F363143

General Info

Members Datasets Scaffolds Average Seq Length
252 146 504 289

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100171406|Ga0070716_1001714061
Length 300
Sequence MDLTLRRRYFAEELEAICRLRSPHLVNAFATVPREQYLGPGPWTVLADSPYLQGAGPAAGLGLRVTPDADPGRVYHNIAVAIDPARQLFNGQPGTLAVWIDTLDLAPGARVLHIGSGLGYYTAVIAQAVGPSGRVVTYEVDEALAAGAKRNLAPLPWVDARHGDSSQVSGELFDAIMVNAGVTHPLDVWLDALAVGGRMILPLTSTMPALGSTLGKGLVFVLTKHDDTSIAARVLTVVAVYSAIGLRDEELGATLGKAMMAGPARWQEIKRLRRDRHDPDAGCWLHAPNCCVSTTGIRPS

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 3.97
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 22.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100171406 3300006173 Unclassified 1416
2 Ga0065712_10001565 3300005290 Bacteria 5815
3 Ga0070690_100004450 3300005330 Bacteria 7782
4 Ga0070690_100178648 3300005330 Unclassified 1465
5 Ga0070670_100006445 3300005331 Bacteria 9936
6 Ga0070670_100015182 3300005331 Bacteria 6611
7 Ga0070670_100046596 3300005331 Bacteria 3729
8 Ga0070670_100186366 3300005331 Bacteria 1802
9 Ga0068869_100056339 3300005334 Bacteria 2867
10 Ga0070666_10026869 3300005335 Bacteria 3765
11 Ga0070666_10082291 3300005335 Bacteria 2202
12 Ga0070680_100484441 3300005336 Unclassified 1057
13 Ga0070689_100016458 3300005340 Bacteria 5412
14 Ga0070689_100030144 3300005340 Bacteria 4115
15 Ga0070669_100010779 3300005353 Bacteria 6489
16 Ga0070675_100049430 3300005354 Bacteria 3452
17 Ga0070675_100062778 3300005354 Bacteria 3070
18 Ga0070673_100012488 3300005364 Bacteria 5832
19 Ga0070673_100289939 3300005364 Unclassified 1438
20 Ga0070667_100017062 3300005367 Bacteria 6013
21 Ga0070714_100005373 3300005435 Bacteria 9776
22 Ga0070713_100545770 3300005436 Bacteria 1097
23 Ga0070700_100064659 3300005441 Bacteria 2317
24 Ga0070694_100043484 3300005444 Bacteria 3004
25 Ga0070662_100102111 3300005457 Unclassified 2172
26 Ga0068867_100067200 3300005459 Unclassified 2672
27 Ga0070699_100299430 3300005518 Bacteria 1443
28 Ga0070686_100001954 3300005544 Bacteria 11436
29 Ga0070665_100002974 3300005548 Bacteria 18312
30 Ga0070665_100006812 3300005548 Bacteria 11618
31 Ga0070704_100019035 3300005549 Bacteria 4404
32 Ga0070664_100136933 3300005564 Unclassified 2154
33 Ga0070664_100195372 3300005564 Bacteria 1803
34 Ga0068854_100017597 3300005578 Bacteria 4784
35 Ga0068854_100032223 3300005578 Bacteria 3644
36 Ga0070702_100153041 3300005615 Unclassified 1483
37 Ga0068859_100091205 3300005617 Bacteria 3098
38 Ga0068859_100551743 3300005617 Unclassified 1247
39 Ga0068864_100007065 3300005618 Bacteria 9218
40 Ga0068866_10006804 3300005718 Bacteria 4773
41 Ga0068863_100003360 3300005841 Bacteria 15799
42 Ga0068863_100035342 3300005841 Bacteria 4759
43 Ga0068863_100039571 3300005841 Bacteria 4485
44 Ga0068863_100094775 3300005841 Bacteria 2833
45 Ga0068863_100143661 3300005841 Bacteria 2282
46 Ga0068858_100018546 3300005842 Bacteria 6515
