F363892

General Info

Members Datasets Scaffolds Average Seq Length
253 166 506 281

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100032201|Ga0070672_1000322013
Length 311
Sequence VEQFASGWKRSYYGKGDVIAYRLNRDGHVPAGQRPVFGANVLMLVYGDAFWRTYTEGDNTGLVATDSMKNFIQRETMNFAGNALADYCQFLAATFLAKYPQVDGIQVSAVEIPYEGVNGQIAFTPGGPERATARVELSRTAVVEAACGIRGFKLLRLGGSAFHGFVRDEYTTLPDIRNRPLYMWLDLEWRYTNPNDAFTAADPLRGIRPTPGSPAVAGRDPRSDPGSSDVASGIRIRHIVHDVFASFESGSIQQVIYQMGARMLAELPAIAEVHLEANNRTWDTVAERGDELGIYTDARPPYGCLGLRLTR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.42
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100032201 3300005543 Bacteria 3955
2 JGI25406J46586_10006784 3300003203 Bacteria 5260
3 rootH1_10113620 3300003316 Unclassified 1528
4 Ga0070683_100003586 3300005329 Bacteria 12634
5 Ga0068869_100014205 3300005334 Bacteria 5316
6 Ga0070680_100261508 3300005336 Bacteria 1464
7 Ga0068868_100037973 3300005338 Bacteria 3736
8 Ga0070673_100202975 3300005364 Bacteria 1708
9 Ga0070688_100047521 3300005365 Unclassified 2663
10 Ga0070662_100151293 3300005457 Unclassified 1807
11 Ga0070681_10098085 3300005458 Bacteria 2876
12 Ga0070681_10398404 3300005458 Unclassified 1288
13 Ga0068867_100053352 3300005459 Unclassified 2986
14 Ga0070707_100389766 3300005468 Bacteria 1353
15 Ga0070699_100012040 3300005518 Bacteria 7468
16 Ga0070699_100311565 3300005518 Bacteria 1413
17 Ga0070679_100500570 3300005530 Bacteria 1159
18 Ga0070684_100412022 3300005535 Bacteria 1247
19 Ga0068853_100276084 3300005539 Bacteria 1548
20 Ga0068853_100431778 3300005539 Unclassified 1237
21 Ga0070665_100078518 3300005548 Bacteria 3307
22 Ga0070665_100230779 3300005548 Unclassified 1851
23 Ga0068855_100240308 3300005563 Unclassified 2024
24 Ga0070664_100313001 3300005564 Bacteria 1421
25 Ga0068857_100001045 3300005577 Bacteria 21421
26 Ga0068857_100088026 3300005577 Unclassified 2778
27 Ga0068857_100236518 3300005577 Bacteria 1671
28 Ga0068856_100329276 3300005614 Bacteria 1545
29 Ga0068859_100043452 3300005617 Bacteria 4516
30 Ga0068864_100053939 3300005618 Bacteria 3469
31 Ga0068864_100124436 3300005618 Bacteria 2309
32 Ga0068864_100551363 3300005618 Unclassified 1114
33 Ga0068863_100053505 3300005841 Bacteria 3827
34 Ga0068860_100007872 3300005843 Bacteria 10639
35 Ga0068860_100260208 3300005843 Bacteria 1691
36 Ga0081539_10000190 3300005985 Bacteria 142511
37 Ga0081539_10002496 3300005985 Bacteria 25819
38 Ga0070717_10053793 3300006028 Bacteria 3319
39 Ga0097621_100002738 3300006237 Bacteria 12061
40 Ga0097621_100311623 3300006237 Bacteria 1392
41 Ga0097621_100645534 3300006237 Unclassified 971
42 Ga0068871_100084049 3300006358 Bacteria 2641
43 Ga0075428_100347914 3300006844 Bacteria 1591
44 Ga0075430_100021918 3300006846 Bacteria 5429
45 Ga0075430_100174061 3300006846 Bacteria 1791
46 Ga0075431_100008497 3300006847 Bacteria 10279
47 Ga0075431_100297582 3300006847 Bacteria 1631
48 Ga0075431_100434590 3300006847 Bacteria 1310
49 Ga0075431_100457859 3300006847 Unclassified 1271
50 Ga0075433_10021556 3300006852 Bacteria 5404
51 Ga0068865_100028831 3300006881 Bacteria 3678
