F363211

General Info

Members Datasets Scaffolds Average Seq Length
252 170 504 159

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11612048|Ga0105242_116120481
Length 182
Sequence MRDDFARLERRPRRHHRTQAAEADVSALPPGAQKVQDAAAALGLEIVVREMTAPTRTAEEAAAACGVTVGQIVKSLMFSGADSGRPYLLLVSGSNRVNEKGVAAHLGERLKRPDADAVRALTGYAIGGIPPFGHAAPLATYMDRDLLQYDVIWAAAGTPKAVFRTEPAKLRDATGAATIDVT

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
106 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.49
Nodule 0
Rhizoplane 3.57
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11612048 3300009176 Bacteria 683
2 Ga0065704_10525180 3300005289 Bacteria 651
3 Ga0070683_100240420 3300005329 Bacteria 1722
4 Ga0070683_101523578 3300005329 Bacteria 643
5 Ga0070690_100278239 3300005330 Bacteria 1193
6 Ga0070670_100231353 3300005331 Bacteria 1609
7 Ga0070677_10023519 3300005333 Bacteria 2282
8 Ga0070677_10670990 3300005333 Bacteria 581
9 Ga0068869_100038305 3300005334 Bacteria 3416
10 Ga0070689_100217674 3300005340 Bacteria 1565
11 Ga0070687_100396204 3300005343 Bacteria 904
12 Ga0070675_100265035 3300005354 Bacteria 1506
13 Ga0070675_100557161 3300005354 Unclassified 1037
14 Ga0070671_100080657 3300005355 Bacteria 2721
15 Ga0070674_100002625 3300005356 Bacteria 9941
16 Ga0070673_100110045 3300005364 Bacteria 2283
17 Ga0070659_100307031 3300005366 Bacteria 1324
18 Ga0070667_100893935 3300005367 Bacteria 827
19 Ga0070694_100926870 3300005444 Bacteria 720
20 Ga0070678_100002368 3300005456 Bacteria 10302
21 Ga0070662_100091246 3300005457 Bacteria 2288
22 Ga0070685_10029217 3300005466 Bacteria 3061
23 Ga0070685_10175714 3300005466 Bacteria 1375
24 Ga0070679_100611470 3300005530 Bacteria 1033
25 Ga0070684_100124170 3300005535 Bacteria 2324
26 Ga0068853_100522028 3300005539 Bacteria 1123
27 Ga0070693_100600658 3300005547 Bacteria 794
28 Ga0070665_100704792 3300005548 Bacteria 1023
29 Ga0070664_100186983 3300005564 Bacteria 1844
30 Ga0068857_100187396 3300005577 Bacteria 1884
31 Ga0068854_100268001 3300005578 Bacteria 1370
32 Ga0068852_100922363 3300005616 Bacteria 891
33 Ga0068859_100114108 3300005617 Bacteria 2765
34 Ga0068859_101033607 3300005617 Bacteria 903
35 Ga0068864_100149360 3300005618 Bacteria 2115
36 Ga0068866_10070302 3300005718 Bacteria 1847
37 Ga0068866_10662655 3300005718 Bacteria 712
38 Ga0068861_100106652 3300005719 Bacteria 2238
39 Ga0068861_101405164 3300005719 Bacteria 682
40 Ga0068851_10545349 3300005834 Unclassified 700
41 Ga0068863_100515225 3300005841 Unclassified 1179
42 Ga0068858_101137357 3300005842 Bacteria 767
43 Ga0068862_100328008 3300005844 Unclassified 1414
44 Ga0075365_10085839 3300006038 Bacteria 2138
45 Ga0075365_10158195 3300006038 Unclassified 1578
46 Ga0075365_10205934 3300006038 Bacteria 1379
47 Ga0075368_10013265 3300006042 Bacteria 3024
48 Ga0075368_10050023 3300006042 Bacteria 1659