47 Ga0068858_100074151 3300005842 Unclassified 3159
48 Ga0068860_100088888 3300005843 Unclassified 2941
49 Ga0068860_100093628 3300005843 Bacteria 2863
50 Ga0068862_100032614 3300005844 Bacteria 4401
51 Ga0068862_100182639 3300005844 Unclassified 1883
52 Ga0068862_100280096 3300005844 Bacteria 1528
53 Ga0081455_10040322 3300005937 Bacteria 4119
54 Ga0097621_100002793 3300006237 Bacteria 11955
55 Ga0097621_100247005 3300006237 Bacteria 1562
56 Ga0068871_100022311 3300006358 Unclassified 4880
57 Ga0068871_100054565 3300006358 Bacteria 3243
58 Ga0068871_100152898 3300006358 Unclassified 1969
59 Ga0068871_100180809 3300006358 Bacteria 1812
60 Ga0075428_100015741 3300006844 Bacteria 8379
61 Ga0075428_100694148 3300006844 Bacteria 1084
62 Ga0075430_100012541 3300006846 Bacteria 7215
63 Ga0075430_100044892 3300006846 Unclassified 3735
64 Ga0075430_100203285 3300006846 Bacteria 1644
65 Ga0075431_100221837 3300006847 Bacteria 1928
66 Ga0075433_10124012 3300006852 Unclassified 2295
67 Ga0075433_10264389 3300006852 Bacteria 1525
68 Ga0075434_100000953 3300006871 Bacteria 23315
69 Ga0075434_100004381 3300006871 Bacteria 12718
70 Ga0068865_100009626 3300006881 Bacteria 5994
71 Ga0075436_100000179 3300006914 Bacteria 39702
72 Ga0075436_100031116 3300006914 Bacteria 3673
73 Ga0097620_100091206 3300006931 Bacteria 3098
74 Ga0097620_100551778 3300006931 Unclassified 1247
75 Ga0075435_100000013 3300007076 Bacteria 106345
76 Ga0075435_100001460 3300007076 Bacteria 15188
77 Ga0075435_100016672 3300007076 Bacteria 5541
78 Ga0075435_100060964 3300007076 Bacteria 3059
79 Ga0105240_10121517 3300009093 Bacteria 3144
80 Ga0111539_10025862 3300009094 Bacteria 7187
81 Ga0111539_10511497 3300009094 Bacteria 1399
82 Ga0105245_10052254 3300009098 Bacteria 3665
83 Ga0105247_10008856 3300009101 Bacteria 6135
84 Ga0114129_10000589 3300009147 Bacteria 44910
85 Ga0114129_10036882 3300009147 Bacteria 6902
86 Ga0114129_10064577 3300009147 Bacteria 5109
87 Ga0114129_10217180 3300009147 Bacteria 2581
88 Ga0114129_10436159 3300009147 Unclassified 1720
89 Ga0105243_10096566 3300009148 Bacteria 2445
90 Ga0105243_10164269 3300009148 Unclassified 1917
91 Ga0105242_10013033 3300009176 Bacteria 6416
92 Ga0105248_10001067 3300009177 Bacteria 30324
93 Ga0105248_10015034 3300009177 Bacteria 8522
94 Ga0105248_10025919 3300009177 Bacteria 6520
95 Ga0105248_10051364 3300009177 Bacteria 4626
96 Ga0105248_10060273 3300009177 Bacteria 4260
97 Ga0105248_10193284 3300009177 Bacteria 2293
98 Ga0105249_10084639 3300009553 Bacteria 2954
99 Ga0105249_10206966 3300009553 Unclassified 1923
100 Ga0105249_10296626 3300009553 Unclassified 1620
101 Ga0157378_10281061 3300013297 Bacteria 1604
102 Ga0157375_10026326 3300013308 Bacteria 5418
103 Ga0163163_10000003 3300014325 Bacteria 455102
104 Ga0163163_10003465 3300014325 Bacteria 13411
105 Ga0163163_10031989 3300014325 Bacteria 5080
106 Ga0157380_10204845 3300014326 Unclassified 1753
