F363008
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 152 | 252 | 533 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100175924|Ga0070673_1001759241 |
| Length | 576 |
| Sequence | MSVTFTSRRSPSQYILHRSIKLPAHKCLPNRSCSCYTTGMEKDTQAQARRDAERTTQHRAQVLGLPYIDTAALSSKPLFREILPLEEMYKVRIIPISADQSKIVFGITTTTSQQAMNEIRQRYADRLVSFAIISDVGFKEYMRLYDPPKQVVYQDIAFSNDSNSNLFQQVSKTLGEVRSDDILAYLVKQAYNLKASDIHLENQAEGVRIRFRVDGVLHPIAHLSREKYHQLLSSIAVAANVSTGGTDAETGHINKTYKMATGEDVNVNLRVETVPTVFGEDVVMRLFTLKMELLKLDNLSLSESERAVVDDVISHPTGMVLVVGPTGSGKTTTLYSILNTLNSDERKLLTLEDPVEYFMPGVVQIPVEGDQNARGFAERLRAVLRLDPDIVMVGEIRDQDTAKTALQAALTGHLVLSTFHASNASAALTRMLDFIGINPLFASAVHLIMAQRLVRRLDPETRQPYQPDEGLKAQLQAVIDTLPPGVPRPDLNQVTLYKPGSSDKNPFGYVGQMPIREQMQMTPGIQQILKLPPNQITTDMIEQKAIEEGMRTMLQDGILKAIEGITTIEEVYRVVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 108 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 123 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 124 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 125 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 126 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 127 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 128 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 131 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 132 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 133 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 135 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 136 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 137 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 138 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 139 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 140 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 141 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 142 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 143 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 144 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 145 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 146 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 147 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 148 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 149 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 150 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 151 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 152 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.83 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 76.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000559 | 3300001915 | Bacteria | 11369 |
| 2 | JGI24737J22298_10000228 | 3300001990 | Bacteria | 18575 |
| 3 | JGI24735J21928_10000227 | 3300002067 | Bacteria | 19785 |
| 4 | JGI24742J22300_10000011 | 3300002244 | Bacteria | 31137 |
| 5 | rootH1_10116708 | 3300003323 | Bacteria | 9089 |
| 6 | rootH1_10189042 | 3300003323 | Bacteria | 5626 |
| 7 | Ga0065704_10113903 | 3300005289 | Bacteria | 1902 |
| 8 | Ga0070658_10000012 | 3300005327 | Bacteria | 277871 |
| 9 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 10 | Ga0070658_10000491 | 3300005327 | Bacteria | 34335 |
| 11 | Ga0070658_10002596 | 3300005327 | Bacteria | 15044 |
| 12 | Ga0070658_10032861 | 3300005327 | Bacteria | 4172 |
| 13 | Ga0070658_10041091 | 3300005327 | Bacteria | 3731 |
| 14 | Ga0070676_10001822 | 3300005328 | Bacteria | 10833 |
| 15 | Ga0070676_10038762 | 3300005328 | Unclassified | 2753 |
| 16 | Ga0070683_100000657 | 3300005329 | Bacteria | 25014 |
| 17 | Ga0070690_100003368 | 3300005330 | Bacteria | 8725 |
| 18 | Ga0070666_10032186 | 3300005335 | Bacteria | 3463 |
| 19 | Ga0070680_100024901 | 3300005336 | Unclassified | 4783 |
| 20 | Ga0070660_100000835 | 3300005339 | Bacteria | 20500 |
| 21 | Ga0070660_100001769 | 3300005339 | Bacteria | 14834 |
| 22 | Ga0070660_100030056 | 3300005339 | Unclassified | 4074 |
| 23 | Ga0070691_10001833 | 3300005341 | Bacteria | 9262 |
| 24 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 25 | Ga0070674_100022246 | 3300005356 | Unclassified | 4087 |
| 26 | Ga0070673_100001360 | 3300005364 | Bacteria | 14303 |
| 27 | Ga0070673_100175924 | 3300005364 | Bacteria | 1829 |
| 28 | Ga0070659_100000558 | 3300005366 | Bacteria | 27295 |
| 29 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 30 | Ga0070667_100013945 | 3300005367 | Bacteria | 6644 |
| 31 | Ga0070678_100000234 | 3300005456 | Bacteria | 25286 |
| 32 | Ga0070681_10003950 | 3300005458 | Bacteria | 13972 |
| 33 | Ga0070681_10135090 | 3300005458 | Bacteria | 2397 |
| 34 | Ga0070685_10001561 | 3300005466 | Bacteria | 12067 |
| 35 | Ga0070679_100000652 | 3300005530 | Bacteria | 29531 |
| 36 | Ga0070679_100004498 | 3300005530 | Bacteria | 12880 |