49 Ga0075363_100009709 3300006048 Bacteria 4531
50 Ga0075363_100017054 3300006048 Bacteria 3595
51 Ga0075363_100207090 3300006048 Bacteria 1122
52 Ga0075364_10002863 3300006051 Bacteria 9722
53 Ga0075364_10054985 3300006051 Bacteria 2604
54 Ga0075362_10005654 3300006177 Bacteria 4595
55 Ga0075367_10006593 3300006178 Bacteria 5880
56 Ga0075367_10009380 3300006178 Bacteria 5114
57 Ga0075367_10129758 3300006178 Bacteria 1558
58 Ga0075367_10307413 3300006178 Bacteria 998
59 Ga0075366_10014412 3300006195 Bacteria 4515
60 Ga0068871_100876841 3300006358 Unclassified 831
61 Ga0068871_101185103 3300006358 Bacteria 716
62 Ga0075428_100005467 3300006844 Bacteria 14125
63 Ga0075428_100023751 3300006844 Bacteria 6785
64 Ga0075428_100942872 3300006844 Bacteria 915
65 Ga0075430_100167805 3300006846 Bacteria 1826
66 Ga0075431_100000105 3300006847 Bacteria 53256
67 Ga0075431_100038991 3300006847 Bacteria 4894
68 Ga0075434_100002763 3300006871 Bacteria 15524
69 Ga0075429_100067484 3300006880 Bacteria 3112
70 Ga0075429_100488663 3300006880 Bacteria 1079
71 Ga0097620_100114108 3300006931 Bacteria 2765
72 Ga0097620_101033366 3300006931 Bacteria 903
73 Ga0075435_100180108 3300007076 Bacteria 1786
74 Ga0111539_10001164 3300009094 Bacteria 34787
75 Ga0111539_10023382 3300009094 Bacteria 7592
76 Ga0111539_10143354 3300009094 Bacteria 2796
77 Ga0111539_10162872 3300009094 Bacteria 2609
78 Ga0111539_10869531 3300009094 Bacteria 1049
79 Ga0105245_10178396 3300009098 Unclassified 2028
80 Ga0105245_10526754 3300009098 Bacteria 1201
81 Ga0105245_11700208 3300009098 Bacteria 683
82 Ga0105247_10179577 3300009101 Bacteria 1412
83 Ga0114129_10003927 3300009147 Bacteria 20989
84 Ga0114129_10072765 3300009147 Bacteria 4791
85 Ga0105243_10727753 3300009148 Bacteria 970
86 Ga0105248_11481225 3300009177 Bacteria 768
87 Ga0105237_10786604 3300009545 Bacteria 958
88 Ga0105238_10036763 3300009551 Bacteria 4979
89 Ga0105249_10168716 3300009553 Bacteria 2121
90 Ga0157378_10241453 3300013297 Bacteria 1726
91 Ga0157378_10543377 3300013297 Bacteria 1166
92 Ga0157375_10117538 3300013308 Bacteria 2764
93 Ga0163163_10372378 3300014325 Bacteria 1485
94 Ga0163163_10775127 3300014325 Bacteria 1022
95 Ga0157380_10593341 3300014326 Bacteria 1094
96 Ga0157380_11366777 3300014326 Bacteria 758
97 Ga0157377_10762428 3300014745 Bacteria 709
98 Ga0157376_10078277 3300014969 Bacteria 2831
99 Ga0163161_10477013 3300017792 Bacteria 1012
100 Ga0213874_10008308 3300021377 Bacteria 2528
101 Ga0213874_10009855 3300021377 Bacteria 2376
102 Ga0213876_10003219 3300021384 Bacteria 9373
103 Ga0213875_10001829 3300021388 Bacteria 13228
104 Ga0207682_10001082 3300025893 Bacteria 12568
105 Ga0207682_10415537 3300025893 Bacteria 636
106 Ga0207693_10417263 3300025915 Bacteria 1049
107 Ga0207662_10272932 3300025918 Bacteria 1117