107 Ga0157379_10039806 3300014968 Bacteria 4194
108 Ga0157379_10081999 3300014968 Bacteria 2890
109 Ga0157376_10056891 3300014969 Bacteria 3270
110 Ga0163161_10230918 3300017792 Unclassified 1436
111 Ga0213872_10001935 3300021361 Bacteria 12649
112 Ga0213872_10003680 3300021361 Bacteria 8391
113 Ga0213872_10015598 3300021361 Bacteria 3532
114 Ga0213872_10017183 3300021361 Bacteria 3347
115 Ga0213872_10028088 3300021361 Unclassified 2581
116 Ga0207642_10026565 3300025899 Unclassified 2358
117 Ga0207642_10074627 3300025899 Unclassified 1626
118 Ga0207688_10057731 3300025901 Unclassified 2182
119 Ga0207680_10045508 3300025903 Bacteria 2588
120 Ga0207645_10010059 3300025907 Bacteria 6512
121 Ga0207681_10004451 3300025923 Bacteria 8625
122 Ga0207681_10067032 3300025923 Unclassified 2487
123 Ga0207681_10074431 3300025923 Unclassified 2379
124 Ga0207650_10029677 3300025925 Bacteria 3933
125 Ga0207650_10058339 3300025925 Bacteria 2874
126 Ga0207650_10191348 3300025925 Bacteria 1635
127 Ga0207644_10046226 3300025931 Bacteria 3100
128 Ga0207644_10056248 3300025931 Bacteria 2838
129 Ga0207690_10469779 3300025932 Bacteria 1014
130 Ga0207706_10107212 3300025933 Unclassified 2458
131 Ga0207686_10208022 3300025934 Unclassified 1405
132 Ga0207670_10059955 3300025936 Bacteria 2590
133 Ga0207704_10012052 3300025938 Bacteria 4279
134 Ga0207704_10270835 3300025938 Bacteria 1286
135 Ga0207704_10469687 3300025938 Unclassified 1008
136 Ga0207691_10011214 3300025940 Bacteria 8602
137 Ga0207691_10019801 3300025940 Bacteria 6365
138 Ga0207691_10214000 3300025940 Unclassified 1673
139 Ga0207691_10462109 3300025940 Bacteria 1080
140 Ga0207711_10021677 3300025941 Bacteria 5367
141 Ga0207711_10128686 3300025941 Bacteria 2268
142 Ga0207711_10203482 3300025941 Bacteria 1807
143 Ga0207711_10375749 3300025941 Unclassified 1318
144 Ga0207689_10061782 3300025942 Bacteria 3081
145 Ga0207679_10047326 3300025945 Bacteria 3124
146 Ga0207679_10082728 3300025945 Bacteria 2459
147 Ga0207679_10096541 3300025945 Unclassified 2300
148 Ga0207651_10138009 3300025960 Unclassified 1879
149 Ga0207712_10028888 3300025961 Bacteria 3713
150 Ga0207640_10089365 3300025981 Unclassified 2129
151 Ga0207703_10021052 3300026035 Bacteria 5103
152 Ga0207703_10074685 3300026035 Unclassified 2808
153 Ga0207708_10002992 3300026075 Bacteria 12454
154 Ga0207641_10007056 3300026088 Bacteria 9386
155 Ga0207641_10062982 3300026088 Bacteria 3167
156 Ga0207648_10020850 3300026089 Bacteria 5901
157 Ga0207676_10039353 3300026095 Bacteria 3616
158 Ga0207676_10151200 3300026095 Bacteria 1999
159 Ga0207675_100161888 3300026118 Bacteria 2135
160 Ga0207675_100402847 3300026118 Unclassified 1348
161 Ga0207428_10010503 3300027907 Bacteria 8264
162 Ga0207428_10271746 3300027907 Unclassified 1260
163 Ga0268266_10022716 3300028379 Bacteria 5340
164 Ga0268266_10037289 3300028379 Unclassified 4142
