F363158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 164 | 504 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100018772|Ga0075430_1000187723 |
| Length | 117 |
| Sequence | MHSEKLLDHFQNPRNAGELSDATVRVDVENPACGDQLRLTVRVEDGLVAAVRFKVRGCTASIAAGSALTEWLTGRAVKEAALLRSDDIEAALGGLIPESRHAAILCMDAARELARRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 80 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 81 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 82 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 83 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 84 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 85 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 91 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 92 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 93 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 94 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 130 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 131 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 98.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075430_100018772 | 3300006846 | Bacteria | 5885 |
| 2 | Ga0070658_10853127 | 3300005327 | Bacteria | 792 |
| 3 | Ga0070658_11282530 | 3300005327 | Unclassified | 636 |
| 4 | Ga0070683_100005933 | 3300005329 | Bacteria | 10224 |
| 5 | Ga0068869_100182153 | 3300005334 | Bacteria | 1647 |
| 6 | Ga0070680_100004266 | 3300005336 | Bacteria | 10734 |
| 7 | Ga0070660_100005565 | 3300005339 | Bacteria | 8727 |
| 8 | Ga0070691_10000451 | 3300005341 | Bacteria | 15241 |
| 9 | Ga0070661_100315395 | 3300005344 | Unclassified | 1220 |
| 10 | Ga0070675_100458402 | 3300005354 | Bacteria | 1144 |
| 11 | Ga0070674_100254008 | 3300005356 | Unclassified | 1382 |
| 12 | Ga0070659_100301981 | 3300005366 | Unclassified | 1335 |
| 13 | Ga0070714_100073780 | 3300005435 | Unclassified | 2957 |
| 14 | Ga0070714_100211176 | 3300005435 | Bacteria | 1779 |
| 15 | Ga0070713_100058139 | 3300005436 | Bacteria | 3224 |
| 16 | Ga0070713_101223664 | 3300005436 | Unclassified | 727 |
| 17 | Ga0070681_10000603 | 3300005458 | Bacteria | 29582 |
| 18 | Ga0070679_100019519 | 3300005530 | Bacteria | 6593 |
| 19 | Ga0070679_101191111 | 3300005530 | Unclassified | 707 |
| 20 | Ga0070684_100002959 | 3300005535 | Bacteria | 12651 |
| 21 | Ga0070684_100197419 | 3300005535 | Unclassified | 1832 |
| 22 | Ga0070697_100119153 | 3300005536 | Bacteria | 2206 |
| 23 | Ga0068853_100036205 | 3300005539 | Bacteria | 4195 |
| 24 | Ga0070695_100074728 | 3300005545 | Bacteria | 2227 |
| 25 | Ga0068855_100013232 | 3300005563 | Bacteria | 9950 |
| 26 | Ga0068855_100040826 | 3300005563 | Bacteria | 5503 |
| 27 | Ga0068855_100172366 | 3300005563 | Bacteria | 2450 |
| 28 | Ga0070664_101057254 | 3300005564 | Bacteria | 764 |
| 29 | Ga0068857_100005428 | 3300005577 | Bacteria | 10869 |
| 30 | Ga0068856_100002485 | 3300005614 | Bacteria | 18973 |
| 31 | Ga0068856_100110336 | 3300005614 | Bacteria | 2748 |
| 32 | Ga0068856_100490746 | 3300005614 | Unclassified | 1249 |
| 33 | Ga0068856_100532317 | 3300005614 | Unclassified | 1196 |
| 34 | Ga0068852_100013638 | 3300005616 | Bacteria | 6224 |
| 35 | Ga0068852_100034676 | 3300005616 | Bacteria | 4202 |
| 36 | Ga0068859_100207260 | 3300005617 | Bacteria | 2046 |
