F363158

General Info

Members Datasets Scaffolds Average Seq Length
252 164 504 119

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100018772|Ga0075430_1000187723
Length 117
Sequence MHSEKLLDHFQNPRNAGELSDATVRVDVENPACGDQLRLTVRVEDGLVAAVRFKVRGCTASIAAGSALTEWLTGRAVKEAALLRSDDIEAALGGLIPESRHAAILCMDAARELARRA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.79
Rhizosphere 98.02
Stem 0
Stem Tuber 0
Unclassified 31.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100018772 3300006846 Bacteria 5885
2 Ga0070658_10853127 3300005327 Bacteria 792
3 Ga0070658_11282530 3300005327 Unclassified 636
4 Ga0070683_100005933 3300005329 Bacteria 10224
5 Ga0068869_100182153 3300005334 Bacteria 1647
6 Ga0070680_100004266 3300005336 Bacteria 10734
7 Ga0070660_100005565 3300005339 Bacteria 8727
8 Ga0070691_10000451 3300005341 Bacteria 15241
9 Ga0070661_100315395 3300005344 Unclassified 1220
10 Ga0070675_100458402 3300005354 Bacteria 1144
11 Ga0070674_100254008 3300005356 Unclassified 1382
12 Ga0070659_100301981 3300005366 Unclassified 1335
13 Ga0070714_100073780 3300005435 Unclassified 2957
14 Ga0070714_100211176 3300005435 Bacteria 1779
15 Ga0070713_100058139 3300005436 Bacteria 3224
16 Ga0070713_101223664 3300005436 Unclassified 727
17 Ga0070681_10000603 3300005458 Bacteria 29582
18 Ga0070679_100019519 3300005530 Bacteria 6593
19 Ga0070679_101191111 3300005530 Unclassified 707
20 Ga0070684_100002959 3300005535 Bacteria 12651
21 Ga0070684_100197419 3300005535 Unclassified 1832
22 Ga0070697_100119153 3300005536 Bacteria 2206
23 Ga0068853_100036205 3300005539 Bacteria 4195
24 Ga0070695_100074728 3300005545 Bacteria 2227
25 Ga0068855_100013232 3300005563 Bacteria 9950
26 Ga0068855_100040826 3300005563 Bacteria 5503
27 Ga0068855_100172366 3300005563 Bacteria 2450
28 Ga0070664_101057254 3300005564 Bacteria 764
29 Ga0068857_100005428 3300005577 Bacteria 10869
30 Ga0068856_100002485 3300005614 Bacteria 18973
31 Ga0068856_100110336 3300005614 Bacteria 2748
32 Ga0068856_100490746 3300005614 Unclassified 1249
33 Ga0068856_100532317 3300005614 Unclassified 1196
34 Ga0068852_100013638 3300005616 Bacteria 6224
35 Ga0068852_100034676 3300005616 Bacteria 4202
36 Ga0068859_100207260 3300005617 Bacteria 2046
37 Ga0068863_100010260 3300005841 Bacteria 9106
38 Ga0068858_100460498 3300005842 Bacteria 1226
39 Ga0068860_100550910 3300005843 Unclassified 1155
40 Ga0075431_100002969 3300006847 Bacteria 16411
41 Ga0068865_100498152 3300006881 Bacteria 1015
42 Ga0097620_100207258 3300006931 Bacteria 2046
43 Ga0097620_100625738 3300006931 Unclassified 1169
44 Ga0105240_10002709 3300009093 Bacteria 28152
45 Ga0105240_10016460 3300009093 Bacteria 10008
46 Ga0105240_10093691 3300009093 Unclassified 3665
47 Ga0105240_10199408 3300009093 Bacteria 2347
48 Ga0105240_10234511 3300009093 Unclassified 2130
49 Ga0105240_10458987 3300009093 Bacteria 1424