165 Ga0268265_10031843 3300028380 Bacteria 3812
166 Ga0268265_10436080 3300028380 Unclassified 1220
167 Ga0268264_10067033 3300028381 Bacteria 3029
168 Ga0307515_10039446 3300028794 Bacteria 7510
169 Ga0307515_10052764 3300028794 Bacteria 6020
170 Ga0265332_10016327 3300031238 Bacteria 3276
171 Ga0307408_100090596 3300031548 Bacteria 2308
172 Ga0307408_100455195 3300031548 Bacteria 1111
173 Ga0307413_10038119 3300031824 Bacteria 2783
174 Ga0307410_10048587 3300031852 Bacteria 2843
175 Ga0307409_100031106 3300031995 Bacteria 3847
176 Ga0307411_10011909 3300032005 Bacteria 4719
177 Ga0307415_100144382 3300032126 Bacteria 1822
178 Ga0373950_0006514 3300034818 Unclassified 1783
179 Ga0373958_0000202 3300034819 Bacteria 6964
180 Ga0373959_0004197 3300034820 Unclassified 2314
181 Ga0373938_0001985 3300034957 Bacteria 3279
182 Ga0373928_0001197 3300035084 Bacteria 5122
183 Ga0373944_0035030 3300035089 Bacteria 1528
184 Ga0373949_0000128 3300035090 Bacteria 28113
185 Ga0373949_0001655 3300035090 Bacteria 6220
186 Ga0373951_0003315 3300035091 Bacteria 3937
187 Ga0373952_0000640 3300035092 Bacteria 6228
188 Ga0373932_0000276 3300035112 Bacteria 15418
189 Ga0373939_0011242 3300035114 Bacteria 2254
190 Ga0373941_0002201 3300035115 Bacteria 4259
191 Ga0373960_0000104 3300035121 Bacteria 13315
192 Ga0373942_0002796 3300035207 Bacteria 4157
193 Ga0373961_0000930 3300035241 Bacteria 9765
194 Ga0373962_0000987 3300035242 Bacteria 6571
195 Ga0373931_0070438 3300035691 Bacteria 1908
196 Ga0373927_0411867 3300035695 Bacteria 892
197 Ga0373933_0033132 3300035724 Bacteria 3004
198 Ga0373947_0183263 3300035725 Bacteria 1364
199 Ga0373937_0061747 3300036401 Bacteria 3445
200 Ga0373937_0193262 3300036401 Unclassified 1913
201 Ga0373937_0316316 3300036401 Bacteria 1477
202 Ga0373925_0240757 3300037068 Unclassified 1449
203 Ga0436361_0221477 3300039447 Bacteria 18968
204 Ga0436361_0337980 3300039447 Bacteria 5046
205 Ga0436361_0381751 3300039447 Bacteria 11041
206 Ga0436361_0487638 3300039447 Bacteria 8069
207 Ga0436361_0768322 3300039447 Bacteria 1903
208 Ga0451853_2564033 3300041512 Bacteria 1391
209 Ga0451576_0019408 3300045051 Bacteria 7421
210 Ga0466967_0381143 3300045976 Unclassified 1369
211 Ga0495622_0045732 3300046557 Bacteria 2034
212 Ga0496102_0343261 3300048905 Unclassified 1406
213 Ga0496104_0208572 3300048907 Bacteria 1866
214 Ga0496106_0061061 3300048909 Unclassified 2859
215 Ga0496106_0066907 3300048909 Bacteria 2738
216 Ga0496108_0084181 3300048911 Bacteria 2699
217 Ga0496109_0101839 3300048912 Bacteria 2666
218 Ga0496109_0705380 3300048912 Bacteria 946
219 Ga0496112_0036009 3300048915 Bacteria 4824
220 Ga0496113_0400694 3300048916 Archaea 1102
221 Ga0496115_0047930 3300048918 Bacteria 3418
222 Ga0501042_0216711 3300049578 Bacteria 1381
223 Ga0501067_0024843 3300049583 Bacteria 3323
224 Ga0501071_0038960 3300049587 Unclassified 3399
225 Ga0501075_0132238 3300049591 Bacteria 1901