108 Ga0207681_10101823 3300025923 Bacteria 2073
109 Ga0207650_10424390 3300025925 Bacteria 1104
110 Ga0207659_10051428 3300025926 Bacteria 2930
111 Ga0207659_11258661 3300025926 Unclassified 636
112 Ga0207706_10139878 3300025933 Bacteria 2129
113 Ga0207706_11255809 3300025933 Unclassified 614
114 Ga0207689_10151687 3300025942 Bacteria 1910
115 Ga0207661_10507744 3300025944 Bacteria 1102
116 Ga0207679_10192079 3300025945 Bacteria 1698
117 Ga0207651_10220930 3300025960 Bacteria 1531
118 Ga0207640_10223250 3300025981 Bacteria 1444
119 Ga0207641_10395918 3300026088 Bacteria 1325
120 Ga0207676_10079365 3300026095 Bacteria 2661
121 Ga0207676_10840562 3300026095 Bacteria 897
122 Ga0207676_12618077 3300026095 Bacteria 501
123 Ga0207675_100348674 3300026118 Bacteria 1451
124 Ga0207675_100452290 3300026118 Bacteria 1273
125 Ga0207683_10005217 3300026121 Bacteria 11154
126 Ga0207698_10516731 3300026142 Bacteria 1165
127 Ga0209813_10019989 3300027866 Bacteria 1868
128 Ga0207428_10019453 3300027907 Bacteria 5788
129 Ga0268266_10463372 3300028379 Bacteria 1206
130 Ga0268266_11069663 3300028379 Bacteria 781
131 Ga0268264_10429831 3300028381 Bacteria 1275
132 Ga0268264_10515064 3300028381 Bacteria 1169
133 Ga0265320_10008357 3300031240 Bacteria 6337
134 Ga0265325_10057584 3300031241 Bacteria 1982
135 Ga0265329_10008882 3300031242 Bacteria 3785
136 Ga0265329_10138420 3300031242 Bacteria 786
137 Ga0265340_10019215 3300031247 Bacteria 3519
138 Ga0265340_10021281 3300031247 Bacteria 3326
139 Ga0265340_10023602 3300031247 Bacteria 3134
140 Ga0265339_10044108 3300031249 Bacteria 2461
141 Ga0265331_10247145 3300031250 Bacteria 800
142 Ga0265331_10330677 3300031250 Bacteria 682
143 Ga0265316_10042798 3300031344 Bacteria 3616
144 Ga0265313_10021776 3300031595 Bacteria 3497
145 Ga0265313_10078069 3300031595 Bacteria 1510
146 Ga0265313_10105376 3300031595 Bacteria 1246
147 Ga0265314_10007445 3300031711 Bacteria 9494
148 Ga0265314_10146678 3300031711 Bacteria 1452
149 Ga0265314_10203370 3300031711 Bacteria 1169
150 Ga0265342_10022199 3300031712 Bacteria 4039
151 Ga0265342_10027294 3300031712 Bacteria 3570
152 Ga0316576_10026276 3300031727 Bacteria 4085
153 Ga0316578_10145738 3300031728 Bacteria 1426
154 Ga0307415_101091392 3300032126 Bacteria 747
155 Ga0373948_0061942 3300034817 Bacteria 823
156 Ga0373950_0026525 3300034818 Bacteria 1052
157 Ga0373938_0027601 3300034957 Bacteria 1195
158 Ga0373940_0002356 3300035088 Bacteria 3658
159 Ga0373940_0230470 3300035088 Bacteria 618
160 Ga0373932_0002979 3300035112 Bacteria 4161
161 Ga0373939_0004365 3300035114 Bacteria 3340
162 Ga0373941_0054655 3300035115 Bacteria 1280
163 Ga0373960_0036101 3300035121 Bacteria 1406
164 Ga0316574_0084665 3300035398 Bacteria 2017
165 Ga0316574_0116508 3300035398 Bacteria 1714
166 Ga0373931_0006152 3300035691 Bacteria 5595