| 37 | Ga0068863_100010260 | 3300005841 | Bacteria | 9106 |
| 38 | Ga0068858_100460498 | 3300005842 | Bacteria | 1226 |
| 39 | Ga0068860_100550910 | 3300005843 | Unclassified | 1155 |
| 40 | Ga0075431_100002969 | 3300006847 | Bacteria | 16411 |
| 41 | Ga0068865_100498152 | 3300006881 | Bacteria | 1015 |
| 42 | Ga0097620_100207258 | 3300006931 | Bacteria | 2046 |
| 43 | Ga0097620_100625738 | 3300006931 | Unclassified | 1169 |
| 44 | Ga0105240_10002709 | 3300009093 | Bacteria | 28152 |
| 45 | Ga0105240_10016460 | 3300009093 | Bacteria | 10008 |
| 46 | Ga0105240_10093691 | 3300009093 | Unclassified | 3665 |
| 47 | Ga0105240_10199408 | 3300009093 | Bacteria | 2347 |
| 48 | Ga0105240_10234511 | 3300009093 | Unclassified | 2130 |
| 49 | Ga0105240_10458987 | 3300009093 | Bacteria | 1424 |
| 50 | Ga0105245_10390025 | 3300009098 | Bacteria | 1389 |
| 51 | Ga0105247_10781947 | 3300009101 | Unclassified | 726 |
| 52 | Ga0114129_10693464 | 3300009147 | Bacteria | 1309 |
| 53 | Ga0105241_10009242 | 3300009174 | Bacteria | 7249 |
| 54 | Ga0105248_10062588 | 3300009177 | Bacteria | 4178 |
| 55 | Ga0105248_10273778 | 3300009177 | Unclassified | 1901 |
| 56 | Ga0105248_11121511 | 3300009177 | Unclassified | 889 |
| 57 | Ga0105237_10006902 | 3300009545 | Bacteria | 12522 |
| 58 | Ga0105237_10037096 | 3300009545 | Bacteria | 4928 |
| 59 | Ga0105237_10056808 | 3300009545 | Bacteria | 3917 |
| 60 | Ga0105237_10136734 | 3300009545 | Unclassified | 2445 |
| 61 | Ga0105237_11221028 | 3300009545 | Bacteria | 758 |
| 62 | Ga0105238_10006155 | 3300009551 | Bacteria | 11911 |
| 63 | Ga0105238_10382658 | 3300009551 | Bacteria | 1399 |
| 64 | Ga0105238_11131485 | 3300009551 | Unclassified | 806 |
| 65 | Ga0105249_10033044 | 3300009553 | Unclassified | 4684 |
| 66 | Ga0105249_10173396 | 3300009553 | Unclassified | 2093 |
| 67 | Ga0105239_10004110 | 3300010375 | Bacteria | 17489 |
| 68 | Ga0105239_10148246 | 3300010375 | Bacteria | 2618 |
| 69 | Ga0105239_10224980 | 3300010375 | Unclassified | 2104 |
| 70 | Ga0157370_10006762 | 3300013104 | Bacteria | 12580 |
| 71 | Ga0157370_10025377 | 3300013104 | Bacteria | 5867 |
| 72 | Ga0157369_10006734 | 3300013105 | Bacteria | 13258 |
| 73 | Ga0157369_10008786 | 3300013105 | Bacteria | 11576 |
| 74 | Ga0157369_10382406 | 3300013105 | Bacteria | 1461 |
| 75 | Ga0157369_10840212 | 3300013105 | Unclassified | 943 |
| 76 | Ga0157374_11249003 | 3300013296 | Bacteria | 764 |
| 77 | Ga0157378_12599531 | 3300013297 | Bacteria | 559 |
| 78 | Ga0163162_10770186 | 3300013306 | Unclassified | 1081 |
| 79 | Ga0163162_11370641 | 3300013306 | Bacteria | 804 |
| 80 | Ga0157372_10005214 | 3300013307 | Bacteria | 13812 |
| 81 | Ga0157372_10029310 | 3300013307 | Bacteria | 6008 |
| 82 | Ga0157375_10099087 | 3300013308 | Unclassified | 2993 |
| 83 | Ga0157375_11307118 | 3300013308 | Unclassified | 853 |
| 84 | Ga0163163_10017589 | 3300014325 | Bacteria | 6671 |
| 85 | Ga0163163_11175428 | 3300014325 | Unclassified | 830 |
| 86 | Ga0157380_10704747 | 3300014326 | Bacteria | 1015 |
| 87 | Ga0157380_12577268 | 3300014326 | Unclassified | 574 |
| 88 | Ga0157376_10140826 | 3300014969 | Bacteria | 2163 |
| 89 | Ga0207705_10322617 | 3300025909 | Unclassified | 1187 |
| 90 | Ga0207705_10941691 | 3300025909 | Unclassified | 668 |