226 nmdc:mga05p37_2556_c2 3300050507 Bacteria 17015
227 nmdc:mga05p37_33024_c1 3300050507 Bacteria 6337
228 nmdc:mga05p37_53781_c1 3300050507 Bacteria 4952
229 nmdc:mga05p37_7398_c1 3300050507 Bacteria 12955
230 nmdc:mga0qj67_112701_c1 3300050509 Unclassified 2196
231 nmdc:mga0qj67_338278_c1 3300050509 Bacteria 1218
232 nmdc:mga0qj67_4195_c1 3300050509 Bacteria 10441
233 nmdc:mga0qj67_46544_c1 3300050509 Unclassified 3425
234 nmdc:mga08y16_122856_c1 3300050511 Bacteria 2702
235 nmdc:mga08y16_17844_c1 3300050511 Bacteria 7475
236 nmdc:mga08y16_200454_c1 3300050511 Unclassified 2068
237 nmdc:mga08y16_225003_c1 3300050511 Bacteria 1941
238 nmdc:mga0n895_123045_c1 3300050512 Unclassified 2616
239 nmdc:mga0n895_57550_c1 3300050512 Unclassified 3832
240 nmdc:mga0n895_72_c1 3300050512 Bacteria 58012
241 nmdc:mga0rr50_10319_c1 3300050513 Bacteria 5922
242 nmdc:mga0rr50_60376_c1 3300050513 Unclassified 2852
243 nmdc:mga0rr50_64082_c1 3300050513 Bacteria 2778
244 nmdc:mga0rr50_749_c1 3300050513 Bacteria 17493
245 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
246 nmdc:mga08x19_229_c1 3300050514 Bacteria 42656
247 nmdc:mga08x19_63022_c1 3300050514 Bacteria 2405
248 nmdc:mga08x19_95026_c1 3300050514 Unclassified 1972
249 nmdc:mga0a205_58797_c1 3300050515 Bacteria 3713
250 Ga0495619_0053016 3300053085 Bacteria 2682
251 Ga0495619_0264097 3300053085 Bacteria 1193
252 Ga0500583_0007750 3300053092 Bacteria 3803
253 Ga0070716_100171406
254 Ga0065712_10001565
255 Ga0070690_100004450
256 Ga0070690_100178648
257 Ga0070670_100006445
258 Ga0070670_100015182
259 Ga0070670_100046596
260 Ga0070670_100186366
261 Ga0068869_100056339
262 Ga0070666_10026869
263 Ga0070666_10082291
264 Ga0070680_100484441
265 Ga0070689_100016458
266 Ga0070689_100030144
267 Ga0070669_100010779
268 Ga0070675_100049430
269 Ga0070675_100062778
270 Ga0070673_100012488
271 Ga0070673_100289939
272 Ga0070667_100017062
273 Ga0070714_100005373
274 Ga0070713_100545770
275 Ga0070700_100064659
276 Ga0070694_100043484
277 Ga0070662_100102111
278 Ga0068867_100067200
279 Ga0070699_100299430
280 Ga0070686_100001954
281 Ga0070665_100002974
282 Ga0070665_100006812
283 Ga0070704_100019035
284 Ga0070664_100136933
285 Ga0070664_100195372
286 Ga0068854_100017597
287 Ga0068854_100032223
288 Ga0070702_100153041
289 Ga0068859_100091205
290 Ga0068859_100551743
291 Ga0068864_100007065
292 Ga0068866_10006804
293 Ga0068863_100003360
294 Ga0068863_100035342
295 Ga0068863_100039571
296 Ga0068863_100094775
297 Ga0068863_100143661
298 Ga0068858_100018546
299 Ga0068858_100074151
300 Ga0068860_100088888
301 Ga0068860_100093628
302 Ga0068862_100032614
303 Ga0068862_100182639
304 Ga0068862_100280096
305 Ga0081455_10040322
306 Ga0097621_100002793
307 Ga0097621_100247005
308 Ga0068871_100022311
309 Ga0068871_100054565
310 Ga0068871_100152898
311 Ga0068871_100180809
312 Ga0075428_100015741
313 Ga0075428_100694148