| 37 | Ga0070679_100006231 | 3300005530 | Bacteria | 11110 |
| 38 | Ga0070679_100021794 | 3300005530 | Bacteria | 6258 |
| 39 | Ga0070684_100001437 | 3300005535 | Bacteria | 17157 |
| 40 | Ga0070684_100003619 | 3300005535 | Bacteria | 11635 |
| 41 | Ga0070672_100005074 | 3300005543 | Bacteria | 8687 |
| 42 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 43 | Ga0068855_100000211 | 3300005563 | Bacteria | 74558 |
| 44 | Ga0068855_100053150 | 3300005563 | Bacteria | 4767 |
| 45 | Ga0068857_100000002 | 3300005577 | Bacteria | 241401 |
| 46 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 47 | Ga0068856_100000866 | 3300005614 | Bacteria | 32413 |
| 48 | Ga0068856_100008801 | 3300005614 | Bacteria | 9824 |
| 49 | Ga0068856_100046085 | 3300005614 | Bacteria | 4295 |
| 50 | Ga0068863_100145252 | 3300005841 | Bacteria | 2268 |
| 51 | Ga0068860_100005217 | 3300005843 | Bacteria | 13193 |
| 52 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 53 | Ga0081539_10041518 | 3300005985 | Bacteria | 2687 |
| 54 | Ga0075365_10012114 | 3300006038 | Bacteria | 5105 |
| 55 | Ga0075368_10000191 | 3300006042 | Bacteria | 16758 |
| 56 | Ga0075364_10000866 | 3300006051 | Bacteria | 15976 |
| 57 | Ga0075364_10014195 | 3300006051 | Unclassified | 4917 |
| 58 | Ga0075362_10000303 | 3300006177 | Bacteria | 13912 |
| 59 | Ga0075367_10000188 | 3300006178 | Bacteria | 20290 |
| 60 | Ga0075367_10001863 | 3300006178 | Bacteria | 9314 |
| 61 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 62 | Ga0075366_10000372 | 3300006195 | Bacteria | 20821 |
| 63 | Ga0097621_100000370 | 3300006237 | Bacteria | 31223 |
| 64 | Ga0068871_100000156 | 3300006358 | Bacteria | 45103 |
| 65 | Ga0075428_100095603 | 3300006844 | Bacteria | 3239 |
| 66 | Ga0075430_100117852 | 3300006846 | Bacteria | 2213 |
| 67 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 68 | Ga0105240_10003943 | 3300009093 | Bacteria | 22929 |
| 69 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 70 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 71 | Ga0105245_10001190 | 3300009098 | Bacteria | 23565 |
| 72 | Ga0105245_10001369 | 3300009098 | Bacteria | 22074 |
| 73 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 74 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 75 | Ga0105241_10002073 | 3300009174 | Bacteria | 15150 |
| 76 | Ga0105241_10024499 | 3300009174 | Bacteria | 4481 |
| 77 | Ga0105242_10000135 | 3300009176 | Bacteria | 53544 |
| 78 | Ga0105242_10035606 | 3300009176 | Unclassified | 3991 |
| 79 | Ga0105248_10055586 | 3300009177 | Bacteria | 4441 |
| 80 | Ga0105237_10041073 | 3300009545 | Bacteria | 4665 |
| 81 | Ga0105238_10069328 | 3300009551 | Bacteria | 3527 |
| 82 | Ga0105249_10000802 | 3300009553 | Bacteria | 28271 |
| 83 | Ga0105239_10014654 | 3300010375 | Bacteria | 8694 |
| 84 | Ga0105239_10217785 | 3300010375 | Bacteria | 2141 |
| 85 | Ga0157373_10000042 | 3300013100 | Bacteria | 113564 |
| 86 | Ga0157369_10003103 | 3300013105 | Bacteria | 19847 |
| 87 | Ga0157369_10016700 | 3300013105 | Bacteria | 8251 |
| 88 | Ga0157369_10114116 | 3300013105 | Bacteria | 2869 |
| 89 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 90 | Ga0157374_10000195 | 3300013296 | Bacteria | 56142 |
| 91 | Ga0157374_10002313 | 3300013296 | Bacteria | 16059 |
| 92 | Ga0157374_10007870 | 3300013296 | Bacteria | 9099 |
| 93 | Ga0157378_10016124 | 3300013297 | Bacteria | 6543 |
| 94 | Ga0157372_10032188 | 3300013307 | Bacteria | 5748 |
| 95 | Ga0163163_10079688 | 3300014325 | Unclassified | 3273 |
| 96 | Ga0157377_10025959 | 3300014745 | Bacteria | 3129 |
| 97 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 98 | Ga0207680_10021780 | 3300025903 | Bacteria | 3474 |
| 99 | Ga0207645_10001792 | 3300025907 | Bacteria | 17339 |
| 100 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 101 | Ga0207705_10000056 | 3300025909 | Bacteria | 157554 |
| 102 | Ga0207705_10001105 | 3300025909 | Bacteria | 21924 |
| 103 | Ga0207705_10001854 | 3300025909 | Bacteria | 16602 |
| 104 | Ga0207705_10021205 | 3300025909 | Bacteria | 4634 |
| 105 | Ga0207705_10033441 | 3300025909 | Bacteria | 3673 |
| 106 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 107 | Ga0207654_10003824 | 3300025911 | Bacteria | 7590 |
| 108 | Ga0207707_10005833 | 3300025912 | Bacteria | 10761 |
| 109 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 110 | Ga0207695_10015645 | 3300025913 | Bacteria | 8922 |
| 111 | Ga0207660_10001351 | 3300025917 | Bacteria | 16443 |
| 112 | Ga0207660_10166707 | 3300025917 | Bacteria | 1703 |
| 113 | Ga0207657_10004283 | 3300025919 | Bacteria | 15119 |
| 114 | Ga0207657_10007630 | 3300025919 | Bacteria | 11073 |
| 115 | Ga0207657_10038163 | 3300025919 | Bacteria | 4280 |
| 116 | Ga0207652_10001980 | 3300025921 | Bacteria | 17726 |