| 91 | Ga0207654_10011751 | 3300025911 | Bacteria | 4470 |
| 92 | Ga0207707_10006124 | 3300025912 | Bacteria | 10514 |
| 93 | Ga0207695_10002352 | 3300025913 | Bacteria | 28101 |
| 94 | Ga0207695_10006258 | 3300025913 | Bacteria | 15497 |
| 95 | Ga0207695_10067628 | 3300025913 | Bacteria | 3664 |
| 96 | Ga0207695_10077139 | 3300025913 | Bacteria | 3386 |
| 97 | Ga0207671_10050888 | 3300025914 | Bacteria | 3068 |
| 98 | Ga0207671_10609851 | 3300025914 | Bacteria | 870 |
| 99 | Ga0207660_10009304 | 3300025917 | Bacteria | 6360 |
| 100 | Ga0207660_10061548 | 3300025917 | Bacteria | 2702 |
| 101 | Ga0207657_10036558 | 3300025919 | Bacteria | 4394 |
| 102 | Ga0207652_10015186 | 3300025921 | Bacteria | 6248 |
| 103 | Ga0207652_10959800 | 3300025921 | Unclassified | 753 |
| 104 | Ga0207694_10005332 | 3300025924 | Bacteria | 9906 |
| 105 | Ga0207694_10433199 | 3300025924 | Unclassified | 1096 |
| 106 | Ga0207687_10016776 | 3300025927 | Bacteria | 4813 |
| 107 | Ga0207700_10075513 | 3300025928 | Bacteria | 2612 |
| 108 | Ga0207664_10057616 | 3300025929 | Unclassified | 3088 |
| 109 | Ga0207670_10265570 | 3300025936 | Bacteria | 1332 |
| 110 | Ga0207669_10063384 | 3300025937 | Unclassified | 2282 |
| 111 | Ga0207704_10532702 | 3300025938 | Bacteria | 952 |
| 112 | Ga0207711_10502439 | 3300025941 | Unclassified | 1130 |
| 113 | Ga0207661_10051324 | 3300025944 | Bacteria | 3290 |
| 114 | Ga0207661_11056013 | 3300025944 | Bacteria | 748 |
| 115 | Ga0207667_10010138 | 3300025949 | Bacteria | 11034 |
| 116 | Ga0207667_10341069 | 3300025949 | Unclassified | 1529 |
| 117 | Ga0207712_10036388 | 3300025961 | Bacteria | 3352 |
| 118 | Ga0207703_10106502 | 3300026035 | Bacteria | 2385 |
| 119 | Ga0207639_10035050 | 3300026041 | Bacteria | 3713 |
| 120 | Ga0207702_10006869 | 3300026078 | Bacteria | 9756 |
| 121 | Ga0207702_10988191 | 3300026078 | Unclassified | 835 |
| 122 | Ga0207702_11041363 | 3300026078 | Unclassified | 812 |
| 123 | Ga0207648_10169255 | 3300026089 | Bacteria | 1931 |
| 124 | Ga0207674_10004753 | 3300026116 | Bacteria | 16285 |
| 125 | Ga0207698_10069411 | 3300026142 | Bacteria | 2787 |
| 126 | Ga0207698_10141516 | 3300026142 | Bacteria | 2073 |
| 127 | Ga0268264_10290574 | 3300028381 | Unclassified | 1535 |
| 128 | Ga0265316_10111503 | 3300031344 | Bacteria | 2071 |
| 129 | Ga0265316_10465137 | 3300031344 | Unclassified | 906 |
| 130 | Ga0373926_0252304 | 3300035083 | Unclassified | 684 |
| 131 | Ga0373934_0048735 | 3300035086 | Bacteria | 1677 |
| 132 | Ga0373923_0497460 | 3300035111 | Unclassified | 594 |
| 133 | Ga0373954_0001103 | 3300035118 | Bacteria | 10795 |
| 134 | Ga0373954_0016915 | 3300035118 | Bacteria | 3272 |
| 135 | Ga0373954_0223668 | 3300035118 | Unclassified | 926 |
| 136 | Ga0373957_0139760 | 3300035120 | Bacteria | 989 |
| 137 | Ga0373955_0058011 | 3300035172 | Bacteria | 2129 |
| 138 | Ga0373955_0581963 | 3300035172 | Bacteria | 685 |
| 139 | Ga0373933_0897842 | 3300035724 | Unclassified | 583 |
| 140 | Ga0373937_0054072 | 3300036401 | Bacteria | 3683 |
| 141 | Ga0373937_1366929 | 3300036401 | Bacteria | 656 |
| 142 | Ga0373925_0191947 | 3300037068 | Bacteria | 1621 |
| 143 | Ga0395900_0937143 | 3300037418 | Unclassified | 788 |
| 144 | Ga0395898_0239713 | 3300037466 | Unclassified | 1730 |
| 145 | Ga0436364_1119461 | 3300037853 | Bacteria | 3317 |