314 Ga0075430_100012541
315 Ga0075430_100044892
316 Ga0075430_100203285
317 Ga0075431_100221837
318 Ga0075433_10124012
319 Ga0075433_10264389
320 Ga0075434_100000953
321 Ga0075434_100004381
322 Ga0068865_100009626
323 Ga0075436_100000179
324 Ga0075436_100031116
325 Ga0097620_100091206
326 Ga0097620_100551778
327 Ga0075435_100000013
328 Ga0075435_100001460
329 Ga0075435_100016672
330 Ga0075435_100060964
331 Ga0105240_10121517
332 Ga0111539_10025862
333 Ga0111539_10511497
334 Ga0105245_10052254
335 Ga0105247_10008856
336 Ga0114129_10000589
337 Ga0114129_10036882
338 Ga0114129_10064577
339 Ga0114129_10217180
340 Ga0114129_10436159
341 Ga0105243_10096566
342 Ga0105243_10164269
343 Ga0105242_10013033
344 Ga0105248_10001067
345 Ga0105248_10015034
346 Ga0105248_10025919
347 Ga0105248_10051364
348 Ga0105248_10060273
349 Ga0105248_10193284
350 Ga0105249_10084639
351 Ga0105249_10206966
352 Ga0105249_10296626
353 Ga0157378_10281061
354 Ga0157375_10026326
355 Ga0163163_10000003
356 Ga0163163_10003465
357 Ga0163163_10031989
358 Ga0157380_10204845
359 Ga0157379_10039806
360 Ga0157379_10081999
361 Ga0157376_10056891
362 Ga0163161_10230918
363 Ga0213872_10001935
364 Ga0213872_10003680
365 Ga0213872_10015598
366 Ga0213872_10017183
367 Ga0213872_10028088
368 Ga0207642_10026565
369 Ga0207642_10074627
370 Ga0207688_10057731
371 Ga0207680_10045508
372 Ga0207645_10010059
373 Ga0207681_10004451
374 Ga0207681_10067032
375 Ga0207681_10074431
376 Ga0207650_10029677
377 Ga0207650_10058339
378 Ga0207650_10191348
379 Ga0207644_10046226
380 Ga0207644_10056248
381 Ga0207690_10469779
382 Ga0207706_10107212
383 Ga0207686_10208022
384 Ga0207670_10059955
385 Ga0207704_10012052
386 Ga0207704_10270835
387 Ga0207704_10469687
388 Ga0207691_10011214
389 Ga0207691_10019801
390 Ga0207691_10214000
391 Ga0207691_10462109
392 Ga0207711_10021677
393 Ga0207711_10128686
394 Ga0207711_10203482
395 Ga0207711_10375749
396 Ga0207689_10061782
397 Ga0207679_10047326
398 Ga0207679_10082728
399 Ga0207679_10096541
400 Ga0207651_10138009
401 Ga0207712_10028888
402 Ga0207640_10089365
403 Ga0207703_10021052
404 Ga0207703_10074685
405 Ga0207708_10002992
406 Ga0207641_10007056
407 Ga0207641_10062982
408 Ga0207648_10020850
409 Ga0207676_10039353
410 Ga0207676_10151200
411 Ga0207675_100161888
412 Ga0207675_100402847
413 Ga0207428_10010503
414 Ga0207428_10271746
415 Ga0268266_10022716
416 Ga0268266_10037289
417 Ga0268265_10031843
418 Ga0268265_10436080
419 Ga0268264_10067033
420 Ga0307515_10039446
421 Ga0307515_10052764
422 Ga0265332_10016327
423 Ga0307408_100090596
424 Ga0307408_100455195
425 Ga0307413_10038119
426 Ga0307410_10048587
427 Ga0307409_100031106
428 Ga0307411_10011909
429 Ga0307415_100144382
430 Ga0373950_0006514
431 Ga0373958_0000202
432 Ga0373959_0004197
433 Ga0373938_0001985
434 Ga0373928_0001197
435 Ga0373944_0035030
436 Ga0373949_0000128
437 Ga0373949_0001655
438 Ga0373951_0003315
439 Ga0373952_0000640