50 Ga0105245_10390025 3300009098 Bacteria 1389
51 Ga0105247_10781947 3300009101 Unclassified 726
52 Ga0114129_10693464 3300009147 Bacteria 1309
53 Ga0105241_10009242 3300009174 Bacteria 7249
54 Ga0105248_10062588 3300009177 Bacteria 4178
55 Ga0105248_10273778 3300009177 Unclassified 1901
56 Ga0105248_11121511 3300009177 Unclassified 889
57 Ga0105237_10006902 3300009545 Bacteria 12522
58 Ga0105237_10037096 3300009545 Bacteria 4928
59 Ga0105237_10056808 3300009545 Bacteria 3917
60 Ga0105237_10136734 3300009545 Unclassified 2445
61 Ga0105237_11221028 3300009545 Bacteria 758
62 Ga0105238_10006155 3300009551 Bacteria 11911
63 Ga0105238_10382658 3300009551 Bacteria 1399
64 Ga0105238_11131485 3300009551 Unclassified 806
65 Ga0105249_10033044 3300009553 Unclassified 4684
66 Ga0105249_10173396 3300009553 Unclassified 2093
67 Ga0105239_10004110 3300010375 Bacteria 17489
68 Ga0105239_10148246 3300010375 Bacteria 2618
69 Ga0105239_10224980 3300010375 Unclassified 2104
70 Ga0157370_10006762 3300013104 Bacteria 12580
71 Ga0157370_10025377 3300013104 Bacteria 5867
72 Ga0157369_10006734 3300013105 Bacteria 13258
73 Ga0157369_10008786 3300013105 Bacteria 11576
74 Ga0157369_10382406 3300013105 Bacteria 1461
75 Ga0157369_10840212 3300013105 Unclassified 943
76 Ga0157374_11249003 3300013296 Bacteria 764
77 Ga0157378_12599531 3300013297 Bacteria 559
78 Ga0163162_10770186 3300013306 Unclassified 1081
79 Ga0163162_11370641 3300013306 Bacteria 804
80 Ga0157372_10005214 3300013307 Bacteria 13812
81 Ga0157372_10029310 3300013307 Bacteria 6008
82 Ga0157375_10099087 3300013308 Unclassified 2993
83 Ga0157375_11307118 3300013308 Unclassified 853
84 Ga0163163_10017589 3300014325 Bacteria 6671
85 Ga0163163_11175428 3300014325 Unclassified 830
86 Ga0157380_10704747 3300014326 Bacteria 1015
87 Ga0157380_12577268 3300014326 Unclassified 574
88 Ga0157376_10140826 3300014969 Bacteria 2163
89 Ga0207705_10322617 3300025909 Unclassified 1187
90 Ga0207705_10941691 3300025909 Unclassified 668
91 Ga0207654_10011751 3300025911 Bacteria 4470
92 Ga0207707_10006124 3300025912 Bacteria 10514
93 Ga0207695_10002352 3300025913 Bacteria 28101
94 Ga0207695_10006258 3300025913 Bacteria 15497
95 Ga0207695_10067628 3300025913 Bacteria 3664
96 Ga0207695_10077139 3300025913 Bacteria 3386
97 Ga0207671_10050888 3300025914 Bacteria 3068
98 Ga0207671_10609851 3300025914 Bacteria 870
99 Ga0207660_10009304 3300025917 Bacteria 6360
100 Ga0207660_10061548 3300025917 Bacteria 2702
101 Ga0207657_10036558 3300025919 Bacteria 4394
102 Ga0207652_10015186 3300025921 Bacteria 6248
103 Ga0207652_10959800 3300025921 Unclassified 753
104 Ga0207694_10005332 3300025924 Bacteria 9906
105 Ga0207694_10433199 3300025924 Unclassified 1096
106 Ga0207687_10016776 3300025927 Bacteria 4813
107 Ga0207700_10075513 3300025928 Bacteria 2612
108 Ga0207664_10057616 3300025929 Unclassified 3088
109 Ga0207670_10265570 3300025936 Bacteria 1332