167 Ga0373931_0691898 3300035691 Bacteria 673
168 Ga0316584_0089026 3300036712 Bacteria 2311
169 Ga0373925_1365343 3300037068 Bacteria 581
170 Ga0436364_0525340 3300037853 Bacteria 1486
171 Ga0436364_0533206 3300037853 Bacteria 1968
172 Ga0436364_0609207 3300037853 Bacteria 9376
173 Ga0436365_0023379 3300039437 Bacteria 19275
174 Ga0436365_1316892 3300039437 Bacteria 27719
175 Ga0436363_0201704 3300039450 Bacteria 18961
176 Ga0436363_0946096 3300039450 Bacteria 18504
177 Ga0436363_1223450 3300039450 Unclassified 1679
178 Ga0436363_1457552 3300039450 Unclassified 1170
179 Ga0436362_0384788 3300039453 Bacteria 1481
180 Ga0436362_0844720 3300039453 Bacteria 6820
181 Ga0439439_0068201 3300041406 Bacteria 950
182 Ga0439453_0012043 3300041408 Bacteria 1451
183 Ga0439443_054320 3300042003 Bacteria 706
184 Ga0439446_0025140 3300042156 Bacteria 1702
185 Ga0439435_0000310 3300042436 Bacteria 7300
186 Ga0439440_0004222 3300042993 Bacteria 2817
187 Ga0466968_0401461 3300044735 Unclassified 672
188 Ga0451576_0088599 3300045051 Bacteria 3219
189 Ga0451576_0967168 3300045051 Bacteria 893
190 Ga0495603_0422756 3300046455 Bacteria 763
191 Ga0495638_0328510 3300046460 Bacteria 815
192 Ga0495605_0027110 3300046474 Bacteria 2972
193 Ga0495616_0133649 3300046513 Bacteria 1135
194 Ga0495663_0049926 3300046525 Bacteria 1293
195 Ga0495598_0005940 3300046537 Bacteria 2731
196 Ga0495621_0002634 3300046539 Bacteria 4853
197 Ga0495656_0069916 3300046615 Bacteria 1556
198 Ga0496100_0632937 3300048903 Bacteria 832
199 Ga0496104_0001125 3300048907 Bacteria 22885
200 Ga0496105_0013291 3300048908 Bacteria 6533
201 Ga0496108_0001847 3300048911 Bacteria 16933
202 Ga0496109_0001944 3300048912 Bacteria 17168
203 Ga0496110_0007214 3300048913 Bacteria 8852
204 Ga0496111_0001745 3300048914 Bacteria 12736
205 Ga0496112_0004667 3300048915 Bacteria 11654
206 Ga0496113_0001947 3300048916 Bacteria 11828
207 Ga0501032_0158018 3300049569 Bacteria 1489
208 Ga0501034_0093840 3300049571 Bacteria 2998
209 Ga0501034_0449136 3300049571 Bacteria 1207
210 Ga0501034_0735016 3300049571 Unclassified 883
211 Ga0501034_0771682 3300049571 Unclassified 856
212 Ga0501067_0054584 3300049583 Bacteria 2214
213 Ga0501070_0224265 3300049586 Bacteria 1541
214 Ga0501073_0073031 3300049589 Bacteria 2389
215 Ga0501073_0119279 3300049589 Bacteria 1828
216 Ga0501073_0159957 3300049589 Bacteria 1561
217 Ga0501083_0021682 3300049744 Bacteria 4462
218 nmdc:mga03n38_160904_c1 3300050490 Bacteria 1137
219 nmdc:mga03n38_3626_c1 3300050490 Bacteria 4988
220 nmdc:mga03n38_49115_c1 3300050490 Bacteria 1875
221 nmdc:mga00v17_47810_c1 3300050491 Bacteria 2592
222 nmdc:mga0yw44_251142_c1 3300050492 Bacteria 1177
223 nmdc:mga0yw44_29067_c1 3300050492 Bacteria 3187
224 nmdc:mga0yw44_375381_c1 3300050492 Bacteria 960
225 nmdc:mga0k408_9626_c1 3300050493 Bacteria 5215