440 Ga0373932_0000276
441 Ga0373939_0011242
442 Ga0373941_0002201
443 Ga0373960_0000104
444 Ga0373942_0002796
445 Ga0373961_0000930
446 Ga0373962_0000987
447 Ga0373931_0070438
448 Ga0373927_0411867
449 Ga0373933_0033132
450 Ga0373947_0183263
451 Ga0373937_0061747
452 Ga0373937_0193262
453 Ga0373937_0316316
454 Ga0373925_0240757
455 Ga0436361_0221477
456 Ga0436361_0337980
457 Ga0436361_0381751
458 Ga0436361_0487638
459 Ga0436361_0768322
460 Ga0451853_2564033
461 Ga0451576_0019408
462 Ga0466967_0381143
463 Ga0495622_0045732
464 Ga0496102_0343261
465 Ga0496104_0208572
466 Ga0496106_0061061
467 Ga0496106_0066907
468 Ga0496108_0084181
469 Ga0496109_0101839
470 Ga0496109_0705380
471 Ga0496112_0036009
472 Ga0496113_0400694
473 Ga0496115_0047930
474 Ga0501042_0216711
475 Ga0501067_0024843
476 Ga0501071_0038960
477 Ga0501075_0132238
478 nmdc:mga05p37_2556_c2
479 nmdc:mga05p37_33024_c1
480 nmdc:mga05p37_53781_c1
481 nmdc:mga05p37_7398_c1
482 nmdc:mga0qj67_112701_c1
483 nmdc:mga0qj67_338278_c1
484 nmdc:mga0qj67_4195_c1
485 nmdc:mga0qj67_46544_c1
486 nmdc:mga08y16_122856_c1
487 nmdc:mga08y16_17844_c1
488 nmdc:mga08y16_200454_c1
489 nmdc:mga08y16_225003_c1
490 nmdc:mga0n895_123045_c1
491 nmdc:mga0n895_57550_c1
492 nmdc:mga0n895_72_c1
493 nmdc:mga0rr50_10319_c1
494 nmdc:mga0rr50_60376_c1
495 nmdc:mga0rr50_64082_c1
496 nmdc:mga0rr50_749_c1
497 nmdc:mga0rr50_9_c1
498 nmdc:mga08x19_229_c1
499 nmdc:mga08x19_63022_c1
500 nmdc:mga08x19_95026_c1
501 nmdc:mga0a205_58797_c1
502 Ga0495619_0053016
503 Ga0495619_0264097
504 Ga0500583_0007750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

66

239

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.8966 7 236
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8895 4 237
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.8884 7 236
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.879 4 237
3lbf-assembly3.cif.gz_C crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.8745 8 236
ID Description Score Start End Superfamily
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9584 99 152 3.40.50.150
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.901 92 173 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8966 7 236 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8884 7 236 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8857 92 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W1I147-F1-model_v4 FkbM family methyltransferase 0.9782 96 153 GO:0008168
GO:0032259
AF-A0A1Z9P9V5-F1-model_v4 deleted 0.9744 98 151
AF-A0A535BK28-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9672 4 137 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A2N3Q1E0-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9585 5 285 GO:0000179
GO:0004719
GO:0005737
GO:0036211
AF-A0A2S6N6S4-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.956 5 283 GO:0004719
GO:0005737
GO:0032259
GO:0036211

Map