110 Ga0207669_10063384 3300025937 Unclassified 2282
111 Ga0207704_10532702 3300025938 Bacteria 952
112 Ga0207711_10502439 3300025941 Unclassified 1130
113 Ga0207661_10051324 3300025944 Bacteria 3290
114 Ga0207661_11056013 3300025944 Bacteria 748
115 Ga0207667_10010138 3300025949 Bacteria 11034
116 Ga0207667_10341069 3300025949 Unclassified 1529
117 Ga0207712_10036388 3300025961 Bacteria 3352
118 Ga0207703_10106502 3300026035 Bacteria 2385
119 Ga0207639_10035050 3300026041 Bacteria 3713
120 Ga0207702_10006869 3300026078 Bacteria 9756
121 Ga0207702_10988191 3300026078 Unclassified 835
122 Ga0207702_11041363 3300026078 Unclassified 812
123 Ga0207648_10169255 3300026089 Bacteria 1931
124 Ga0207674_10004753 3300026116 Bacteria 16285
125 Ga0207698_10069411 3300026142 Bacteria 2787
126 Ga0207698_10141516 3300026142 Bacteria 2073
127 Ga0268264_10290574 3300028381 Unclassified 1535
128 Ga0265316_10111503 3300031344 Bacteria 2071
129 Ga0265316_10465137 3300031344 Unclassified 906
130 Ga0373926_0252304 3300035083 Unclassified 684
131 Ga0373934_0048735 3300035086 Bacteria 1677
132 Ga0373923_0497460 3300035111 Unclassified 594
133 Ga0373954_0001103 3300035118 Bacteria 10795
134 Ga0373954_0016915 3300035118 Bacteria 3272
135 Ga0373954_0223668 3300035118 Unclassified 926
136 Ga0373957_0139760 3300035120 Bacteria 989
137 Ga0373955_0058011 3300035172 Bacteria 2129
138 Ga0373955_0581963 3300035172 Bacteria 685
139 Ga0373933_0897842 3300035724 Unclassified 583
140 Ga0373937_0054072 3300036401 Bacteria 3683
141 Ga0373937_1366929 3300036401 Bacteria 656
142 Ga0373925_0191947 3300037068 Bacteria 1621
143 Ga0395900_0937143 3300037418 Unclassified 788
144 Ga0395898_0239713 3300037466 Unclassified 1730
145 Ga0436364_1119461 3300037853 Bacteria 3317
146 Ga0436365_0188996 3300039437 Unclassified 640
147 Ga0436365_1909208 3300039437 Bacteria 877
148 Ga0436360_0530689 3300039438 Unclassified 562
149 Ga0451576_0814088 3300045051 Unclassified 981
150 Ga0451576_2388370 3300045051 Bacteria 541
151 Ga0495592_0119290 3300046454 Bacteria 1857
152 Ga0495592_0482299 3300046454 Unclassified 772
153 Ga0495629_0117167 3300046459 Bacteria 1856
154 Ga0495629_1101885 3300046459 Unclassified 513
155 Ga0495651_0006999 3300046462 Bacteria 8627
156 Ga0495653_0132400 3300046463 Unclassified 1763
157 Ga0495653_0806564 3300046463 Bacteria 564
158 Ga0495580_0068789 3300046472 Unclassified 2475
159 Ga0495582_0009650 3300046473 Bacteria 5314
160 Ga0495639_0096473 3300046475 Bacteria 1392
161 Ga0495662_0012987 3300046476 Unclassified 4057
162 Ga0495608_0035876 3300046511 Bacteria 3341
163 Ga0495618_0400116 3300046514 Unclassified 840
164 Ga0495628_0011875 3300046516 Bacteria 7346
165 Ga0495628_0072998 3300046516 Bacteria 2674
166 Ga0495628_0362774 3300046516 Unclassified 1063
167 Ga0495630_0071090 3300046517 Unclassified 2618
168 Ga0495630_0340912 3300046517 Unclassified 1147