| 117 | Ga0207652_10005637 | 3300025921 | Bacteria | 10158 |
| 118 | Ga0207652_10011519 | 3300025921 | Bacteria | 7131 |
| 119 | Ga0207652_10030767 | 3300025921 | Bacteria | 4498 |
| 120 | Ga0207652_10044184 | 3300025921 | Bacteria | 3795 |
| 121 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 122 | Ga0207687_10000030 | 3300025927 | Bacteria | 155548 |
| 123 | Ga0207687_10001069 | 3300025927 | Bacteria | 18570 |
| 124 | Ga0207687_10023453 | 3300025927 | Bacteria | 4113 |
| 125 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 126 | Ga0207690_10007132 | 3300025932 | Bacteria | 6639 |
| 127 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 128 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 129 | Ga0207691_10022874 | 3300025940 | Bacteria | 5892 |
| 130 | Ga0207661_10000021 | 3300025944 | Bacteria | 205381 |
| 131 | Ga0207661_10001361 | 3300025944 | Bacteria | 16380 |
| 132 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 133 | Ga0207667_10000466 | 3300025949 | Bacteria | 54272 |
| 134 | Ga0207667_10015676 | 3300025949 | Bacteria | 8596 |
| 135 | Ga0207667_10059320 | 3300025949 | Bacteria | 4008 |
| 136 | Ga0207667_10063293 | 3300025949 | Bacteria | 3865 |
| 137 | Ga0207651_10000191 | 3300025960 | Bacteria | 26637 |
| 138 | Ga0207651_10146270 | 3300025960 | Bacteria | 1833 |
| 139 | Ga0207712_10006986 | 3300025961 | Bacteria | 7120 |
| 140 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 141 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 142 | Ga0207702_10006320 | 3300026078 | Bacteria | 10235 |
| 143 | Ga0207702_10014456 | 3300026078 | Bacteria | 6554 |
| 144 | Ga0207648_10213787 | 3300026089 | Bacteria | 1712 |
| 145 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 146 | Ga0207683_10015104 | 3300026121 | Bacteria | 6571 |
| 147 | Ga0207683_10018388 | 3300026121 | Bacteria | 5963 |
| 148 | Ga0209998_10005866 | 3300027717 | Bacteria | 2555 |
| 149 | Ga0209813_10000004 | 3300027866 | Bacteria | 139340 |
| 150 | Ga0207428_10006981 | 3300027907 | Bacteria | 10343 |
| 151 | Ga0268266_10001545 | 3300028379 | Bacteria | 26966 |
| 152 | Ga0265326_10000683 | 3300028558 | Bacteria | 12587 |
| 153 | Ga0265326_10011203 | 3300028558 | Bacteria | 2646 |
| 154 | Ga0265334_10000049 | 3300028573 | Bacteria | 89091 |
| 155 | Ga0265334_10000184 | 3300028573 | Bacteria | 36597 |
| 156 | Ga0265334_10017099 | 3300028573 | Bacteria | 3000 |
| 157 | Ga0265318_10008117 | 3300028577 | Bacteria | 4693 |
| 158 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 159 | Ga0265338_10000192 | 3300028800 | Bacteria | 115195 |
| 160 | Ga0265338_10000601 | 3300028800 | Bacteria | 63282 |
| 161 | Ga0265338_10122433 | 3300028800 | Bacteria | 2070 |
| 162 | Ga0265320_10037935 | 3300031240 | Bacteria | 2423 |
| 163 | Ga0265340_10000077 | 3300031247 | Bacteria | 47065 |
| 164 | Ga0265327_10004018 | 3300031251 | Bacteria | 13393 |
| 165 | Ga0265327_10006648 | 3300031251 | Bacteria | 9181 |
| 166 | Ga0265327_10012154 | 3300031251 | Bacteria | 5841 |
| 167 | Ga0265316_10029572 | 3300031344 | Bacteria | 4502 |
| 168 | Ga0395899_0005886 | 3300037312 | Bacteria | 9515 |
| 169 | Ga0395900_0000232 | 3300037418 | Bacteria | 87268 |
| 170 | Ga0395900_0004371 | 3300037418 | Bacteria | 14994 |
| 171 | Ga0395900_0011364 | 3300037418 | Bacteria | 9108 |
| 172 | Ga0395900_0012595 | 3300037418 | Bacteria | 8653 |
| 173 | Ga0395900_0164307 | 3300037418 | Bacteria | 2263 |
| 174 | Ga0395898_0016807 | 3300037466 | Bacteria | 7475 |
| 175 | Ga0395898_0018336 | 3300037466 | Bacteria | 7137 |
| 176 | Ga0395905_0000238 | 3300037471 | Bacteria | 83164 |
| 177 | Ga0395905_0004532 | 3300037471 | Bacteria | 14388 |
| 178 | Ga0395905_0181936 | 3300037471 | Bacteria | 1973 |
| 179 | Ga0395901_0000680 | 3300038443 | Bacteria | 39129 |
| 180 | Ga0395901_0006077 | 3300038443 | Bacteria | 12237 |
| 181 | Ga0495622_0000082 | 3300046557 | Bacteria | 85266 |
| 182 | Ga0495588_0000116 | 3300046674 | Bacteria | 135919 |
| 183 | Ga0495658_0001953 | 3300046683 | Bacteria | 10540 |
| 184 | Ga0495649_0000284 | 3300046694 | Bacteria | 44736 |
| 185 | Ga0495672_0000129 | 3300047320 | Bacteria | 112879 |
| 186 | Ga0496112_0023282 | 3300048915 | Bacteria | 5915 |
| 187 | Ga0501031_0000446 | 3300049568 | Bacteria | 23856 |
| 188 | Ga0501032_0021993 | 3300049569 | Bacteria | 4427 |
| 189 | Ga0501034_0002719 | 3300049571 | Bacteria | 20818 |
| 190 | Ga0501034_0033532 | 3300049571 | Bacteria | 5208 |
| 191 | Ga0501036_0002986 | 3300049572 | Bacteria | 13446 |
| 192 | Ga0501037_0000121 | 3300049573 | Bacteria | 72862 |
| 193 | Ga0501038_0007638 | 3300049574 | Bacteria | 9972 |
| 194 | Ga0501043_0002262 | 3300049579 | Bacteria | 16380 |
| 195 | Ga0501046_0000922 | 3300049580 | Bacteria | 28825 |
