Ga0495674_0076751
492 Ga0495674_0109930
493 Ga0495674_0330755
494 Ga0495680_0197102
495 Ga0495680_0308152
496 Ga0495684_0021623
497 Ga0495684_0070857
498 Ga0495684_0143104
499 Ga0495602_0161186
500 Ga0496115_0372546
501 Ga0501034_0220795
502 nmdc:mga05p37_81403_c1
503 nmdc:mga06r32_74749_c1
504 nmdc:mga0n895_244977_c1
505 nmdc:mga08x19_3311_c1
506 Ga0501082_0000242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

28

173

0.93

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9506 2 227
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.949 2 230
4hzu-assembly1.cif.gz_A structure of a bacterial energy-coupling factor transporter 0.9456 5 225
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.9438 3 229
4rfs-assembly1.cif.gz_B structure of a pantothenate energy coupling factor transporter 0.9427 6 225
ID Description Score Start End Superfamily
4huqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9503 6 225 3.40.50.300
af_Q2FUT2_290_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9461 2 223 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 4 229 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9416 3 216 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 5 219 3.40.50.300
ID Description Score Start End GO Terms
AF-K0DB19-F1-model_v4 ABC transporter ATP binding protein 0.9612 4 218 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A3N5U8W3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9601 2 110 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A1V6D2Y9-F1-model_v4 Energy-coupling factor transporter ATP-binding protein EcfA1 (EC 3.6.3.-) 0.9597 3 223 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A7X8ASX2-F1-model_v4 Energy-coupling factor transporter ATPase 0.9544 5 229 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A3E2C8A1-F1-model_v4 Cobalt ABC transporter ATP-binding protein 0.9542 9 166 GO:0005524
GO:0016887
GO:0042626
GO:0043190

Map