169 Ga0495666_0122884 3300046526 Bacteria 1215
170 Ga0495652_0040309 3300046529 Bacteria 4036
171 Ga0495665_0045302 3300046531 Unclassified 2337
172 Ga0495665_0072846 3300046531 Bacteria 1809
173 Ga0495640_0150416 3300046533 Unclassified 1496
174 Ga0495640_0473785 3300046533 Bacteria 763
175 Ga0495586_0062305 3300046535 Bacteria 2030
176 Ga0495587_0016965 3300046536 Unclassified 4528
177 Ga0495645_0009581 3300046543 Bacteria 6775
178 Ga0495645_0026092 3300046543 Bacteria 4240
179 Ga0495645_0174904 3300046543 Unclassified 1475
180 Ga0495645_0207967 3300046543 Bacteria 1323
181 Ga0495667_0007972 3300046559 Bacteria 7183
182 Ga0495634_0016966 3300046642 Bacteria 5201
183 Ga0495634_0043889 3300046642 Bacteria 3029
184 Ga0495635_0024913 3300046663 Unclassified 4169
185 Ga0495599_0006928 3300046678 Bacteria 6853
186 Ga0495599_0046290 3300046678 Bacteria 2728
187 Ga0495623_0096585 3300046679 Unclassified 1805
188 Ga0495623_0145309 3300046679 Bacteria 1407
189 Ga0495646_0028159 3300046680 Unclassified 3520
190 Ga0495647_0289720 3300046681 Bacteria 736
191 Ga0495658_0054637 3300046683 Bacteria 2272
192 Ga0495613_0070926 3300046689 Bacteria 2540
193 Ga0495613_0245185 3300046689 Bacteria 1252
194 Ga0495613_0625704 3300046689 Unclassified 714
195 Ga0495624_0935437 3300046690 Bacteria 509
196 Ga0495600_0014924 3300046809 Bacteria 4904
197 Ga0495604_0020925 3300047317 Bacteria 5221
198 Ga0495604_0078377 3300047317 Bacteria 2480
199 Ga0495604_0569628 3300047317 Bacteria 729
200 Ga0495674_0021504 3300047319 Bacteria 5967
201 Ga0495674_0160956 3300047319 Bacteria 1878
202 Ga0495674_0412305 3300047319 Unclassified 1089
203 Ga0495674_0542763 3300047319 Bacteria 926
204 Ga0495675_0085069 3300047444 Bacteria 1989
205 Ga0495684_0040000 3300047471 Bacteria 3595
206 Ga0495684_0152178 3300047471 Bacteria 1729
207 Ga0495684_0287884 3300047471 Bacteria 1183
208 Ga0495684_0368264 3300047471 Bacteria 1016
209 Ga0495684_0428273 3300047471 Unclassified 923
210 Ga0495684_0513802 3300047471 Bacteria 821
211 Ga0495602_0058445 3300048088 Bacteria 3375
212 Ga0495602_1109222 3300048088 Unclassified 518
213 Ga0496114_0665731 3300048917 Unclassified 915
214 Ga0496115_0062455 3300048918 Bacteria 3005
215 Ga0501031_0013620 3300049568 Bacteria 5299
216 Ga0501032_0001588 3300049569 Bacteria 18112
217 Ga0501033_0059718 3300049570 Bacteria 2815
218 Ga0501034_0006425 3300049571 Bacteria 12656
219 Ga0501036_0001871 3300049572 Bacteria 16321
220 Ga0501036_1154454 3300049572 Unclassified 632
221 Ga0501037_0505390 3300049573 Bacteria 819
222 Ga0501037_0596834 3300049573 Bacteria 742
223 Ga0501038_0117697 3300049574 Unclassified 2194
224 Ga0501039_0059913 3300049575 Bacteria 2948
225 Ga0501040_0415383 3300049576 Unclassified 967
226 Ga0501043_0063065 3300049579 Bacteria 2910
227 Ga0501046_0112802 3300049580 Unclassified 2075
228 Ga0501047_0082535 3300049581 Bacteria 3089