| 196 | Ga0501047_0000229 | 3300049581 | Bacteria | 66412 |
| 197 | Ga0501047_0003170 | 3300049581 | Bacteria | 15588 |
| 198 | Ga0501048_0002409 | 3300049582 | Bacteria | 14272 |
| 199 | Ga0501070_0153717 | 3300049586 | Bacteria | 1898 |
| 200 | Ga0501073_0080084 | 3300049589 | Bacteria | 2273 |
| 201 | Ga0501035_0000033 | 3300049822 | Bacteria | 175087 |
| 202 | Ga0501035_0000801 | 3300049822 | Bacteria | 33495 |
| 203 | Ga0501044_0043314 | 3300049823 | Bacteria | 4677 |
| 204 | Ga0501044_0048773 | 3300049823 | Bacteria | 4373 |
| 205 | nmdc:mga03683_20_c2 | 3300050489 | Bacteria | 23288 |
| 206 | nmdc:mga00v17_515_c1 | 3300050491 | Bacteria | 21654 |
| 207 | nmdc:mga00v17_52518_c1 | 3300050491 | Bacteria | 2480 |
| 208 | nmdc:mga00v17_666_c2 | 3300050491 | Bacteria | 16020 |
| 209 | nmdc:mga0k408_17_c2 | 3300050493 | Bacteria | 97852 |
| 210 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 211 | nmdc:mga06z11_44_c1 | 3300050494 | Bacteria | 47967 |
| 212 | nmdc:mga06z11_6_c1 | 3300050494 | Bacteria | 124054 |
| 213 | nmdc:mga04h51_4_c1 | 3300050495 | Bacteria | 139342 |
| 214 | nmdc:mga07m45_44982_c1 | 3300050496 | Bacteria | 2478 |
| 215 | nmdc:mga0qj67_10614_c1 | 3300050509 | Bacteria | 6880 |
| 216 | nmdc:mga0qj67_111447_c1 | 3300050509 | Bacteria | 2209 |
| 217 | nmdc:mga08y16_1132_c1 | 3300050511 | Bacteria | 26248 |
| 218 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 219 | nmdc:mga0sz30_23_c1 | 3300050516 | Bacteria | 65683 |
| 220 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 221 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 222 | Ga0500643_000038 | 3300053087 | Bacteria | 178974 |
| 223 | Ga0500643_003390 | 3300053087 | Bacteria | 7705 |
| 224 | Ga0500644_0000006 | 3300053088 | Bacteria | 143304 |
| 225 | Ga0500644_0000480 | 3300053088 | Bacteria | 17568 |
| 226 | Ga0500644_0003341 | 3300053088 | Bacteria | 3968 |
| 227 | Ga0500646_0002335 | 3300053090 | Bacteria | 4934 |
| 228 | Ga0500583_0002166 | 3300053092 | Bacteria | 5834 |
| 229 | Ga0500651_0000045 | 3300053093 | Bacteria | 85481 |
| 230 | Ga0500651_0015284 | 3300053093 | Bacteria | 4710 |
| 231 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 232 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 233 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 234 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 235 | Ga0500556_0000295 | 3300053104 | Bacteria | 38375 |
| 236 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 237 | Ga0500562_003053 | 3300053108 | Bacteria | 4184 |
| 238 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 239 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 240 | Ga0500594_0000196 | 3300053118 | Bacteria | 15125 |
| 241 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 242 | Ga0500614_000647 | 3300053123 | Bacteria | 8893 |
| 243 | Ga0500628_000012 | 3300053129 | Bacteria | 106556 |
| 244 | Ga0500652_000020 | 3300053131 | Bacteria | 119198 |
| 245 | Ga0500655_000437 | 3300053133 | Bacteria | 8566 |
| 246 | Ga0500655_005766 | 3300053133 | Bacteria | 2229 |
| 247 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 248 | Ga0500577_0001573 | 3300053142 | Bacteria | 5837 |
| 249 | Ga0500589_000016 | 3300053147 | Bacteria | 107090 |
| 250 | Ga0500589_012636 | 3300053147 | Bacteria | 3701 |
| 251 | Ga0500649_000013 | 3300053722 | Bacteria | 73694 |
| 252 | Ga0500570_000005 | 3300053724 | Bacteria | 132994 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10217785 | Ga0105239_102177852 | 435 |
| 2 | 3300050509 | nmdc:mga0qj67_111447_c1 | nmdc:mga0qj67_111447_c1_33_1571 | 491 |
| 3 | 3300037471 | Ga0395905_0181936 | Ga0395905_0181936_20_1513 | 495 |
| 4 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_111881_113488 | 496 |
| 5 | 3300053088 | Ga0500644_0000006 | Ga0500644_0000006_127146_128753 | 496 |
| 6 | 3300005535 | Ga0070684_100001437 | Ga0070684_10000143714 | 500 |
| 7 | 3300025944 | Ga0207661_10000021 | Ga0207661_1000002199 | 500 |
| 8 | 3300053087 | Ga0500643_003390 | Ga0500643_003390_4836_6443 | 503 |
| 9 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_528950_530557 | 503 |
| 10 | 3300053131 | Ga0500652_000020 | Ga0500652_000020_17005_18612 | 503 |
| 11 | 3300050496 | nmdc:mga07m45_44982_c1 | nmdc:mga07m45_44982_c1_926_2440 | 504 |
| 12 | 3300037418 | Ga0395900_0004371 | Ga0395900_0004371_6787_8331 | 512 |
| 13 | 3300038443 | Ga0395901_0006077 | Ga0395901_0006077_3272_4816 | 512 |
| 14 | 3300013105 | Ga0157369_10114116 | Ga0157369_101141163 | 514 |
| 15 | 3300025949 | Ga0207667_10059320 | Ga0207667_100593203 | 517 |
| 16 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001384 | 522 |
| 17 | 3300025927 | Ga0207687_10000030 | Ga0207687_1000003055 | 522 |