226 nmdc:mga06z11_124022_c1 3300050494 Bacteria 1444
227 nmdc:mga06z11_296171_c1 3300050494 Bacteria 961
228 nmdc:mga06z11_4660_c1 3300050494 Bacteria 5411
229 nmdc:mga06z11_692305_c1 3300050494 Bacteria 621
230 nmdc:mga04h51_304849_c1 3300050495 Bacteria 650
231 nmdc:mga04h51_31144_c1 3300050495 Bacteria 1684
232 nmdc:mga04h51_40733_c1 3300050495 Bacteria 1515
233 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
234 nmdc:mga09592_2259_c2 3300050508 Bacteria 13811
235 nmdc:mga09592_815786_c1 3300050508 Bacteria 788
236 nmdc:mga0qj67_37517_c1 3300050509 Bacteria 3796
237 nmdc:mga06r32_290083_c1 3300050510 Bacteria 1623
238 nmdc:mga06r32_671_c1 3300050510 Bacteria 29849
239 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
240 nmdc:mga08y16_1771672_c1 3300050511 Bacteria 571
241 nmdc:mga0n895_2533_c1 3300050512 Bacteria 14307
242 nmdc:mga0rr50_145631_c1 3300050513 Bacteria 1910
243 nmdc:mga0a205_3630_c1 3300050515 Bacteria 13815
244 nmdc:mga0sz30_35401_c1 3300050516 Bacteria 2083
245 Ga0500620_145754 3300053155 Unclassified 826
246 Ga0501084_0516615 3300054114 Bacteria 1010
247 Ga0501084_0944547 3300054114 Unclassified 725
248 Ga0501082_0008053 3300060353 Bacteria 9092
249 Ga0501082_0185374 3300060353 Bacteria 1811
250 Ga0501082_0230111 3300060353 Bacteria 1613
251 Ga0501082_0239207 3300060353 Unclassified 1580
252 8045868950 8045864390 Bacteria 5043873
253 Ga0105242_11612048
254 Ga0065704_10525180
255 Ga0070683_100240420
256 Ga0070683_101523578
257 Ga0070690_100278239
258 Ga0070670_100231353
259 Ga0070677_10023519
260 Ga0070677_10670990
261 Ga0068869_100038305
262 Ga0070689_100217674
263 Ga0070687_100396204
264 Ga0070675_100265035
265 Ga0070675_100557161
266 Ga0070671_100080657
267 Ga0070674_100002625
268 Ga0070673_100110045
269 Ga0070659_100307031
270 Ga0070667_100893935
271 Ga0070694_100926870
272 Ga0070678_100002368
273 Ga0070662_100091246
274 Ga0070685_10029217
275 Ga0070685_10175714
276 Ga0070679_100611470
277 Ga0070684_100124170
278 Ga0068853_100522028
279 Ga0070693_100600658
280 Ga0070665_100704792
281 Ga0070664_100186983
282 Ga0068857_100187396
283 Ga0068854_100268001
284 Ga0068852_100922363
285 Ga0068859_100114108
286 Ga0068859_101033607
287 Ga0068864_100149360
288 Ga0068866_10070302
289 Ga0068866_10662655
290 Ga0068861_100106652
291 Ga0068861_101405164
292 Ga0068851_10545349
293 Ga0068863_100515225
294 Ga0068858_101137357
295 Ga0068862_100328008
296 Ga0075365_10085839
297 Ga0075365_10158195
298 Ga0075365_10205934
299 Ga0075368_10013265
300 Ga0075368_10050023
301 Ga0075363_100009709
302 Ga0075363_100017054
303 Ga0075363_100207090
304 Ga0075364_10002863
305 Ga0075364_10054985
306 Ga0075362_10005654
307 Ga0075367_10006593
308 Ga0075367_10009380
309 Ga0075367_10129758
310 Ga0075367_10307413
311 Ga0075366_10014412
312 Ga0068871_100876841
313 Ga0068871_101185103