229 Ga0501048_0054802 3300049582 Bacteria 2832
230 Ga0501067_0001722 3300049583 Bacteria 12019
231 Ga0501068_0000599 3300049584 Bacteria 18316
232 Ga0501069_0000859 3300049585 Bacteria 14407
233 Ga0501070_0078730 3300049586 Bacteria 2727
234 Ga0501072_0025629 3300049588 Bacteria 4593
235 Ga0501073_0001104 3300049589 Bacteria 19571
236 Ga0501074_0021187 3300049590 Bacteria 4721
237 Ga0501077_0077461 3300049593 Unclassified 2106
238 Ga0501079_0000123 3300049741 Bacteria 41037
239 Ga0501080_0000370 3300049742 Bacteria 34770
240 Ga0501035_0123674 3300049822 Unclassified 2259
241 Ga0501044_0082341 3300049823 Bacteria 3256
242 Ga0501045_0611885 3300049824 Bacteria 806
243 Ga0501045_1094793 3300049824 Unclassified 583
244 nmdc:mga05p37_1378739_c1 3300050507 Bacteria 712
245 nmdc:mga0qj67_53619_c1 3300050509 Bacteria 3192
246 nmdc:mga06r32_11890_c1 3300050510 Bacteria 7840
247 Ga0495601_0233970 3300053077 Unclassified 1200
248 Ga0495595_0506668 3300053084 Bacteria 615
249 Ga0495619_0281311 3300053085 Bacteria 1153
250 Ga0501082_0000348 3300060353 Bacteria 40832
251 Ga0501082_1396497 3300060353 Unclassified 611
252 Ga0530510_0187064 3300061734 Unclassified 1537
253 Ga0075430_100018772
254 Ga0070658_10853127
255 Ga0070658_11282530
256 Ga0070683_100005933
257 Ga0068869_100182153
258 Ga0070680_100004266
259 Ga0070660_100005565
260 Ga0070691_10000451
261 Ga0070661_100315395
262 Ga0070675_100458402
263 Ga0070674_100254008
264 Ga0070659_100301981
265 Ga0070714_100073780
266 Ga0070714_100211176
267 Ga0070713_100058139
268 Ga0070713_101223664
269 Ga0070681_10000603
270 Ga0070679_100019519
271 Ga0070679_101191111
272 Ga0070684_100002959
273 Ga0070684_100197419
274 Ga0070697_100119153
275 Ga0068853_100036205
276 Ga0070695_100074728
277 Ga0068855_100013232
278 Ga0068855_100040826
279 Ga0068855_100172366
280 Ga0070664_101057254
281 Ga0068857_100005428
282 Ga0068856_100002485
283 Ga0068856_100110336
284 Ga0068856_100490746
285 Ga0068856_100532317
286 Ga0068852_100013638
287 Ga0068852_100034676
288 Ga0068859_100207260
289 Ga0068863_100010260
290 Ga0068858_100460498
291 Ga0068860_100550910
292 Ga0075431_100002969
293 Ga0068865_100498152
294 Ga0097620_100207258
295 Ga0097620_100625738
296 Ga0105240_10002709
297 Ga0105240_10016460
298 Ga0105240_10093691
299 Ga0105240_10199408
300 Ga0105240_10234511
301 Ga0105240_10458987
302 Ga0105245_10390025
303 Ga0105247_10781947
304 Ga0114129_10693464
305 Ga0105241_10009242
306 Ga0105248_10062588
307 Ga0105248_10273778
308 Ga0105248_11121511
309 Ga0105237_10006902
310 Ga0105237_10037096
311 Ga0105237_10056808
312 Ga0105237_10136734
313 Ga0105237_11221028
314 Ga0105238_10006155
315 Ga0105238_10382658
316 Ga0105238_11131485
317 Ga0105249_10033044
318 Ga0105249_10173396
319 Ga0105239_10004110
320 Ga0105239_10148246
321 Ga0105239_10224980
322 Ga0157370_10006762
323 Ga0157370_10025377