| 18 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001440 | 523 |
| 19 | 3300009174 | Ga0105241_10002073 | Ga0105241_1000207310 | 523 |
| 20 | 3300025911 | Ga0207654_10003824 | Ga0207654_100038244 | 523 |
| 21 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_672091_673692 | 523 |
| 22 | 3300050516 | nmdc:mga0sz30_23_c1 | nmdc:mga0sz30_23_c1_19638_21239 | 523 |
| 23 | 3300006177 | Ga0075362_10000303 | Ga0075362_1000030310 | 525 |
| 24 | 3300049568 | Ga0501031_0000446 | Ga0501031_0000446_20971_22587 | 525 |
| 25 | 3300049569 | Ga0501032_0021993 | Ga0501032_0021993_1216_2832 | 525 |
| 26 | 3300049571 | Ga0501034_0033532 | Ga0501034_0033532_3536_5152 | 525 |
| 27 | 3300049572 | Ga0501036_0002986 | Ga0501036_0002986_1829_3445 | 525 |
| 28 | 3300049573 | Ga0501037_0000121 | Ga0501037_0000121_66192_67808 | 525 |
| 29 | 3300049574 | Ga0501038_0007638 | Ga0501038_0007638_3631_5247 | 525 |
| 30 | 3300049579 | Ga0501043_0002262 | Ga0501043_0002262_2041_3657 | 525 |
| 31 | 3300049580 | Ga0501046_0000922 | Ga0501046_0000922_16472_18088 | 525 |
| 32 | 3300049581 | Ga0501047_0003170 | Ga0501047_0003170_6561_8177 | 525 |
| 33 | 3300049582 | Ga0501048_0002409 | Ga0501048_0002409_7240_8856 | 525 |
| 34 | 3300049586 | Ga0501070_0153717 | Ga0501070_0153717_108_1724 | 525 |
| 35 | 3300049589 | Ga0501073_0080084 | Ga0501073_0080084_245_1861 | 525 |
| 36 | 3300049822 | Ga0501035_0000801 | Ga0501035_0000801_25566_27182 | 525 |
| 37 | 3300049823 | Ga0501044_0043314 | Ga0501044_0043314_598_2214 | 525 |
| 38 | 3300050489 | nmdc:mga03683_20_c2 | nmdc:mga03683_20_c2_10555_12159 | 525 |
| 39 | 3300046674 | Ga0495588_0000116 | Ga0495588_0000116_88370_89977 | 526 |
| 40 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_286948_288555 | 526 |
| 41 | 3300053722 | Ga0500649_000013 | Ga0500649_000013_34980_36587 | 526 |
| 42 | 3300009177 | Ga0105248_10055586 | Ga0105248_100555863 | 530 |
| 43 | 3300005289 | Ga0065704_10113903 | Ga0065704_101139031 | 532 |
| 44 | 3300005327 | Ga0070658_10000491 | Ga0070658_1000049116 | 532 |
| 45 | 3300005327 | Ga0070658_10032861 | Ga0070658_100328614 | 532 |
| 46 | 3300005330 | Ga0070690_100003368 | Ga0070690_1000033689 | 532 |
| 47 | 3300005339 | Ga0070660_100000835 | Ga0070660_10000083511 | 532 |
| 48 | 3300005341 | Ga0070691_10001833 | Ga0070691_100018333 | 532 |
| 49 | 3300005366 | Ga0070659_100000558 | Ga0070659_10000055810 | 532 |
| 50 | 3300005530 | Ga0070679_100006231 | Ga0070679_1000062312 | 532 |
| 51 | 3300005563 | Ga0068855_100000211 | Ga0068855_1000002118 | 532 |
| 52 | 3300005577 | Ga0068857_100000002 | Ga0068857_10000000237 | 532 |
| 53 | 3300005614 | Ga0068856_100000001 | Ga0068856_100000001233 | 532 |
| 54 | 3300005614 | Ga0068856_100008801 | Ga0068856_1000088015 | 532 |
| 55 | 3300005985 | Ga0081539_10041518 | Ga0081539_100415182 | 532 |
| 56 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003794 | 532 |
| 57 | 3300009098 | Ga0105245_10001190 | Ga0105245_1000119015 | 532 |
| 58 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001498 | 532 |
| 59 | 3300009176 | Ga0105242_10000135 | Ga0105242_1000013548 | 532 |
| 60 | 3300009545 | Ga0105237_10041073 | Ga0105237_100410732 | 532 |
| 61 | 3300013296 | Ga0157374_10000195 | Ga0157374_1000019535 | 532 |
| 62 | 3300014745 | Ga0157377_10025959 | Ga0157377_100259592 | 532 |
| 63 | 3300025909 | Ga0207705_10001105 | Ga0207705_100011053 | 532 |
| 64 | 3300025909 | Ga0207705_10021205 | Ga0207705_100212054 | 532 |
| 65 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005804 | 532 |
| 66 | 3300025917 | Ga0207660_10166707 | Ga0207660_101667071 | 532 |
| 67 | 3300025919 | Ga0207657_10007630 | Ga0207657_100076309 | 532 |
| 68 | 3300025921 | Ga0207652_10011519 | Ga0207652_100115194 | 532 |
| 69 | 3300025927 | Ga0207687_10001069 | Ga0207687_1000106911 | 532 |
| 70 | 3300025932 | Ga0207690_10007132 | Ga0207690_100071324 | 532 |
| 71 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001645 | 532 |
| 72 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002763 | 532 |
| 73 | 3300025949 | Ga0207667_10000466 | Ga0207667_1000046627 | 532 |
| 74 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001782 | 532 |
| 75 | 3300026089 | Ga0207648_10213787 | Ga0207648_102137871 | 532 |
| 76 | 3300026116 | Ga0207674_10000001 | Ga0207674_10000001461 | 532 |
| 77 | 3300028558 | Ga0265326_10000683 | Ga0265326_100006837 | 532 |
| 78 | 3300028558 | Ga0265326_10011203 | Ga0265326_100112032 | 532 |
| 79 | 3300028573 | Ga0265334_10000049 | Ga0265334_1000004962 | 532 |
| 80 | 3300028577 | Ga0265318_10008117 | Ga0265318_100081172 | 532 |
| 81 | 3300028800 | Ga0265338_10000003 | Ga0265338_10000003456 | 532 |
| 82 | 3300031251 | Ga0265327_10006648 | Ga0265327_100066487 | 532 |