314 Ga0075428_100005467
315 Ga0075428_100023751
316 Ga0075428_100942872
317 Ga0075430_100167805
318 Ga0075431_100000105
319 Ga0075431_100038991
320 Ga0075434_100002763
321 Ga0075429_100067484
322 Ga0075429_100488663
323 Ga0097620_100114108
324 Ga0097620_101033366
325 Ga0075435_100180108
326 Ga0111539_10001164
327 Ga0111539_10023382
328 Ga0111539_10143354
329 Ga0111539_10162872
330 Ga0111539_10869531
331 Ga0105245_10178396
332 Ga0105245_10526754
333 Ga0105245_11700208
334 Ga0105247_10179577
335 Ga0114129_10003927
336 Ga0114129_10072765
337 Ga0105243_10727753
338 Ga0105248_11481225
339 Ga0105237_10786604
340 Ga0105238_10036763
341 Ga0105249_10168716
342 Ga0157378_10241453
343 Ga0157378_10543377
344 Ga0157375_10117538
345 Ga0163163_10372378
346 Ga0163163_10775127
347 Ga0157380_10593341
348 Ga0157380_11366777
349 Ga0157377_10762428
350 Ga0157376_10078277
351 Ga0163161_10477013
352 Ga0213874_10008308
353 Ga0213874_10009855
354 Ga0213876_10003219
355 Ga0213875_10001829
356 Ga0207682_10001082
357 Ga0207682_10415537
358 Ga0207693_10417263
359 Ga0207662_10272932
360 Ga0207681_10101823
361 Ga0207650_10424390
362 Ga0207659_10051428
363 Ga0207659_11258661
364 Ga0207706_10139878
365 Ga0207706_11255809
366 Ga0207689_10151687
367 Ga0207661_10507744
368 Ga0207679_10192079
369 Ga0207651_10220930
370 Ga0207640_10223250
371 Ga0207641_10395918
372 Ga0207676_10079365
373 Ga0207676_10840562
374 Ga0207676_12618077
375 Ga0207675_100348674
376 Ga0207675_100452290
377 Ga0207683_10005217
378 Ga0207698_10516731
379 Ga0209813_10019989
380 Ga0207428_10019453
381 Ga0268266_10463372
382 Ga0268266_11069663
383 Ga0268264_10429831
384 Ga0268264_10515064
385 Ga0265320_10008357
386 Ga0265325_10057584
387 Ga0265329_10008882
388 Ga0265329_10138420
389 Ga0265340_10019215
390 Ga0265340_10021281
391 Ga0265340_10023602
392 Ga0265339_10044108
393 Ga0265331_10247145
394 Ga0265331_10330677
395 Ga0265316_10042798
396 Ga0265313_10021776
397 Ga0265313_10078069
398 Ga0265313_10105376
399 Ga0265314_10007445
400 Ga0265314_10146678
401 Ga0265314_10203370
402 Ga0265342_10022199
403 Ga0265342_10027294
404 Ga0316576_10026276
405 Ga0316578_10145738
406 Ga0307415_101091392
407 Ga0373948_0061942
408 Ga0373950_0026525
409 Ga0373938_0027601
410 Ga0373940_0002356
411 Ga0373940_0230470
412 Ga0373932_0002979
413 Ga0373939_0004365
414 Ga0373941_0054655
415 Ga0373960_0036101
416 Ga0316574_0084665
417 Ga0316574_0116508
418 Ga0373931_0006152
419 Ga0373931_0691898
420 Ga0316584_0089026
421 Ga0373925_1365343
422 Ga0436364_0525340
423 Ga0436364_0533206
424 Ga0436364_0609207
425 Ga0436365_0023379
426 Ga0436365_1316892
427 Ga0436363_0201704
428 Ga0436363_0946096
429 Ga0436363_1223450
430 Ga0436363_1457552
431 Ga0436362_0384788
432 Ga0436362_0844720
433 Ga0439439_0068201
434 Ga0439453_0012043
435 Ga0439443_054320
436 Ga0439446_0025140