324 Ga0157369_10006734
325 Ga0157369_10008786
326 Ga0157369_10382406
327 Ga0157369_10840212
328 Ga0157374_11249003
329 Ga0157378_12599531
330 Ga0163162_10770186
331 Ga0163162_11370641
332 Ga0157372_10005214
333 Ga0157372_10029310
334 Ga0157375_10099087
335 Ga0157375_11307118
336 Ga0163163_10017589
337 Ga0163163_11175428
338 Ga0157380_10704747
339 Ga0157380_12577268
340 Ga0157376_10140826
341 Ga0207705_10322617
342 Ga0207705_10941691
343 Ga0207654_10011751
344 Ga0207707_10006124
345 Ga0207695_10002352
346 Ga0207695_10006258
347 Ga0207695_10067628
348 Ga0207695_10077139
349 Ga0207671_10050888
350 Ga0207671_10609851
351 Ga0207660_10009304
352 Ga0207660_10061548
353 Ga0207657_10036558
354 Ga0207652_10015186
355 Ga0207652_10959800
356 Ga0207694_10005332
357 Ga0207694_10433199
358 Ga0207687_10016776
359 Ga0207700_10075513
360 Ga0207664_10057616
361 Ga0207670_10265570
362 Ga0207669_10063384
363 Ga0207704_10532702
364 Ga0207711_10502439
365 Ga0207661_10051324
366 Ga0207661_11056013
367 Ga0207667_10010138
368 Ga0207667_10341069
369 Ga0207712_10036388
370 Ga0207703_10106502
371 Ga0207639_10035050
372 Ga0207702_10006869
373 Ga0207702_10988191
374 Ga0207702_11041363
375 Ga0207648_10169255
376 Ga0207674_10004753
377 Ga0207698_10069411
378 Ga0207698_10141516
379 Ga0268264_10290574
380 Ga0265316_10111503
381 Ga0265316_10465137
382 Ga0373926_0252304
383 Ga0373934_0048735
384 Ga0373923_0497460
385 Ga0373954_0001103
386 Ga0373954_0016915
387 Ga0373954_0223668
388 Ga0373957_0139760
389 Ga0373955_0058011
390 Ga0373955_0581963
391 Ga0373933_0897842
392 Ga0373937_0054072
393 Ga0373937_1366929
394 Ga0373925_0191947
395 Ga0395900_0937143
396 Ga0395898_0239713
397 Ga0436364_1119461
398 Ga0436365_0188996
399 Ga0436365_1909208
400 Ga0436360_0530689
401 Ga0451576_0814088
402 Ga0451576_2388370
403 Ga0495592_0119290
404 Ga0495592_0482299
405 Ga0495629_0117167
406 Ga0495629_1101885
407 Ga0495651_0006999
408 Ga0495653_0132400
409 Ga0495653_0806564
410 Ga0495580_0068789
411 Ga0495582_0009650
412 Ga0495639_0096473
413 Ga0495662_0012987
414 Ga0495608_0035876
415 Ga0495618_0400116
416 Ga0495628_0011875
417 Ga0495628_0072998
418 Ga0495628_0362774
419 Ga0495630_0071090
420 Ga0495630_0340912
421 Ga0495666_0122884
422 Ga0495652_0040309
423 Ga0495665_0045302
424 Ga0495665_0072846
425 Ga0495640_0150416
426 Ga0495640_0473785
427 Ga0495586_0062305
428 Ga0495587_0016965
429 Ga0495645_0009581
430 Ga0495645_0026092
431 Ga0495645_0174904
432 Ga0495645_0207967
433 Ga0495667_0007972
434 Ga0495634_0016966
435 Ga0495634_0043889
436 Ga0495635_0024913
437 Ga0495599_0006928
438 Ga0495599_0046290
439 Ga0495623_0096585
440 Ga0495623_0145309
441 Ga0495646_0028159
442 Ga0495647_0289720
443 Ga0495658_0054637
444 Ga0495613_0070926
445 Ga0495613_0245185
446 Ga0495613_0625704
447 Ga0495624_0935437
448 Ga0495600_0014924
449 Ga0495604_0020925
450 Ga0495604_0078377
451 Ga0495604_0569628