| 146 | Ga0436365_0188996 | 3300039437 | Unclassified | 640 |
| 147 | Ga0436365_1909208 | 3300039437 | Bacteria | 877 |
| 148 | Ga0436360_0530689 | 3300039438 | Unclassified | 562 |
| 149 | Ga0451576_0814088 | 3300045051 | Unclassified | 981 |
| 150 | Ga0451576_2388370 | 3300045051 | Bacteria | 541 |
| 151 | Ga0495592_0119290 | 3300046454 | Bacteria | 1857 |
| 152 | Ga0495592_0482299 | 3300046454 | Unclassified | 772 |
| 153 | Ga0495629_0117167 | 3300046459 | Bacteria | 1856 |
| 154 | Ga0495629_1101885 | 3300046459 | Unclassified | 513 |
| 155 | Ga0495651_0006999 | 3300046462 | Bacteria | 8627 |
| 156 | Ga0495653_0132400 | 3300046463 | Unclassified | 1763 |
| 157 | Ga0495653_0806564 | 3300046463 | Bacteria | 564 |
| 158 | Ga0495580_0068789 | 3300046472 | Unclassified | 2475 |
| 159 | Ga0495582_0009650 | 3300046473 | Bacteria | 5314 |
| 160 | Ga0495639_0096473 | 3300046475 | Bacteria | 1392 |
| 161 | Ga0495662_0012987 | 3300046476 | Unclassified | 4057 |
| 162 | Ga0495608_0035876 | 3300046511 | Bacteria | 3341 |
| 163 | Ga0495618_0400116 | 3300046514 | Unclassified | 840 |
| 164 | Ga0495628_0011875 | 3300046516 | Bacteria | 7346 |
| 165 | Ga0495628_0072998 | 3300046516 | Bacteria | 2674 |
| 166 | Ga0495628_0362774 | 3300046516 | Unclassified | 1063 |
| 167 | Ga0495630_0071090 | 3300046517 | Unclassified | 2618 |
| 168 | Ga0495630_0340912 | 3300046517 | Unclassified | 1147 |
| 169 | Ga0495666_0122884 | 3300046526 | Bacteria | 1215 |
| 170 | Ga0495652_0040309 | 3300046529 | Bacteria | 4036 |
| 171 | Ga0495665_0045302 | 3300046531 | Unclassified | 2337 |
| 172 | Ga0495665_0072846 | 3300046531 | Bacteria | 1809 |
| 173 | Ga0495640_0150416 | 3300046533 | Unclassified | 1496 |
| 174 | Ga0495640_0473785 | 3300046533 | Bacteria | 763 |
| 175 | Ga0495586_0062305 | 3300046535 | Bacteria | 2030 |
| 176 | Ga0495587_0016965 | 3300046536 | Unclassified | 4528 |
| 177 | Ga0495645_0009581 | 3300046543 | Bacteria | 6775 |
| 178 | Ga0495645_0026092 | 3300046543 | Bacteria | 4240 |
| 179 | Ga0495645_0174904 | 3300046543 | Unclassified | 1475 |
| 180 | Ga0495645_0207967 | 3300046543 | Bacteria | 1323 |
| 181 | Ga0495667_0007972 | 3300046559 | Bacteria | 7183 |
| 182 | Ga0495634_0016966 | 3300046642 | Bacteria | 5201 |
| 183 | Ga0495634_0043889 | 3300046642 | Bacteria | 3029 |
| 184 | Ga0495635_0024913 | 3300046663 | Unclassified | 4169 |
| 185 | Ga0495599_0006928 | 3300046678 | Bacteria | 6853 |
| 186 | Ga0495599_0046290 | 3300046678 | Bacteria | 2728 |
| 187 | Ga0495623_0096585 | 3300046679 | Unclassified | 1805 |
| 188 | Ga0495623_0145309 | 3300046679 | Bacteria | 1407 |
| 189 | Ga0495646_0028159 | 3300046680 | Unclassified | 3520 |
| 190 | Ga0495647_0289720 | 3300046681 | Bacteria | 736 |
| 191 | Ga0495658_0054637 | 3300046683 | Bacteria | 2272 |
| 192 | Ga0495613_0070926 | 3300046689 | Bacteria | 2540 |
| 193 | Ga0495613_0245185 | 3300046689 | Bacteria | 1252 |
| 194 | Ga0495613_0625704 | 3300046689 | Unclassified | 714 |
| 195 | Ga0495624_0935437 | 3300046690 | Bacteria | 509 |
| 196 | Ga0495600_0014924 | 3300046809 | Bacteria | 4904 |
| 197 | Ga0495604_0020925 | 3300047317 | Bacteria | 5221 |
| 198 | Ga0495604_0078377 | 3300047317 | Bacteria | 2480 |
| 199 | Ga0495604_0569628 | 3300047317 | Bacteria | 729 |