437 Ga0439435_0000310
438 Ga0439440_0004222
439 Ga0466968_0401461
440 Ga0451576_0088599
441 Ga0451576_0967168
442 Ga0495603_0422756
443 Ga0495638_0328510
444 Ga0495605_0027110
445 Ga0495616_0133649
446 Ga0495663_0049926
447 Ga0495598_0005940
448 Ga0495621_0002634
449 Ga0495656_0069916
450 Ga0496100_0632937
451 Ga0496104_0001125
452 Ga0496105_0013291
453 Ga0496108_0001847
454 Ga0496109_0001944
455 Ga0496110_0007214
456 Ga0496111_0001745
457 Ga0496112_0004667
458 Ga0496113_0001947
459 Ga0501032_0158018
460 Ga0501034_0093840
461 Ga0501034_0449136
462 Ga0501034_0735016
463 Ga0501034_0771682
464 Ga0501067_0054584
465 Ga0501070_0224265
466 Ga0501073_0073031
467 Ga0501073_0119279
468 Ga0501073_0159957
469 Ga0501083_0021682
470 nmdc:mga03n38_160904_c1
471 nmdc:mga03n38_3626_c1
472 nmdc:mga03n38_49115_c1
473 nmdc:mga00v17_47810_c1
474 nmdc:mga0yw44_251142_c1
475 nmdc:mga0yw44_29067_c1
476 nmdc:mga0yw44_375381_c1
477 nmdc:mga0k408_9626_c1
478 nmdc:mga06z11_124022_c1
479 nmdc:mga06z11_296171_c1
480 nmdc:mga06z11_4660_c1
481 nmdc:mga06z11_692305_c1
482 nmdc:mga04h51_304849_c1
483 nmdc:mga04h51_31144_c1
484 nmdc:mga04h51_40733_c1
485 nmdc:mga05p37_140_c1
486 nmdc:mga09592_2259_c2
487 nmdc:mga09592_815786_c1
488 nmdc:mga0qj67_37517_c1
489 nmdc:mga06r32_290083_c1
490 nmdc:mga06r32_671_c1
491 nmdc:mga08y16_104_c1
492 nmdc:mga08y16_1771672_c1
493 nmdc:mga0n895_2533_c1
494 nmdc:mga0rr50_145631_c1
495 nmdc:mga0a205_3630_c1
496 nmdc:mga0sz30_35401_c1
497 Ga0500620_145754
498 Ga0501084_0516615
499 Ga0501084_0944547
500 Ga0501082_0008053
501 Ga0501082_0185374
502 Ga0501082_0230111
503 Ga0501082_0239207
504 8045868950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

52

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9614 4 158
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.9582 3 158
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9525 4 158
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9468 4 158
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.9465 10 157
ID Description Score Start End Superfamily
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9405 10 157 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9391 10 158 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.929 3 158 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9164 10 157 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9148 10 157 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A2V7YFH2-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9927 63 158 GO:0002161
AF-A0A847JHI2-F1-model_v4 YbaK/EbsC family protein 0.9898 1 158 GO:0002161
AF-A0A7V5N300-F1-model_v4 YbaK/EbsC family protein 0.9891 24 158 GO:0002161
AF-A0A2V3U036-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.9888 2 158 GO:0002161
AF-A0A849IDZ5-F1-model_v4 YbaK/EbsC family protein 0.9883 1 157 GO:0002161

Map