| 83 | 3300031251 | Ga0265327_10012154 | Ga0265327_100121544 | 532 |
| 84 | 3300031344 | Ga0265316_10029572 | Ga0265316_100295725 | 532 |
| 85 | 3300050493 | nmdc:mga0k408_17_c2 | nmdc:mga0k408_17_c2_38183_39796 | 532 |
| 86 | 3300053724 | Ga0500570_000005 | Ga0500570_000005_62633_64243 | 532 |
| 87 | 3300001915 | JGI24741J21665_1000559 | JGI24741J21665_10005594 | 533 |
| 88 | 3300001990 | JGI24737J22298_10000228 | JGI24737J22298_1000022812 | 533 |
| 89 | 3300002067 | JGI24735J21928_10000227 | JGI24735J21928_100002275 | 533 |
| 90 | 3300002244 | JGI24742J22300_10000011 | JGI24742J22300_1000001114 | 533 |
| 91 | 3300003323 | rootH1_10116708 | rootH1_1011670810 | 533 |
| 92 | 3300003323 | rootH1_10189042 | rootH1_101890421 | 533 |
| 93 | 3300005327 | Ga0070658_10000012 | Ga0070658_10000012303 | 533 |
| 94 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001575 | 533 |
| 95 | 3300005327 | Ga0070658_10002596 | Ga0070658_100025969 | 533 |
| 96 | 3300005327 | Ga0070658_10041091 | Ga0070658_100410912 | 533 |
| 97 | 3300005328 | Ga0070676_10001822 | Ga0070676_100018228 | 533 |
| 98 | 3300005328 | Ga0070676_10038762 | Ga0070676_100387622 | 533 |
| 99 | 3300005329 | Ga0070683_100000657 | Ga0070683_1000006575 | 533 |
| 100 | 3300005335 | Ga0070666_10032186 | Ga0070666_100321863 | 533 |
| 101 | 3300005336 | Ga0070680_100024901 | Ga0070680_1000249018 | 533 |
| 102 | 3300005339 | Ga0070660_100001769 | Ga0070660_10000176910 | 533 |
| 103 | 3300005339 | Ga0070660_100030056 | Ga0070660_1000300564 | 533 |
| 104 | 3300005355 | Ga0070671_100000001 | Ga0070671_100000001517 | 533 |
| 105 | 3300005356 | Ga0070674_100022246 | Ga0070674_1000222462 | 533 |
| 106 | 3300005364 | Ga0070673_100001360 | Ga0070673_1000013604 | 533 |
| 107 | 3300005364 | Ga0070673_100175924 | Ga0070673_1001759241 | 533 |
| 108 | 3300005367 | Ga0070667_100000001 | Ga0070667_100000001751 | 533 |
| 109 | 3300005367 | Ga0070667_100013945 | Ga0070667_1000139453 | 533 |
| 110 | 3300005456 | Ga0070678_100000234 | Ga0070678_1000002345 | 533 |
| 111 | 3300005458 | Ga0070681_10003950 | Ga0070681_100039505 | 533 |
| 112 | 3300005458 | Ga0070681_10135090 | Ga0070681_101350902 | 533 |
| 113 | 3300005466 | Ga0070685_10001561 | Ga0070685_100015618 | 533 |
| 114 | 3300005530 | Ga0070679_100000652 | Ga0070679_10000065230 | 533 |
| 115 | 3300005530 | Ga0070679_100004498 | Ga0070679_1000044989 | 533 |
| 116 | 3300005530 | Ga0070679_100021794 | Ga0070679_1000217943 | 533 |
| 117 | 3300005535 | Ga0070684_100003619 | Ga0070684_1000036197 | 533 |
| 118 | 3300005543 | Ga0070672_100005074 | Ga0070672_1000050743 | 533 |
| 119 | 3300005563 | Ga0068855_100000003 | Ga0068855_10000000387 | 533 |
| 120 | 3300005563 | Ga0068855_100053150 | Ga0068855_1000531502 | 533 |
| 121 | 3300005614 | Ga0068856_100000866 | Ga0068856_1000008662 | 533 |
| 122 | 3300005614 | Ga0068856_100046085 | Ga0068856_1000460852 | 533 |
| 123 | 3300005841 | Ga0068863_100145252 | Ga0068863_1001452521 | 533 |
| 124 | 3300005843 | Ga0068860_100005217 | Ga0068860_1000052178 | 533 |
| 125 | 3300005937 | Ga0081455_10000003 | Ga0081455_10000003340 | 533 |
| 126 | 3300006038 | Ga0075365_10012114 | Ga0075365_100121142 | 533 |
| 127 | 3300006042 | Ga0075368_10000191 | Ga0075368_100001917 | 533 |
| 128 | 3300006051 | Ga0075364_10000866 | Ga0075364_1000086612 | 533 |
| 129 | 3300006051 | Ga0075364_10014195 | Ga0075364_100141955 | 533 |
| 130 | 3300006178 | Ga0075367_10000188 | Ga0075367_1000018811 | 533 |
| 131 | 3300006178 | Ga0075367_10001863 | Ga0075367_100018637 | 533 |
| 132 | 3300006195 | Ga0075366_10000372 | Ga0075366_1000037216 | 533 |
| 133 | 3300006237 | Ga0097621_100000370 | Ga0097621_10000037015 | 533 |
| 134 | 3300006358 | Ga0068871_100000156 | Ga0068871_10000015629 | 533 |
| 135 | 3300006844 | Ga0075428_100095603 | Ga0075428_1000956033 | 533 |
| 136 | 3300006846 | Ga0075430_100117852 | Ga0075430_1001178521 | 533 |
| 137 | 3300009093 | Ga0105240_10003943 | Ga0105240_1000394315 | 533 |
| 138 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002205 | 533 |
| 139 | 3300009098 | Ga0105245_10001369 | Ga0105245_100013697 | 533 |
| 140 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003215 | 533 |
| 141 | 3300009174 | Ga0105241_10024499 | Ga0105241_100244992 | 533 |
| 142 | 3300009176 | Ga0105242_10035606 | Ga0105242_100356062 | 533 |
| 143 | 3300009551 | Ga0105238_10069328 | Ga0105238_100693283 | 533 |
| 144 | 3300009553 | Ga0105249_10000802 | Ga0105249_100008028 | 533 |
| 145 | 3300010375 | Ga0105239_10014654 | Ga0105239_100146547 | 533 |
| 146 | 3300013100 | Ga0157373_10000042 | Ga0157373_1000004238 | 533 |
| 147 | 3300013105 | Ga0157369_10003103 | Ga0157369_100031036 | 533 |
| 148 | 3300013105 | Ga0157369_10016700 | Ga0157369_100167005 | 533 |