| 200 | Ga0495674_0021504 | 3300047319 | Bacteria | 5967 |
| 201 | Ga0495674_0160956 | 3300047319 | Bacteria | 1878 |
| 202 | Ga0495674_0412305 | 3300047319 | Unclassified | 1089 |
| 203 | Ga0495674_0542763 | 3300047319 | Bacteria | 926 |
| 204 | Ga0495675_0085069 | 3300047444 | Bacteria | 1989 |
| 205 | Ga0495684_0040000 | 3300047471 | Bacteria | 3595 |
| 206 | Ga0495684_0152178 | 3300047471 | Bacteria | 1729 |
| 207 | Ga0495684_0287884 | 3300047471 | Bacteria | 1183 |
| 208 | Ga0495684_0368264 | 3300047471 | Bacteria | 1016 |
| 209 | Ga0495684_0428273 | 3300047471 | Unclassified | 923 |
| 210 | Ga0495684_0513802 | 3300047471 | Bacteria | 821 |
| 211 | Ga0495602_0058445 | 3300048088 | Bacteria | 3375 |
| 212 | Ga0495602_1109222 | 3300048088 | Unclassified | 518 |
| 213 | Ga0496114_0665731 | 3300048917 | Unclassified | 915 |
| 214 | Ga0496115_0062455 | 3300048918 | Bacteria | 3005 |
| 215 | Ga0501031_0013620 | 3300049568 | Bacteria | 5299 |
| 216 | Ga0501032_0001588 | 3300049569 | Bacteria | 18112 |
| 217 | Ga0501033_0059718 | 3300049570 | Bacteria | 2815 |
| 218 | Ga0501034_0006425 | 3300049571 | Bacteria | 12656 |
| 219 | Ga0501036_0001871 | 3300049572 | Bacteria | 16321 |
| 220 | Ga0501036_1154454 | 3300049572 | Unclassified | 632 |
| 221 | Ga0501037_0505390 | 3300049573 | Bacteria | 819 |
| 222 | Ga0501037_0596834 | 3300049573 | Bacteria | 742 |
| 223 | Ga0501038_0117697 | 3300049574 | Unclassified | 2194 |
| 224 | Ga0501039_0059913 | 3300049575 | Bacteria | 2948 |
| 225 | Ga0501040_0415383 | 3300049576 | Unclassified | 967 |
| 226 | Ga0501043_0063065 | 3300049579 | Bacteria | 2910 |
| 227 | Ga0501046_0112802 | 3300049580 | Unclassified | 2075 |
| 228 | Ga0501047_0082535 | 3300049581 | Bacteria | 3089 |
| 229 | Ga0501048_0054802 | 3300049582 | Bacteria | 2832 |
| 230 | Ga0501067_0001722 | 3300049583 | Bacteria | 12019 |
| 231 | Ga0501068_0000599 | 3300049584 | Bacteria | 18316 |
| 232 | Ga0501069_0000859 | 3300049585 | Bacteria | 14407 |
| 233 | Ga0501070_0078730 | 3300049586 | Bacteria | 2727 |
| 234 | Ga0501072_0025629 | 3300049588 | Bacteria | 4593 |
| 235 | Ga0501073_0001104 | 3300049589 | Bacteria | 19571 |
| 236 | Ga0501074_0021187 | 3300049590 | Bacteria | 4721 |
| 237 | Ga0501077_0077461 | 3300049593 | Unclassified | 2106 |
| 238 | Ga0501079_0000123 | 3300049741 | Bacteria | 41037 |
| 239 | Ga0501080_0000370 | 3300049742 | Bacteria | 34770 |
| 240 | Ga0501035_0123674 | 3300049822 | Unclassified | 2259 |
| 241 | Ga0501044_0082341 | 3300049823 | Bacteria | 3256 |
| 242 | Ga0501045_0611885 | 3300049824 | Bacteria | 806 |
| 243 | Ga0501045_1094793 | 3300049824 | Unclassified | 583 |
| 244 | nmdc:mga05p37_1378739_c1 | 3300050507 | Bacteria | 712 |
| 245 | nmdc:mga0qj67_53619_c1 | 3300050509 | Bacteria | 3192 |
| 246 | nmdc:mga06r32_11890_c1 | 3300050510 | Bacteria | 7840 |
| 247 | Ga0495601_0233970 | 3300053077 | Unclassified | 1200 |
| 248 | Ga0495595_0506668 | 3300053084 | Bacteria | 615 |
| 249 | Ga0495619_0281311 | 3300053085 | Bacteria | 1153 |
| 250 | Ga0501082_0000348 | 3300060353 | Bacteria | 40832 |
| 251 | Ga0501082_1396497 | 3300060353 | Unclassified | 611 |
| 252 | Ga0530510_0187064 | 3300061734 | Unclassified | 1537 |
| 253 | Ga0075430_100018772 | |||
| 254 | Ga0070658_10853127 | |||
| 255 | Ga0070658_11282530 | |||
| 256 | Ga0070683_100005933 | |||
| 257 | Ga0068869_100182153 | |||
| 258 | Ga0070680_100004266 | |||
| 259 | Ga0070660_100005565 | |||
| 260 | Ga0070691_10000451 | |||
| 261 | Ga0070661_100315395 | |||
| 262 | Ga0070675_100458402 | |||
| 263 | Ga0070674_100254008 | |||
| 264 | Ga0070659_100301981 | |||
| 265 | Ga0070714_100073780 | |||
| 266 | Ga0070714_100211176 | |||
| 267 | Ga0070713_100058139 | |||
| 268 | Ga0070713_101223664 | |||
| 269 | Ga0070681_10000603 | |||
| 270 | Ga0070679_100019519 | |||
| 271 | Ga0070679_101191111 | |||
| 272 | Ga0070684_100002959 | |||
| 273 | Ga0070684_100197419 | |||
| 274 | Ga0070697_100119153 | |||
| 275 | Ga0068853_100036205 | |||
| 276 | Ga0070695_100074728 | |||
| 277 | Ga0068855_100013232 | |||
| 278 | Ga0068855_100040826 | |||
| 279 | Ga0068855_100172366 | |||
| 280 | Ga0070664_101057254 | |||
| 281 | Ga0068857_100005428 | |||
| 282 | Ga0068856_100002485 | |||
| 283 | Ga0068856_100110336 | |||
| 284 | Ga0068856_100490746 | |||
| 285 | Ga0068856_100532317 | |||
| 286 | Ga0068852_100013638 | |||
| 287 | Ga0068852_100034676 | |||
| 288 | Ga0068859_100207260 | |||
| 289 | Ga0068863_100010260 | |||
| 290 | Ga0068858_100460498 | |||
| 291 | Ga0068860_100550910 | |||
| 292 | Ga0075431_100002969 | |||
| 293 | Ga0068865_100498152 | |||
| 294 | Ga0097620_100207258 | |||
| 295 | Ga0097620_100625738 | |||
| 296 | Ga0105240_10002709 | |||
| 297 | Ga0105240_10016460 | |||
| 298 | Ga0105240_10093691 | |||
| 299 | Ga0105240_10199408 | |||
| 300 | Ga0105240_10234511 | |||
| 301 | Ga0105240_10458987 | |||
| 302 | Ga0105245_10390025 | |||
| 303 | Ga0105247_10781947 | |||
| 304 | Ga0114129_10693464 | |||
| 305 | Ga0105241_10009242 | |||
| 306 | Ga0105248_10062588 | |||
| 307 | Ga0105248_10273778 | |||
| 308 | Ga0105248_11121511 | |||
| 309 | Ga0105237_10006902 | |||
| 310 | Ga0105237_10037096 | |||
| 311 | Ga0105237_10056808 | |||
| 312 | Ga0105237_10136734 | |||
| 313 | Ga0105237_11221028 | |||
| 314 | Ga0105238_10006155 | |||
| 315 | Ga0105238_10382658 | |||
| 316 | Ga0105238_11131485 | |||
| 317 | Ga0105249_10033044 | |||
| 318 | Ga0105249_10173396 | |||
| 319 | Ga0105239_10004110 | |||
| 320 | Ga0105239_10148246 | |||
| 321 | Ga0105239_10224980 | |||
| 322 | Ga0157370_10006762 | |||
| 323 | Ga0157370_10025377 | |||
| 324 | Ga0157369_10006734 | |||
| 325 | Ga0157369_10008786 | |||
| 326 | Ga0157369_10382406 | |||
| 327 | Ga0157369_10840212 | |||
| 328 | Ga0157374_11249003 | |||
| 329 | Ga0157378_12599531 | |||
| 330 | Ga0163162_10770186 | |||
| 331 | Ga0163162_11370641 | |||
| 332 | Ga0157372_10005214 | |||
| 333 | Ga0157372_10029310 | |||
| 334 | Ga0157375_10099087 | |||
| 335 | Ga0157375_11307118 | |||
| 336 | Ga0163163_10017589 | |||
| 337 | Ga0163163_11175428 | |||
| 338 | Ga0157380_10704747 | |||
| 339 | Ga0157380_12577268 | |||
| 340 | Ga0157376_10140826 | |||
| 341 | Ga0207705_10322617 | |||
| 342 | Ga0207705_10941691 | |||
| 343 | Ga0207654_10011751 | |||
| 344 | Ga0207707_10006124 | |||
| 345 | Ga0207695_10002352 | |||
| 346 | Ga0207695_10006258 | |||
| 347 | Ga0207695_10067628 | |||
| 348 | Ga0207695_10077139 | |||
| 349 | Ga0207671_10050888 | |||
| 350 | Ga0207671_10609851 | |||
| 351 | Ga0207660_10009304 | |||
| 352 | Ga0207660_10061548 | |||
| 353 | Ga0207657_10036558 | |||
| 354 | Ga0207652_10015186 | |||
| 355 | Ga0207652_10959800 | |||
| 356 | Ga0207694_10005332 | |||
| 357 | Ga0207694_10433199 | |||
| 358 | Ga0207687_10016776 | |||
| 359 | Ga0207700_10075513 | |||
| 360 | Ga0207664_10057616 | |||
| 361 | Ga0207670_10265570 | |||
| 362 | Ga0207669_10063384 | |||
| 363 | Ga0207704_10532702 | |||
| 364 | Ga0207711_10502439 | |||
| 365 | Ga0207661_10051324 | |||
| 366 | Ga0207661_11056013 | |||
| 367 | Ga0207667_10010138 | |||
| 368 | Ga0207667_10341069 | |||
| 369 | Ga0207712_10036388 | |||
| 370 | Ga0207703_10106502 | |||
| 371 | Ga0207639_10035050 | |||
| 372 | Ga0207702_10006869 | |||
| 373 | Ga0207702_10988191 | |||
| 374 | Ga0207702_11041363 | |||
| 375 | Ga0207648_10169255 | |||
| 376 | Ga0207674_10004753 | |||
| 377 | Ga0207698_10069411 | |||
| 378 | Ga0207698_10141516 | |||
| 379 | Ga0268264_10290574 | |||
| 380 | Ga0265316_10111503 | |||
| 381 | Ga0265316_10465137 | |||
| 382 | Ga0373926_0252304 | |||
| 383 | Ga0373934_0048735 | |||
| 384 | Ga0373923_0497460 | |||
| 385 | Ga0373954_0001103 | |||
| 386 | Ga0373954_0016915 | |||
| 387 | Ga0373954_0223668 | |||
| 388 | Ga0373957_0139760 | |||
| 389 | Ga0373955_0058011 | |||
| 390 | Ga0373955_0581963 | |||
| 391 | Ga0373933_0897842 | |||
| 392 | Ga0373937_0054072 | |||
| 393 | Ga0373937_1366929 | |||
| 394 | Ga0373925_0191947 | |||
| 395 | Ga0395900_0937143 | |||
| 396 | Ga0395898_0239713 | |||
| 397 | Ga0436364_1119461 | |||
| 398 | Ga0436365_0188996 | |||
| 399 | Ga0436365_1909208 | |||
| 400 | Ga0436360_0530689 | |||
| 401 | Ga0451576_0814088 | |||
| 402 | Ga0451576_2388370 | |||
| 403 | Ga0495592_0119290 | |||
| 404 | Ga0495592_0482299 | |||
| 405 | Ga0495629_0117167 | |||
| 406 | Ga0495629_1101885 | |||
| 407 | Ga0495651_0006999 | |||
| 408 | Ga0495653_0132400 | |||
| 409 | Ga0495653_0806564 | |||
| 410 | Ga0495580_0068789 | |||
| 411 | Ga0495582_0009650 | |||
| 412 | Ga0495639_0096473 | |||
| 413 | Ga0495662_0012987 | |||
| 414 | Ga0495608_0035876 | |||
| 415 | Ga0495618_0400116 | |||
| 416 | Ga0495628_0011875 | |||
| 417 | Ga0495628_0072998 | |||
| 418 | Ga0495628_0362774 | |||
| 419 | Ga0495630_0071090 | |||
| 420 | Ga0495630_0340912 | |||
| 421 | Ga0495666_0122884 | |||
| 422 | Ga0495652_0040309 | |||
| 423 | Ga0495665_0045302 | |||
| 424 | Ga0495665_0072846 | |||
| 425 | Ga0495640_0150416 | |||
| 426 | Ga0495640_0473785 | |||
| 427 | Ga0495586_0062305 | |||
| 428 | Ga0495587_0016965 | |||
| 429 | Ga0495645_0009581 | |||
| 430 | Ga0495645_0026092 | |||
| 431 | Ga0495645_0174904 | |||
| 432 | Ga0495645_0207967 | |||
| 433 | Ga0495667_0007972 | |||
| 434 | Ga0495634_0016966 | |||
| 435 | Ga0495634_0043889 | |||
| 436 | Ga0495635_0024913 | |||
| 437 | Ga0495599_0006928 | |||
| 438 | Ga0495599_0046290 | |||
| 439 | Ga0495623_0096585 | |||
| 440 | Ga0495623_0145309 | |||
| 441 | Ga0495646_0028159 | |||
| 442 | Ga0495647_0289720 | |||
| 443 | Ga0495658_0054637 | |||
| 444 | Ga0495613_0070926 | |||
| 445 | Ga0495613_0245185 | |||
| 446 | Ga0495613_0625704 | |||
| 447 | Ga0495624_0935437 | |||
| 448 | Ga0495600_0014924 | |||
| 449 | Ga0495604_0020925 | |||
| 450 | Ga0495604_0078377 | |||
| 451 | Ga0495604_0569628 | |||
| 452 | Ga0495674_0021504 | |||
| 453 | Ga0495674_0160956 | |||
| 454 | Ga0495674_0412305 | |||
| 455 | Ga0495674_0542763 | |||
| 456 | Ga0495675_0085069 | |||
| 457 | Ga0495684_0040000 | |||
| 458 | Ga0495684_0152178 | |||
| 459 | Ga0495684_0287884 | |||
| 460 | Ga0495684_0368264 | |||
| 461 | Ga0495684_0428273 | |||
| 462 | Ga0495684_0513802 | |||
| 463 | Ga0495602_0058445 | |||
| 464 | Ga0495602_1109222 | |||
| 465 | Ga0496114_0665731 | |||
| 466 | Ga0496115_0062455 | |||
| 467 | Ga0501031_0013620 | |||
| 468 | Ga0501032_0001588 | |||
| 469 | Ga0501033_0059718 | |||
| 470 | Ga0501034_0006425 | |||
| 471 | Ga0501036_0001871 | |||
| 472 | Ga0501036_1154454 | |||
| 473 | Ga0501037_0505390 | |||
| 474 | Ga0501037_0596834 | |||
| 475 | Ga0501038_0117697 | |||
| 476 | Ga0501039_0059913 | |||
| 477 | Ga0501040_0415383 | |||
| 478 | Ga0501043_0063065 | |||
| 479 | Ga0501046_0112802 | |||
| 480 | Ga0501047_0082535 | |||
| 481 | Ga0501048_0054802 | |||
| 482 | Ga0501067_0001722 | |||
| 483 | Ga0501068_0000599 | |||
| 484 | Ga0501069_0000859 | |||
| 485 | Ga0501070_0078730 | |||
| 486 | Ga0501072_0025629 | |||
| 487 | Ga0501073_0001104 | |||
| 488 | Ga0501074_0021187 | |||
| 489 | Ga0501077_0077461 | |||
| 490 | Ga0501079_0000123 | |||
| 491 | Ga0501080_0000370 | |||
| 492 | Ga0501035_0123674 | |||
| 493 | Ga0501044_0082341 | |||
| 494 | Ga0501045_0611885 | |||
| 495 | Ga0501045_1094793 | |||
| 496 | nmdc:mga05p37_1378739_c1 | |||
| 497 | nmdc:mga0qj67_53619_c1 | |||
| 498 | nmdc:mga06r32_11890_c1 | |||
| 499 | Ga0495601_0233970 | |||
| 500 | Ga0495595_0506668 | |||
| 501 | Ga0495619_0281311 | |||
| 502 | Ga0501082_0000348 | |||
| 503 | Ga0501082_1396497 | |||
| 504 | Ga0530510_0187064 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eb5-assembly1.cif.gz_D | a. fulgidus iscs-iscu complex structure | 0.9366 | 6 | 114 |
| 5wlw-assembly1.cif.gz_H | crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. | 0.9291 | 5 | 120 |
| 4eb5-assembly1.cif.gz_C | a. fulgidus iscs-iscu complex structure | 0.9276 | 6 | 120 |
| 5wkp-assembly1.cif.gz_D | crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a | 0.9249 | 11 | 120 |
| 3lvl-assembly1.cif.gz_A-2 | crystal structure of e.coli iscs-iscu complex | 0.921 | 4 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5wlwD01 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9477 | 26 | 118 | 3.90.1010.10 |
| 4eb5D00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9366 | 6 | 114 | 3.90.1010.10 |
| af_Q9MAB6_26_163_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9286 | 5 | 120 | 3.90.1010.10 |
| af_Q8IKT4_39_161_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9285 | 6 | 120 | 3.90.1010.10 |
| 4eb7C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8944 | 6 | 120 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q023P2-F1-model_v4 | Nitrogen-fixing NifU domain protein | 0.9933 | 5 | 121 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2V8UX25-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9861 | 5 | 121 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7C2HZI7-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9802 | 2 | 69 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-Q023P2-F1-model_v4 | Nitrogen-fixing NifU domain protein | 0.9767 | 5 | 121 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2V9A416-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9766 | 5 | 119 |
GO:0005506
GO:0016226 GO:0051536 |