452 Ga0495674_0021504
453 Ga0495674_0160956
454 Ga0495674_0412305
455 Ga0495674_0542763
456 Ga0495675_0085069
457 Ga0495684_0040000
458 Ga0495684_0152178
459 Ga0495684_0287884
460 Ga0495684_0368264
461 Ga0495684_0428273
462 Ga0495684_0513802
463 Ga0495602_0058445
464 Ga0495602_1109222
465 Ga0496114_0665731
466 Ga0496115_0062455
467 Ga0501031_0013620
468 Ga0501032_0001588
469 Ga0501033_0059718
470 Ga0501034_0006425
471 Ga0501036_0001871
472 Ga0501036_1154454
473 Ga0501037_0505390
474 Ga0501037_0596834
475 Ga0501038_0117697
476 Ga0501039_0059913
477 Ga0501040_0415383
478 Ga0501043_0063065
479 Ga0501046_0112802
480 Ga0501047_0082535
481 Ga0501048_0054802
482 Ga0501067_0001722
483 Ga0501068_0000599
484 Ga0501069_0000859
485 Ga0501070_0078730
486 Ga0501072_0025629
487 Ga0501073_0001104
488 Ga0501074_0021187
489 Ga0501077_0077461
490 Ga0501079_0000123
491 Ga0501080_0000370
492 Ga0501035_0123674
493 Ga0501044_0082341
494 Ga0501045_0611885
495 Ga0501045_1094793
496 nmdc:mga05p37_1378739_c1
497 nmdc:mga0qj67_53619_c1
498 nmdc:mga06r32_11890_c1
499 Ga0495601_0233970
500 Ga0495595_0506668
501 Ga0495619_0281311
502 Ga0501082_0000348
503 Ga0501082_1396497
504 Ga0530510_0187064

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

1

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eb5-assembly1.cif.gz_D a. fulgidus iscs-iscu complex structure 0.9366 6 114
5wlw-assembly1.cif.gz_H crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. 0.9291 5 120
4eb5-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.9276 6 120
5wkp-assembly1.cif.gz_D crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and iron-sulfur cluster scaffold protein iscu1, and e. coli acp1 protein at 3.15a 0.9249 11 120
3lvl-assembly1.cif.gz_A-2 crystal structure of e.coli iscs-iscu complex 0.921 4 120
ID Description Score Start End Superfamily
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9477 26 118 3.90.1010.10
4eb5D00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9366 6 114 3.90.1010.10
af_Q9MAB6_26_163_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9286 5 120 3.90.1010.10
af_Q8IKT4_39_161_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9285 6 120 3.90.1010.10
4eb7C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8944 6 120 3.90.1010.10
ID Description Score Start End GO Terms
AF-Q023P2-F1-model_v4 Nitrogen-fixing NifU domain protein 0.9933 5 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V8UX25-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9861 5 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C2HZI7-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9802 2 69 GO:0005506
GO:0016226
GO:0051536
AF-Q023P2-F1-model_v4 Nitrogen-fixing NifU domain protein 0.9767 5 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V9A416-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9766 5 119 GO:0005506
GO:0016226
GO:0051536

Map