| 149 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031167 | 533 |
| 150 | 3300013296 | Ga0157374_10002313 | Ga0157374_1000231313 | 533 |
| 151 | 3300013296 | Ga0157374_10007870 | Ga0157374_100078707 | 533 |
| 152 | 3300013297 | Ga0157378_10016124 | Ga0157378_100161242 | 533 |
| 153 | 3300013307 | Ga0157372_10032188 | Ga0157372_100321883 | 533 |
| 154 | 3300014325 | Ga0163163_10079688 | Ga0163163_100796883 | 533 |
| 155 | 3300014969 | Ga0157376_10000001 | Ga0157376_10000001150 | 533 |
| 156 | 3300025903 | Ga0207680_10021780 | Ga0207680_100217803 | 533 |
| 157 | 3300025907 | Ga0207645_10001792 | Ga0207645_100017926 | 533 |
| 158 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011270 | 533 |
| 159 | 3300025909 | Ga0207705_10000056 | Ga0207705_10000056121 | 533 |
| 160 | 3300025909 | Ga0207705_10001854 | Ga0207705_100018548 | 533 |
| 161 | 3300025909 | Ga0207705_10033441 | Ga0207705_100334415 | 533 |
| 162 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002994 | 533 |
| 163 | 3300025912 | Ga0207707_10005833 | Ga0207707_1000583310 | 533 |
| 164 | 3300025913 | Ga0207695_10015645 | Ga0207695_100156452 | 533 |
| 165 | 3300025917 | Ga0207660_10001351 | Ga0207660_1000135115 | 533 |
| 166 | 3300025919 | Ga0207657_10004283 | Ga0207657_100042835 | 533 |
| 167 | 3300025919 | Ga0207657_10038163 | Ga0207657_100381634 | 533 |
| 168 | 3300025921 | Ga0207652_10001980 | Ga0207652_100019809 | 533 |
| 169 | 3300025921 | Ga0207652_10005637 | Ga0207652_100056373 | 533 |
| 170 | 3300025921 | Ga0207652_10030767 | Ga0207652_100307675 | 533 |
| 171 | 3300025921 | Ga0207652_10044184 | Ga0207652_100441842 | 533 |
| 172 | 3300025927 | Ga0207687_10000001 | Ga0207687_100000011006 | 533 |
| 173 | 3300025927 | Ga0207687_10023453 | Ga0207687_100234535 | 533 |
| 174 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001919 | 533 |
| 175 | 3300025940 | Ga0207691_10022874 | Ga0207691_100228745 | 533 |
| 176 | 3300025944 | Ga0207661_10001361 | Ga0207661_100013615 | 533 |
| 177 | 3300025949 | Ga0207667_10000008 | Ga0207667_1000000886 | 533 |
| 178 | 3300025949 | Ga0207667_10015676 | Ga0207667_100156764 | 533 |
| 179 | 3300025949 | Ga0207667_10063293 | Ga0207667_100632931 | 533 |
| 180 | 3300025960 | Ga0207651_10000191 | Ga0207651_100001918 | 533 |
| 181 | 3300025960 | Ga0207651_10146270 | Ga0207651_101462701 | 533 |
| 182 | 3300025961 | Ga0207712_10006986 | Ga0207712_100069864 | 533 |
| 183 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003628 | 533 |
| 184 | 3300026078 | Ga0207702_10006320 | Ga0207702_100063207 | 533 |
| 185 | 3300026078 | Ga0207702_10014456 | Ga0207702_100144564 | 533 |
| 186 | 3300026121 | Ga0207683_10015104 | Ga0207683_100151042 | 533 |
| 187 | 3300026121 | Ga0207683_10018388 | Ga0207683_100183884 | 533 |
| 188 | 3300027717 | Ga0209998_10005866 | Ga0209998_100058663 | 533 |
| 189 | 3300027866 | Ga0209813_10000004 | Ga0209813_10000004118 | 533 |
| 190 | 3300027907 | Ga0207428_10006981 | Ga0207428_1000698110 | 533 |
| 191 | 3300028379 | Ga0268266_10001545 | Ga0268266_100015456 | 533 |
| 192 | 3300028573 | Ga0265334_10000184 | Ga0265334_100001845 | 533 |
| 193 | 3300028573 | Ga0265334_10017099 | Ga0265334_100170993 | 533 |
| 194 | 3300028800 | Ga0265338_10000192 | Ga0265338_1000019290 | 533 |
| 195 | 3300028800 | Ga0265338_10000601 | Ga0265338_1000060141 | 533 |
| 196 | 3300028800 | Ga0265338_10122433 | Ga0265338_101224331 | 533 |
| 197 | 3300031240 | Ga0265320_10037935 | Ga0265320_100379351 | 533 |
| 198 | 3300031247 | Ga0265340_10000077 | Ga0265340_1000007710 | 533 |
| 199 | 3300031251 | Ga0265327_10004018 | Ga0265327_1000401812 | 533 |
| 200 | 3300037312 | Ga0395899_0005886 | Ga0395899_0005886_3110_4717 | 533 |
| 201 | 3300037418 | Ga0395900_0000232 | Ga0395900_0000232_26945_28555 | 533 |
| 202 | 3300037418 | Ga0395900_0011364 | Ga0395900_0011364_900_2507 | 533 |
| 203 | 3300037418 | Ga0395900_0012595 | Ga0395900_0012595_5108_6709 | 533 |
| 204 | 3300037418 | Ga0395900_0164307 | Ga0395900_0164307_572_2179 | 533 |
| 205 | 3300037466 | Ga0395898_0016807 | Ga0395898_0016807_3646_5256 | 533 |
| 206 | 3300037466 | Ga0395898_0018336 | Ga0395898_0018336_5095_6702 | 533 |
| 207 | 3300037471 | Ga0395905_0000238 | Ga0395905_0000238_13125_14732 | 533 |
| 208 | 3300037471 | Ga0395905_0004532 | Ga0395905_0004532_10647_12254 | 533 |
| 209 | 3300038443 | Ga0395901_0000680 | Ga0395901_0000680_2957_4567 | 533 |
| 210 | 3300046557 | Ga0495622_0000082 | Ga0495622_0000082_21876_23477 | 533 |
| 211 | 3300046683 | Ga0495658_0001953 | Ga0495658_0001953_14_1615 | 533 |
| 212 | 3300046694 | Ga0495649_0000284 | Ga0495649_0000284_997_2598 | 533 |
| 213 | 3300047320 | Ga0495672_0000129 | Ga0495672_0000129_25296_26906 | 533 |
| 214 | 3300048915 | Ga0496112_0023282 | Ga0496112_0023282_973_2580 | 533 |