52 Ga0097620_100043452 3300006931 Bacteria 4516
53 Ga0105240_10001230 3300009093 Bacteria 44482
54 Ga0105240_10005541 3300009093 Bacteria 18798
55 Ga0105240_10149144 3300009093 Bacteria 2787
56 Ga0105240_10219333 3300009093 Bacteria 2217
57 Ga0105240_10278627 3300009093 Unclassified 1922
58 Ga0111539_10056091 3300009094 Bacteria 4684
59 Ga0105245_10025163 3300009098 Bacteria 5234
60 Ga0105245_10391082 3300009098 Bacteria 1387
61 Ga0105247_10067244 3300009101 Bacteria 2232
62 Ga0114129_10034807 3300009147 Bacteria 7116
63 Ga0114129_10111321 3300009147 Bacteria 3778
64 Ga0114129_10812432 3300009147 Bacteria 1192
65 Ga0105243_10224754 3300009148 Bacteria 1661
66 Ga0105241_10035007 3300009174 Bacteria 3777
67 Ga0105241_10066199 3300009174 Bacteria 2794
68 Ga0105242_10001360 3300009176 Bacteria 19285
69 Ga0105242_10104801 3300009176 Bacteria 2401
70 Ga0105242_10346793 3300009176 Unclassified 1370
71 Ga0105248_10015001 3300009177 Bacteria 8531
72 Ga0105248_10027711 3300009177 Bacteria 6309
73 Ga0105248_10635660 3300009177 Bacteria 1204
74 Ga0105237_10018165 3300009545 Bacteria 7281
75 Ga0105237_10059146 3300009545 Bacteria 3834
76 Ga0105237_10810269 3300009545 Unclassified 943
77 Ga0105238_10104161 3300009551 Bacteria 2818
78 Ga0105238_10390936 3300009551 Bacteria 1383
79 Ga0105239_10033429 3300010375 Bacteria 5648
80 Ga0105239_10101701 3300010375 Bacteria 3179
81 Ga0105246_10024709 3300011119 Bacteria 3907
82 Ga0105246_10115854 3300011119 Bacteria 1977
83 Ga0157369_10384899 3300013105 Bacteria 1456
84 Ga0157369_10448062 3300013105 Bacteria 1337
85 Ga0157374_10006789 3300013296 Bacteria 9730
86 Ga0157374_10099390 3300013296 Bacteria 2787
87 Ga0157374_10121839 3300013296 Bacteria 2517
88 Ga0157374_10427319 3300013296 Bacteria 1324
89 Ga0157378_10085761 3300013297 Bacteria 2853
90 Ga0163162_10002784 3300013306 Bacteria 16620
91 Ga0163162_10089222 3300013306 Unclassified 3163
92 Ga0157372_10263460 3300013307 Bacteria 2002
93 Ga0157375_10310376 3300013308 Unclassified 1741
94 Ga0163163_10027803 3300014325 Bacteria 5423
95 Ga0163163_10039936 3300014325 Bacteria 4582
96 Ga0163163_10126874 3300014325 Bacteria 2590
97 Ga0157380_10271564 3300014326 Bacteria 1546
98 Ga0157376_10096376 3300014969 Bacteria 2574
99 Ga0157376_10116246 3300014969 Bacteria 2363
100 Ga0157376_10658494 3300014969 Unclassified 1048
101 Ga0213876_10046341 3300021384 Bacteria 2299
102 Ga0207680_10019866 3300025903 Bacteria 3603
103 Ga0207707_10030051 3300025912 Bacteria 4751
104 Ga0207707_10405665 3300025912 Unclassified 1170
105 Ga0207695_10001403 3300025913 Bacteria 40591
106 Ga0207695_10035974 3300025913 Bacteria 5359
107 Ga0207660_10246949 3300025917 Bacteria 1408
108 Ga0207657_10494556 3300025919 Bacteria 958
109 Ga0207694_10020003 3300025924 Bacteria 5063
110 Ga0207694_10161413 3300025924 Unclassified 1810
111 Ga0207690_10207156 3300025932 Bacteria 1493
112 Ga0207706_10255377 3300025933 Bacteria 1530
113 Ga0207686_10128613 3300025934 Unclassified 1734
114 Ga0207686_10218564 3300025934 Unclassified 1374
115 Ga0207704_10029933 3300025938 Bacteria 3045
116 Ga0207691_10045603 3300025940 Bacteria 4029
117 Ga0207711_10115126 3300025941 Bacteria 2395
118 Ga0207711_10768156 3300025941 Unclassified 898
119 Ga0207661_10011766 3300025944 Bacteria 6353
120 Ga0207661_10167550 3300025944 Bacteria 1910
121 Ga0207679_10268992 3300025945 Bacteria 1457
122 Ga0207667_10087943 3300025949 Bacteria 3214
123 Ga0207651_10351572 3300025960 Bacteria 1241
124 Ga0207712_10149154 3300025961 Bacteria 1804
125 Ga0207658_10205477 3300025986 Bacteria 1647
126 Ga0207703_10086766 3300026035 Unclassified 2622
127 Ga0207703_10270803 3300026035 Bacteria 1538
128 Ga0207639_10125296 3300026041 Bacteria 2118
129 Ga0207639_10241171 3300026041 Bacteria 1572
130 Ga0207702_10406253 3300026078 Unclassified 1314
131 Ga0207641_10004685 3300026088 Bacteria 11794
132 Ga0207648_10068612 3300026089 Unclassified 3090
133 Ga0207676_10124899 3300026095 Bacteria 2177
134 Ga0207674_10003344 3300026116 Bacteria 19689
135 Ga0207674_10009778 3300026116 Bacteria 10924
136 Ga0207683_10320818 3300026121 Bacteria 1419
137 Ga0207683_10527038 3300026121 Bacteria 1092
138 Ga0207428_10085018 3300027907 Bacteria 2464
139 Ga0268266_10088791 3300028379 Bacteria 2705
140 Ga0268266_10276548 3300028379 Unclassified 1560
141 Ga0268264_10045170 3300028381 Unclassified 3657
142 Ga0268264_10217801 3300028381 Bacteria 1756
143 Ga0265339_10093319 3300031249 Bacteria 1575
144 Ga0265314_10003198 3300031711 Bacteria 16041
145 Ga0265314_10077160 3300031711 Bacteria 2211
146 Ga0265342_10022638 3300031712 Bacteria 3991
147 Ga0307409_100382865 3300031995 Bacteria 1338
148 Ga0307411_10170699 3300032005 Bacteria 1640
149 Ga0307411_10284962 3300032005 Archaea 1317
150 Ga0373954_0052741 3300035118 Bacteria 1911
151 Ga0373937_0145047 3300036401 Bacteria 2222
152 Ga0373925_0303406 3300037068 Bacteria 1290
153 Ga0436365_0876895 3300039437 Bacteria 5403
154 Ga0451576_0271620 3300045051 Bacteria 1773
155 Ga0495603_0133834 3300046455 Bacteria 1443
156 Ga0495651_0093998 3300046462 Bacteria 2244
157 Ga0495651_0117116 3300046462 Bacteria 1961
158 Ga0495580_0008737 3300046472 Bacteria 8026
159 Ga0495662_0029875 3300046476 Bacteria 2630
160 Ga0495664_0002347 3300046477 Bacteria 10140
161 Ga0495594_0024459 3300046499 Bacteria 3244
162 Ga0495608_0109832 3300046511 Bacteria 1773
163 Ga0495628_0016032 3300046516 Bacteria 6252
164 Ga0495628_0161945 3300046516 Bacteria 1700
165 Ga0495643_0001528 3300046522 Bacteria 20803
166 Ga0495652_0013606 3300046529 Bacteria 7323
167 Ga0495652_0223585 3300046529 Bacteria 1413
168 Ga0495665_0042973 3300046531 Bacteria 2404
169 Ga0495665_0045220 3300046531 Bacteria 2339
170 Ga0495587_0006244 3300046536 Bacteria 7780
171 Ga0495645_0002042 3300046543 Bacteria 13731
172 Ga0495645_0004778 3300046543 Bacteria 9258
173 Ga0495667_0037069 3300046559 Bacteria 3251
174 Ga0495667_0055518 3300046559 Unclassified 2605
175 Ga0495634_0020215 3300046642 Bacteria 4723
176 Ga0495635_0100444 3300046663 Bacteria 1977
177 Ga0495588_0126130 3300046674 Bacteria 1350
178 Ga0495657_0084193 3300046675 Bacteria 2052
179 Ga0495599_0018516 3300046678 Bacteria 4338
180 Ga0495599_0174732 3300046678 Bacteria 1325
181 Ga0495623_0055505 3300046679 Bacteria 2497
182 Ga0495613_0072301 3300046689 Bacteria 2514
183 Ga0495613_0082398 3300046689 Bacteria 2336
184 Ga0495600_0070781 3300046809 Bacteria 2279
185 Ga0495600_0155316 3300046809 Unclassified 1480
186 Ga0495581_0146159 3300047315 Bacteria 1380
187 Ga0495581_0255551 3300047315 Bacteria 1025
188 Ga0495604_0031669 3300047317 Unclassified 4195
189 Ga0495674_0014290 3300047319 Bacteria 7433
190 Ga0495674_0035106 3300047319 Bacteria 4526
191 Ga0495680_0404716 3300047322 Unclassified 941
192 Ga0495675_0005537 3300047444 Bacteria 7702
193 Ga0495675_0101293 3300047444 Unclassified 1802
194 Ga0495684_0031911 3300047471 Bacteria 4044
195 Ga0495602_0051186 3300048088 Bacteria 3681
196 Ga0496110_0015172 3300048913 Bacteria 6408
197 Ga0501031_0252983 3300049568 Bacteria 1145
198 Ga0501032_0000238 3300049569 Bacteria 45642
199 Ga0501032_0091458 3300049569 Bacteria 2018
200 Ga0501033_0026298 3300049570 Bacteria 4381
201 Ga0501034_0032208 3300049571 Bacteria 5326
202 Ga0501034_0135702 3300049571 Bacteria 2441
203 Ga0501036_0070983 3300049572 Bacteria 2945
204 Ga0501036_0145979 3300049572 Bacteria 1995
205 Ga0501037_0013829 3300049573 Bacteria 5947
206 Ga0501038_0026628 3300049574 Bacteria 5149
207 Ga0501039_0076502 3300049575 Bacteria 2602
208 Ga0501040_0106190 3300049576 Bacteria 1962
209 Ga0501041_0224434 3300049577 Bacteria 1179
210 Ga0501042_0272552 3300049578 Bacteria 1222
211 Ga0501043_0002272 3300049579 Bacteria 16347
212 Ga0501046_0004812 3300049580 Bacteria 12172
213 Ga0501046_0012933 3300049580 Bacteria 7094
214 Ga0501047_0003539 3300049581 Bacteria 14747
215 Ga0501047_0007297 3300049581 Bacteria 10391
216 Ga0501067_0052267 3300049583 Bacteria 2264
217 Ga0501068_0187132 3300049584 Bacteria 1310
218 Ga0501069_0195459 3300049585 Bacteria 1171
219 Ga0501070_0038377 3300049586 Bacteria 3996
220 Ga0501071_0028368 3300049587 Bacteria 3945
221 Ga0501072_0011663 3300049588 Bacteria 6714
222 Ga0501072_0012699 3300049588 Bacteria 6441
223 Ga0501073_0007403 3300049589 Bacteria 8159
224 Ga0501073_0020453 3300049589 Bacteria 4773
225 Ga0501073_0070648 3300049589 Bacteria 2432
226 Ga0501073_0076161 3300049589 Bacteria 2335
227 Ga0501074_0272531 3300049590 Bacteria 1203
228 Ga0501075_0011787 3300049591 Bacteria 6198
229 Ga0501076_0251280 3300049592 Unclassified 1447
230 Ga0501080_0001278 3300049742 Bacteria 20899
231 Ga0501080_0024470 3300049742 Bacteria 5596
232 Ga0501080_0327364 3300049742 Bacteria 1386
233 Ga0501083_0003976 3300049744 Bacteria 10378
234 Ga0501035_0002571 3300049822 Bacteria 17737
235 Ga0501044_0014677 3300049823 Bacteria 8445
236 Ga0501044_0019532 3300049823 Bacteria 7246
237 Ga0501044_0024135 3300049823 Bacteria 6459
238 Ga0501045_0084120 3300049824 Bacteria 2347
239 nmdc:mga05p37_122804_c1 3300050507 Bacteria 3190
240 nmdc:mga0qj67_16744_c1 3300050509 Bacteria 5566
241 nmdc:mga0qj67_194975_c1 3300050509 Bacteria 1646
242 nmdc:mga06r32_154676_c1 3300050510 Bacteria 2274
243 nmdc:mga06r32_764880_c1 3300050510 Bacteria 928
244 nmdc:mga08y16_9471_c1 3300050511 Bacteria 10221
245 nmdc:mga0a205_370372_c1 3300050515 Bacteria 1298
246 Ga0501084_0004492 3300054114 Bacteria 11397
247 Ga0501084_0222763 3300054114 Bacteria 1591
248 Ga0501084_0369481 3300054114 Bacteria 1212
249 Ga0501084_0419524 3300054114 Bacteria 1131
250 Ga0590071_002799 3300059421 Bacteria 4365
251 Ga0590077_016653 3300059426 Bacteria 1543
252 Ga0501082_0008422 3300060353 Bacteria 8897
253 Ga0501082_0074538 3300060353 Bacteria 2923
254 Ga0070672_100032201
255 JGI25406J46586_10006784
256 rootH1_10113620
257 Ga0070683_100003586
258 Ga0068869_100014205
259 Ga0070680_100261508
260 Ga0068868_100037973
261 Ga0070673_100202975
262 Ga0070688_100047521
263 Ga0070662_100151293
264 Ga0070681_10098085
265 Ga0070681_10398404
266 Ga0068867_100053352
267 Ga0070707_100389766
268 Ga0070699_100012040
269 Ga0070699_100311565
270 Ga0070679_100500570
271 Ga0070684_100412022
272 Ga0068853_100276084
273 Ga0068853_100431778
274 Ga0070665_100078518
275 Ga0070665_100230779
276 Ga0068855_100240308
277 Ga0070664_100313001
278 Ga0068857_100001045
279 Ga0068857_100088026
280 Ga0068857_100236518
281 Ga0068856_100329276
282 Ga0068859_100043452
283 Ga0068864_100053939
284 Ga0068864_100124436
285 Ga0068864_100551363
286 Ga0068863_100053505
287 Ga0068860_100007872
288 Ga0068860_100260208
289 Ga0081539_10000190
290 Ga0081539_10002496
291 Ga0070717_10053793
292 Ga0097621_100002738
293 Ga0097621_100311623
294 Ga0097621_100645534
295 Ga0068871_100084049
296 Ga0075428_100347914
297 Ga0075430_100021918
298 Ga0075430_100174061
299 Ga0075431_100008497
300 Ga0075431_100297582
301 Ga0075431_100434590
302 Ga0075431_100457859
303 Ga0075433_10021556
304 Ga0068865_100028831
305 Ga0097620_100043452
306 Ga0105240_10001230
307 Ga0105240_10005541
308 Ga0105240_10149144
309 Ga0105240_10219333
310 Ga0105240_10278627
311 Ga0111539_10056091
312 Ga0105245_10025163
313 Ga0105245_10391082
314 Ga0105247_10067244
315 Ga0114129_10034807
316 Ga0114129_10111321
317 Ga0114129_10812432
318 Ga0105243_10224754
319 Ga0105241_10035007
320 Ga0105241_10066199
321 Ga0105242_10001360
322 Ga0105242_10104801
323 Ga0105242_10346793
324 Ga0105248_10015001
325 Ga0105248_10027711
326 Ga0105248_10635660
327 Ga0105237_10018165
328 Ga0105237_10059146
329 Ga0105237_10810269
330 Ga0105238_10104161
331 Ga0105238_10390936
332 Ga0105239_10033429
333 Ga0105239_10101701
334 Ga0105246_10024709
335 Ga0105246_10115854
336 Ga0157369_10384899
337 Ga0157369_10448062
338 Ga0157374_10006789
339 Ga0157374_10099390
340 Ga0157374_10121839
341 Ga0157374_10427319
342 Ga0157378_10085761
343 Ga0163162_10002784
344 Ga0163162_10089222
345 Ga0157372_10263460
346 Ga0157375_10310376
347 Ga0163163_10027803
348 Ga0163163_10039936
349 Ga0163163_10126874
350 Ga0157380_10271564
351 Ga0157376_10096376
352 Ga0157376_10116246
353 Ga0157376_10658494
354 Ga0213876_10046341
355 Ga0207680_10019866
356 Ga0207707_10030051
357 Ga0207707_10405665
358 Ga0207695_10001403
359 Ga0207695_10035974
360 Ga0207660_10246949
361 Ga0207657_10494556
362 Ga0207694_10020003
363 Ga0207694_10161413
364 Ga0207690_10207156
365 Ga0207706_10255377
366 Ga0207686_10128613
367 Ga0207686_10218564
368 Ga0207704_10029933
369 Ga0207691_10045603
370 Ga0207711_10115126
371 Ga0207711_10768156
372 Ga0207661_10011766
373 Ga0207661_10167550
374 Ga0207679_10268992
375 Ga0207667_10087943
376 Ga0207651_10351572
377 Ga0207712_10149154
378 Ga0207658_10205477
379 Ga0207703_10086766
380 Ga0207703_10270803
381 Ga0207639_10125296
382 Ga0207639_10241171
383 Ga0207702_10406253
384 Ga0207641_10004685
385 Ga0207648_10068612
386 Ga0207676_10124899
387 Ga0207674_10003344
388 Ga0207674_10009778
389 Ga0207683_10320818
390 Ga0207683_10527038
391 Ga0207428_10085018
392 Ga0268266_10088791
393 Ga0268266_10276548
394 Ga0268264_10045170
395 Ga0268264_10217801
396 Ga0265339_10093319
397 Ga0265314_10003198
398 Ga0265314_10077160
399 Ga0265342_10022638
400 Ga0307409_100382865
401 Ga0307411_10170699
402 Ga0307411_10284962
403 Ga0373954_0052741
404 Ga0373937_0145047
405 Ga0373925_0303406
406 Ga0436365_0876895
407 Ga0451576_0271620
408 Ga0495603_0133834
409 Ga0495651_0093998
410 Ga0495651_0117116
411 Ga0495580_0008737
412 Ga0495662_0029875
413 Ga0495664_0002347
414 Ga0495594_0024459
415 Ga0495608_0109832
416 Ga0495628_0016032
417 Ga0495628_0161945
418 Ga0495643_0001528
419 Ga0495652_0013606
420 Ga0495652_0223585
421 Ga0495665_0042973
422 Ga0495665_0045220
423 Ga0495587_0006244
424 Ga0495645_0002042
425 Ga0495645_0004778
426 Ga0495667_0037069
427 Ga0495667_0055518
428 Ga0495634_0020215
429 Ga0495635_0100444
430 Ga0495588_0126130
431 Ga0495657_0084193
432 Ga0495599_0018516
433 Ga0495599_0174732
434 Ga0495623_0055505
435 Ga0495613_0072301
436 Ga0495613_0082398
437 Ga0495600_0070781
438 Ga0495600_0155316
439 Ga0495581_0146159
440 Ga0495581_0255551
441 Ga0495604_0031669
442 Ga0495674_0014290
443 Ga0495674_0035106
444 Ga0495680_0404716
445 Ga0495675_0005537
446 Ga0495675_0101293
447 Ga0495684_0031911
448 Ga0495602_0051186
449 Ga0496110_0015172
450 Ga0501031_0252983
451 Ga0501032_0000238
452 Ga0501032_0091458
453 Ga0501033_0026298
454 Ga0501034_0032208
455 Ga0501034_0135702
456 Ga0501036_0070983
457 Ga0501036_0145979
458 Ga0501037_0013829
459 Ga0501038_0026628
460 Ga0501039_0076502
461 Ga0501040_0106190
462 Ga0501041_0224434
463 Ga0501042_0272552
464 Ga0501043_0002272
465 Ga0501046_0004812
466 Ga0501046_0012933
467 Ga0501047_0003539
468 Ga0501047_0007297
469 Ga0501067_0052267
470 Ga0501068_0187132
471 Ga0501069_0195459
472 Ga0501070_0038377
473 Ga0501071_0028368
474 Ga0501072_0011663
475 Ga0501072_0012699
476 Ga0501073_0007403
477 Ga0501073_0020453
478 Ga0501073_0070648
479 Ga0501073_0076161
480 Ga0501074_0272531
481 Ga0501075_0011787
482 Ga0501076_0251280
483 Ga0501080_0001278
484 Ga0501080_0024470
485 Ga0501080_0327364
486 Ga0501083_0003976
487 Ga0501035_0002571
488 Ga0501044_0014677
489 Ga0501044_0019532
490 Ga0501044_0024135
491 Ga0501045_0084120
492 nmdc:mga05p37_122804_c1
493 nmdc:mga0qj67_16744_c1
494 nmdc:mga0qj67_194975_c1
495 nmdc:mga06r32_154676_c1
496 nmdc:mga06r32_764880_c1
497 nmdc:mga08y16_9471_c1
498 nmdc:mga0a205_370372_c1
499 Ga0501084_0004492
500 Ga0501084_0222763
501 Ga0501084_0369481
502 Ga0501084_0419524
503 Ga0590071_002799
504 Ga0590077_016653
505 Ga0501082_0008422
506 Ga0501082_0074538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01014

Uricase

Uricase

145

304

0.91

PF01014

Uricase

Uricase

47

138

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cuc-assembly1.cif.gz_A-2 crystal structure of urate oxidase from bacillus sp. tb-90 in the absence from chloride anion at 1.44 a resolution 0.8884 11 280
4r99-assembly1.cif.gz_C crystal structure of a uricase from bacillus fastidious 0.8794 7 279
7cmq-assembly1.cif.gz_B crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 88% rh. 0.8776 11 280
7cmn-assembly1.cif.gz_A-2 crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 88% rh. 0.877 11 280
7cmq-assembly1.cif.gz_A-2 crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 88% rh. 0.8744 11 280
ID Description Score Start End Superfamily
af_Q54LT2_1_287_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8754 11 280 3.10.270.10
af_P16163_26_350_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8617 7 280 3.10.270.10
4d12A00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8617 8 280 3.10.270.10
af_Q5ACV3_1_301_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8588 11 280 3.10.270.10
4r99B00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8575 8 279 3.10.270.10
ID Description Score Start End GO Terms
AF-A0A3N5PD00-F1-model_v4 Uricase (EC 1.7.3.3) (Urate oxidase) 0.9659 1 279 GO:0004846
GO:0005777
GO:0006145
GO:0019628
AF-A0A3N5PD00-F1-model_v4 Uricase (EC 1.7.3.3) (Urate oxidase) 0.9592 1 279 GO:0004846
GO:0005777
GO:0006145
GO:0019628
AF-A0A535H5N4-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) 0.9588 11 149 GO:0004846
GO:0006144
GO:0019628
AF-A0A2V8GYF6-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) 0.9566 163 280 GO:0006144
GO:0016491
AF-A0A1Q7R0Q9-F1-model_v4 Uricase (EC 1.7.3.3) (Urate oxidase) 0.9514 1 280 GO:0004846
GO:0005777
GO:0006145
GO:0019628

Map