| 215 | 3300049571 | Ga0501034_0002719 | Ga0501034_0002719_10432_12039 | 533 |
| 216 | 3300049581 | Ga0501047_0000229 | Ga0501047_0000229_8861_10468 | 533 |
| 217 | 3300049822 | Ga0501035_0000033 | Ga0501035_0000033_106905_108512 | 533 |
| 218 | 3300049823 | Ga0501044_0048773 | Ga0501044_0048773_20_1627 | 533 |
| 219 | 3300050491 | nmdc:mga00v17_515_c1 | nmdc:mga00v17_515_c1_15801_17402 | 533 |
| 220 | 3300050491 | nmdc:mga00v17_52518_c1 | nmdc:mga00v17_52518_c1_148_1749 | 533 |
| 221 | 3300050491 | nmdc:mga00v17_666_c2 | nmdc:mga00v17_666_c2_10575_12191 | 533 |
| 222 | 3300050494 | nmdc:mga06z11_44_c1 | nmdc:mga06z11_44_c1_26363_27964 | 533 |
| 223 | 3300050494 | nmdc:mga06z11_6_c1 | nmdc:mga06z11_6_c1_470_2071 | 533 |
| 224 | 3300050495 | nmdc:mga04h51_4_c1 | nmdc:mga04h51_4_c1_29712_31313 | 533 |
| 225 | 3300050509 | nmdc:mga0qj67_10614_c1 | nmdc:mga0qj67_10614_c1_30_1631 | 533 |
| 226 | 3300050511 | nmdc:mga08y16_1132_c1 | nmdc:mga08y16_1132_c1_15561_17162 | 533 |
| 227 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_217435_219036 | 533 |
| 228 | 3300053087 | Ga0500643_000010 | Ga0500643_000010_386989_388602 | 533 |
| 229 | 3300053087 | Ga0500643_000038 | Ga0500643_000038_78300_79910 | 533 |
| 230 | 3300053088 | Ga0500644_0000480 | Ga0500644_0000480_6130_7731 | 533 |
| 231 | 3300053088 | Ga0500644_0003341 | Ga0500644_0003341_1505_3112 | 533 |
| 232 | 3300053090 | Ga0500646_0002335 | Ga0500646_0002335_2694_4301 | 533 |
| 233 | 3300053092 | Ga0500583_0002166 | Ga0500583_0002166_3600_5207 | 533 |
| 234 | 3300053093 | Ga0500651_0000045 | Ga0500651_0000045_16500_18137 | 533 |
| 235 | 3300053093 | Ga0500651_0015284 | Ga0500651_0015284_440_2077 | 533 |
| 236 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_622989_624590 | 533 |
| 237 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_433381_434988 | 533 |
| 238 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_709396_710997 | 533 |
| 239 | 3300053104 | Ga0500556_0000295 | Ga0500556_0000295_22314_23921 | 533 |
| 240 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_866823_868424 | 533 |
| 241 | 3300053108 | Ga0500562_003053 | Ga0500562_003053_490_2097 | 533 |
| 242 | 3300053117 | Ga0500593_000001 | Ga0500593_000001_610458_612074 | 533 |
| 243 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_1094458_1096065 | 533 |
| 244 | 3300053118 | Ga0500594_0000196 | Ga0500594_0000196_10657_12258 | 533 |
| 245 | 3300053123 | Ga0500614_000647 | Ga0500614_000647_2372_4009 | 533 |
| 246 | 3300053129 | Ga0500628_000012 | Ga0500628_000012_49874_51475 | 533 |
| 247 | 3300053133 | Ga0500655_000437 | Ga0500655_000437_1571_3178 | 533 |
| 248 | 3300053133 | Ga0500655_005766 | Ga0500655_005766_484_2097 | 533 |
| 249 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_594824_596425 | 533 |
| 250 | 3300053142 | Ga0500577_0001573 | Ga0500577_0001573_2448_4055 | 533 |
| 251 | 3300053147 | Ga0500589_000016 | Ga0500589_000016_53187_54788 | 533 |
| 252 | 3300053147 | Ga0500589_012636 | Ga0500589_012636_574_2184 | 533 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tsg-assembly1.cif.gz_C-2 | pilb from geobacter metallireducens bound to adp | 0.8943 | 140 | 531 |
| 5tsg-assembly1.cif.gz_B-2 | pilb from geobacter metallireducens bound to adp | 0.891 | 140 | 530 |
| 5tsh-assembly1.cif.gz_A | pilb from geobacter metallireducens bound to amp-pnp | 0.8733 | 140 | 531 |
| 5tsh-assembly1.cif.gz_F | pilb from geobacter metallireducens bound to amp-pnp | 0.8729 | 140 | 530 |
| 5tsg-assembly1.cif.gz_C-2 | pilb from geobacter metallireducens bound to adp | 0.87 | 140 | 531 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4phtB03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9027 | 246 | 530 | 3.40.50.300 |
| af_P36645_186_456_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9026 | 251 | 533 | 3.40.50.300 |
| 5tsgD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9025 | 251 | 530 | 3.40.50.300 |
| 5oiuB01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8813 | 136 | 243 | 3.30.450.90 |
| af_P36645_186_456_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8805 | 251 | 533 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455V6V1-F1-model_v4 | deleted | 0.9304 | 242 | 431 |
|
| AF-A0A655V1I4-F1-model_v4 | deleted | 0.927 | 280 | 532 |
|
| AF-A0A182SD16-F1-model_v4 | T2SP_E domain-containing protein | 0.9246 | 258 | 530 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7Y5LDS9-F1-model_v4 | Flp pilus assembly complex ATPase component TadA | 0.924 | 341 | 533 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A149PUD3-F1-model_v4 | General secretion pathway protein GspE | 0.9216 | 279 | 531 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar