F363008

General Info

Members Datasets Scaffolds Average Seq Length
252 152 252 533

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100175924|Ga0070673_1001759241
Length 576
Sequence MSVTFTSRRSPSQYILHRSIKLPAHKCLPNRSCSCYTTGMEKDTQAQARRDAERTTQHRAQVLGLPYIDTAALSSKPLFREILPLEEMYKVRIIPISADQSKIVFGITTTTSQQAMNEIRQRYADRLVSFAIISDVGFKEYMRLYDPPKQVVYQDIAFSNDSNSNLFQQVSKTLGEVRSDDILAYLVKQAYNLKASDIHLENQAEGVRIRFRVDGVLHPIAHLSREKYHQLLSSIAVAANVSTGGTDAETGHINKTYKMATGEDVNVNLRVETVPTVFGEDVVMRLFTLKMELLKLDNLSLSESERAVVDDVISHPTGMVLVVGPTGSGKTTTLYSILNTLNSDERKLLTLEDPVEYFMPGVVQIPVEGDQNARGFAERLRAVLRLDPDIVMVGEIRDQDTAKTALQAALTGHLVLSTFHASNASAALTRMLDFIGINPLFASAVHLIMAQRLVRRLDPETRQPYQPDEGLKAQLQAVIDTLPPGVPRPDLNQVTLYKPGSSDKNPFGYVGQMPIREQMQMTPGIQQILKLPPNQITTDMIEQKAIEEGMRTMLQDGILKAIEGITTIEEVYRVVS

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
138 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
143 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
144 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
145 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
146 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
147 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
148 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
149 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
150 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
151 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
152 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.83
Nodule 0
Rhizoplane 0.4
Rhizosphere 76.98
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000559 3300001915 Bacteria 11369
2 JGI24737J22298_10000228 3300001990 Bacteria 18575
3 JGI24735J21928_10000227 3300002067 Bacteria 19785
4 JGI24742J22300_10000011 3300002244 Bacteria 31137
5 rootH1_10116708 3300003323 Bacteria 9089
6 rootH1_10189042 3300003323 Bacteria 5626
7 Ga0065704_10113903 3300005289 Bacteria 1902
8 Ga0070658_10000012 3300005327 Bacteria 277871
9 Ga0070658_10000015 3300005327 Bacteria 230579
10 Ga0070658_10000491 3300005327 Bacteria 34335
11 Ga0070658_10002596 3300005327 Bacteria 15044
12 Ga0070658_10032861 3300005327 Bacteria 4172
13 Ga0070658_10041091 3300005327 Bacteria 3731
14 Ga0070676_10001822 3300005328 Bacteria 10833
15 Ga0070676_10038762 3300005328 Unclassified 2753
16 Ga0070683_100000657 3300005329 Bacteria 25014
17 Ga0070690_100003368 3300005330 Bacteria 8725
18 Ga0070666_10032186 3300005335 Bacteria 3463
19 Ga0070680_100024901 3300005336 Unclassified 4783
20 Ga0070660_100000835 3300005339 Bacteria 20500
21 Ga0070660_100001769 3300005339 Bacteria 14834
22 Ga0070660_100030056 3300005339 Unclassified 4074
23 Ga0070691_10001833 3300005341 Bacteria 9262
24 Ga0070671_100000001 3300005355 Bacteria 1228151
25 Ga0070674_100022246 3300005356 Unclassified 4087
26 Ga0070673_100001360 3300005364 Bacteria 14303
27 Ga0070673_100175924 3300005364 Bacteria 1829
28 Ga0070659_100000558 3300005366 Bacteria 27295
29 Ga0070667_100000001 3300005367 Bacteria 1108638
30 Ga0070667_100013945 3300005367 Bacteria 6644
31 Ga0070678_100000234 3300005456 Bacteria 25286
32 Ga0070681_10003950 3300005458 Bacteria 13972
33 Ga0070681_10135090 3300005458 Bacteria 2397
34 Ga0070685_10001561 3300005466 Bacteria 12067
35 Ga0070679_100000652 3300005530 Bacteria 29531
36 Ga0070679_100004498 3300005530 Bacteria 12880
37 Ga0070679_100006231 3300005530 Bacteria 11110
38 Ga0070679_100021794 3300005530 Bacteria 6258
39 Ga0070684_100001437 3300005535 Bacteria 17157
40 Ga0070684_100003619 3300005535 Bacteria 11635
41 Ga0070672_100005074 3300005543 Bacteria 8687
42 Ga0068855_100000003 3300005563 Bacteria 589862
43 Ga0068855_100000211 3300005563 Bacteria 74558
44 Ga0068855_100053150 3300005563 Bacteria 4767
45 Ga0068857_100000002 3300005577 Bacteria 241401
46 Ga0068856_100000001 3300005614 Bacteria 565602
47 Ga0068856_100000866 3300005614 Bacteria 32413
48 Ga0068856_100008801 3300005614 Bacteria 9824
49 Ga0068856_100046085 3300005614 Bacteria 4295
50 Ga0068863_100145252 3300005841 Bacteria 2268
51 Ga0068860_100005217 3300005843 Bacteria 13193
52 Ga0081455_10000003 3300005937 Bacteria 367763
53 Ga0081539_10041518 3300005985 Bacteria 2687
54 Ga0075365_10012114 3300006038 Bacteria 5105
55 Ga0075368_10000191 3300006042 Bacteria 16758
56 Ga0075364_10000866 3300006051 Bacteria 15976
57 Ga0075364_10014195 3300006051 Unclassified 4917
58 Ga0075362_10000303 3300006177 Bacteria 13912
59 Ga0075367_10000188 3300006178 Bacteria 20290
60 Ga0075367_10001863 3300006178 Bacteria 9314
61 Ga0075366_10000001 3300006195 Bacteria 569172
62 Ga0075366_10000372 3300006195 Bacteria 20821
63 Ga0097621_100000370 3300006237 Bacteria 31223
64 Ga0068871_100000156 3300006358 Bacteria 45103
65 Ga0075428_100095603 3300006844 Bacteria 3239
66 Ga0075430_100117852 3300006846 Bacteria 2213
67 Ga0105240_10000003 3300009093 Bacteria 1183681
68 Ga0105240_10003943 3300009093 Bacteria 22929
69 Ga0105245_10000001 3300009098 Bacteria 939270
70 Ga0105245_10000002 3300009098 Bacteria 634374
71 Ga0105245_10001190 3300009098 Bacteria 23565
72 Ga0105245_10001369 3300009098 Bacteria 22074
73 Ga0105243_10000001 3300009148 Bacteria 1156578
74 Ga0105241_10000003 3300009174 Bacteria 839043
75 Ga0105241_10002073 3300009174 Bacteria 15150
76 Ga0105241_10024499 3300009174 Bacteria 4481
77 Ga0105242_10000135 3300009176 Bacteria 53544
78 Ga0105242_10035606 3300009176 Unclassified 3991
79 Ga0105248_10055586 3300009177 Bacteria 4441
80 Ga0105237_10041073 3300009545 Bacteria 4665
81 Ga0105238_10069328 3300009551 Bacteria 3527
82 Ga0105249_10000802 3300009553 Bacteria 28271
83 Ga0105239_10014654 3300010375 Bacteria 8694
84 Ga0105239_10217785 3300010375 Bacteria 2141
85 Ga0157373_10000042 3300013100 Bacteria 113564
86 Ga0157369_10003103 3300013105 Bacteria 19847
87 Ga0157369_10016700 3300013105 Bacteria 8251
88 Ga0157369_10114116 3300013105 Bacteria 2869
89 Ga0157374_10000031 3300013296 Bacteria 204840
90 Ga0157374_10000195 3300013296 Bacteria 56142
91 Ga0157374_10002313 3300013296 Bacteria 16059
92 Ga0157374_10007870 3300013296 Bacteria 9099
93 Ga0157378_10016124 3300013297 Bacteria 6543
94 Ga0157372_10032188 3300013307 Bacteria 5748
95 Ga0163163_10079688 3300014325 Unclassified 3273
96 Ga0157377_10025959 3300014745 Bacteria 3129
97 Ga0157376_10000001 3300014969 Bacteria 842910
98 Ga0207680_10021780 3300025903 Bacteria 3474
99 Ga0207645_10001792 3300025907 Bacteria 17339
100 Ga0207705_10000011 3300025909 Bacteria 517768
101 Ga0207705_10000056 3300025909 Bacteria 157554
102 Ga0207705_10001105 3300025909 Bacteria 21924
103 Ga0207705_10001854 3300025909 Bacteria 16602
104 Ga0207705_10021205 3300025909 Bacteria 4634
105 Ga0207705_10033441 3300025909 Bacteria 3673
106 Ga0207654_10000002 3300025911 Bacteria 1460142
107 Ga0207654_10003824 3300025911 Bacteria 7590
108 Ga0207707_10005833 3300025912 Bacteria 10761
109 Ga0207695_10000005 3300025913 Bacteria 1196715
110 Ga0207695_10015645 3300025913 Bacteria 8922
111 Ga0207660_10001351 3300025917 Bacteria 16443
112 Ga0207660_10166707 3300025917 Bacteria 1703
113 Ga0207657_10004283 3300025919 Bacteria 15119
114 Ga0207657_10007630 3300025919 Bacteria 11073
115 Ga0207657_10038163 3300025919 Bacteria 4280
116 Ga0207652_10001980 3300025921 Bacteria 17726
117 Ga0207652_10005637 3300025921 Bacteria 10158
118 Ga0207652_10011519 3300025921 Bacteria 7131
119 Ga0207652_10030767 3300025921 Bacteria 4498
120 Ga0207652_10044184 3300025921 Bacteria 3795
121 Ga0207687_10000001 3300025927 Bacteria 1130810
122 Ga0207687_10000030 3300025927 Bacteria 155548
123 Ga0207687_10001069 3300025927 Bacteria 18570
124 Ga0207687_10023453 3300025927 Bacteria 4113
125 Ga0207644_10000001 3300025931 Bacteria 1243214
126 Ga0207690_10007132 3300025932 Bacteria 6639
127 Ga0207686_10000001 3300025934 Bacteria 1169580
128 Ga0207709_10000002 3300025935 Bacteria 1171536
129 Ga0207691_10022874 3300025940 Bacteria 5892
130 Ga0207661_10000021 3300025944 Bacteria 205381
131 Ga0207661_10001361 3300025944 Bacteria 16380
132 Ga0207667_10000008 3300025949 Bacteria 625138
133 Ga0207667_10000466 3300025949 Bacteria 54272
134 Ga0207667_10015676 3300025949 Bacteria 8596
135 Ga0207667_10059320 3300025949 Bacteria 4008
136 Ga0207667_10063293 3300025949 Bacteria 3865
137 Ga0207651_10000191 3300025960 Bacteria 26637
138 Ga0207651_10146270 3300025960 Bacteria 1833
139 Ga0207712_10006986 3300025961 Bacteria 7120
140 Ga0207658_10000003 3300025986 Bacteria 1151934
141 Ga0207702_10000001 3300026078 Bacteria 895738
142 Ga0207702_10006320 3300026078 Bacteria 10235
143 Ga0207702_10014456 3300026078 Bacteria 6554
144 Ga0207648_10213787 3300026089 Bacteria 1712
145 Ga0207674_10000001 3300026116 Bacteria 616581
146 Ga0207683_10015104 3300026121 Bacteria 6571
147 Ga0207683_10018388 3300026121 Bacteria 5963
148 Ga0209998_10005866 3300027717 Bacteria 2555
149 Ga0209813_10000004 3300027866 Bacteria 139340
150 Ga0207428_10006981 3300027907 Bacteria 10343
151 Ga0268266_10001545 3300028379 Bacteria 26966
152 Ga0265326_10000683 3300028558 Bacteria 12587
153 Ga0265326_10011203 3300028558 Bacteria 2646
154 Ga0265334_10000049 3300028573 Bacteria 89091
155 Ga0265334_10000184 3300028573 Bacteria 36597
156 Ga0265334_10017099 3300028573 Bacteria 3000
157 Ga0265318_10008117 3300028577 Bacteria 4693
158 Ga0265338_10000003 3300028800 Bacteria 733923
159 Ga0265338_10000192 3300028800 Bacteria 115195
160 Ga0265338_10000601 3300028800 Bacteria 63282
161 Ga0265338_10122433 3300028800 Bacteria 2070
162 Ga0265320_10037935 3300031240 Bacteria 2423
163 Ga0265340_10000077 3300031247 Bacteria 47065
164 Ga0265327_10004018 3300031251 Bacteria 13393
165 Ga0265327_10006648 3300031251 Bacteria 9181
166 Ga0265327_10012154 3300031251 Bacteria 5841
167 Ga0265316_10029572 3300031344 Bacteria 4502
168 Ga0395899_0005886 3300037312 Bacteria 9515
169 Ga0395900_0000232 3300037418 Bacteria 87268
170 Ga0395900_0004371 3300037418 Bacteria 14994
171 Ga0395900_0011364 3300037418 Bacteria 9108
172 Ga0395900_0012595 3300037418 Bacteria 8653
173 Ga0395900_0164307 3300037418 Bacteria 2263
174 Ga0395898_0016807 3300037466 Bacteria 7475
175 Ga0395898_0018336 3300037466 Bacteria 7137
176 Ga0395905_0000238 3300037471 Bacteria 83164
177 Ga0395905_0004532 3300037471 Bacteria 14388
178 Ga0395905_0181936 3300037471 Bacteria 1973
179 Ga0395901_0000680 3300038443 Bacteria 39129
180 Ga0395901_0006077 3300038443 Bacteria 12237
181 Ga0495622_0000082 3300046557 Bacteria 85266
182 Ga0495588_0000116 3300046674 Bacteria 135919
183 Ga0495658_0001953 3300046683 Bacteria 10540
184 Ga0495649_0000284 3300046694 Bacteria 44736
185 Ga0495672_0000129 3300047320 Bacteria 112879
186 Ga0496112_0023282 3300048915 Bacteria 5915
187 Ga0501031_0000446 3300049568 Bacteria 23856
188 Ga0501032_0021993 3300049569 Bacteria 4427
189 Ga0501034_0002719 3300049571 Bacteria 20818
190 Ga0501034_0033532 3300049571 Bacteria 5208
191 Ga0501036_0002986 3300049572 Bacteria 13446
192 Ga0501037_0000121 3300049573 Bacteria 72862
193 Ga0501038_0007638 3300049574 Bacteria 9972
194 Ga0501043_0002262 3300049579 Bacteria 16380
195 Ga0501046_0000922 3300049580 Bacteria 28825
196 Ga0501047_0000229 3300049581 Bacteria 66412
197 Ga0501047_0003170 3300049581 Bacteria 15588
198 Ga0501048_0002409 3300049582 Bacteria 14272
199 Ga0501070_0153717 3300049586 Bacteria 1898
200 Ga0501073_0080084 3300049589 Bacteria 2273
201 Ga0501035_0000033 3300049822 Bacteria 175087
202 Ga0501035_0000801 3300049822 Bacteria 33495
203 Ga0501044_0043314 3300049823 Bacteria 4677
204 Ga0501044_0048773 3300049823 Bacteria 4373
205 nmdc:mga03683_20_c2 3300050489 Bacteria 23288
206 nmdc:mga00v17_515_c1 3300050491 Bacteria 21654
207 nmdc:mga00v17_52518_c1 3300050491 Bacteria 2480
208 nmdc:mga00v17_666_c2 3300050491 Bacteria 16020
209 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
210 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
211 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
212 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
213 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
214 nmdc:mga07m45_44982_c1 3300050496 Bacteria 2478
215 nmdc:mga0qj67_10614_c1 3300050509 Bacteria 6880
216 nmdc:mga0qj67_111447_c1 3300050509 Bacteria 2209
217 nmdc:mga08y16_1132_c1 3300050511 Bacteria 26248
218 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
219 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
220 Ga0500610_0000001 3300053079 Bacteria 185468
221 Ga0500643_000010 3300053087 Bacteria 408084
222 Ga0500643_000038 3300053087 Bacteria 178974
223 Ga0500643_003390 3300053087 Bacteria 7705
224 Ga0500644_0000006 3300053088 Bacteria 143304
225 Ga0500644_0000480 3300053088 Bacteria 17568
226 Ga0500644_0003341 3300053088 Bacteria 3968
227 Ga0500646_0002335 3300053090 Bacteria 4934
228 Ga0500583_0002166 3300053092 Bacteria 5834
229 Ga0500651_0000045 3300053093 Bacteria 85481
230 Ga0500651_0015284 3300053093 Bacteria 4710
231 Ga0500566_0000001 3300053094 Bacteria 1101031
232 Ga0500650_0000001 3300053098 Bacteria 818797
233 Ga0500555_000001 3300053103 Bacteria 1353713
234 Ga0500555_000002 3300053103 Bacteria 1314346
235 Ga0500556_0000295 3300053104 Bacteria 38375
236 Ga0500562_000002 3300053108 Bacteria 977234
237 Ga0500562_003053 3300053108 Bacteria 4184
238 Ga0500593_000001 3300053117 Bacteria 784404
239 Ga0500594_0000001 3300053118 Bacteria 1178472
240 Ga0500594_0000196 3300053118 Bacteria 15125
241 Ga0500614_000001 3300053123 Bacteria 1274484
242 Ga0500614_000647 3300053123 Bacteria 8893
243 Ga0500628_000012 3300053129 Bacteria 106556
244 Ga0500652_000020 3300053131 Bacteria 119198
245 Ga0500655_000437 3300053133 Bacteria 8566
246 Ga0500655_005766 3300053133 Bacteria 2229
247 Ga0500561_0000001 3300053137 Bacteria 957685
248 Ga0500577_0001573 3300053142 Bacteria 5837
249 Ga0500589_000016 3300053147 Bacteria 107090
250 Ga0500589_012636 3300053147 Bacteria 3701
251 Ga0500649_000013 3300053722 Bacteria 73694
252 Ga0500570_000005 3300053724 Bacteria 132994

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10217785 Ga0105239_102177852 435
2 3300050509 nmdc:mga0qj67_111447_c1 nmdc:mga0qj67_111447_c1_33_1571 491
3 3300037471 Ga0395905_0181936 Ga0395905_0181936_20_1513 495
4 3300053079 Ga0500610_0000001 Ga0500610_0000001_111881_113488 496
5 3300053088 Ga0500644_0000006 Ga0500644_0000006_127146_128753 496
6 3300005535 Ga0070684_100001437 Ga0070684_10000143714 500
7 3300025944 Ga0207661_10000021 Ga0207661_1000002199 500
8 3300053087 Ga0500643_003390 Ga0500643_003390_4836_6443 503
9 3300053103 Ga0500555_000002 Ga0500555_000002_528950_530557 503
10 3300053131 Ga0500652_000020 Ga0500652_000020_17005_18612 503
11 3300050496 nmdc:mga07m45_44982_c1 nmdc:mga07m45_44982_c1_926_2440 504
12 3300037418 Ga0395900_0004371 Ga0395900_0004371_6787_8331 512
13 3300038443 Ga0395901_0006077 Ga0395901_0006077_3272_4816 512
14 3300013105 Ga0157369_10114116 Ga0157369_101141163 514
15 3300025949 Ga0207667_10059320 Ga0207667_100593203 517
16 3300009098 Ga0105245_10000001 Ga0105245_10000001384 522
17 3300025927 Ga0207687_10000030 Ga0207687_1000003055 522
18 3300006195 Ga0075366_10000001 Ga0075366_10000001440 523
19 3300009174 Ga0105241_10002073 Ga0105241_1000207310 523
20 3300025911 Ga0207654_10003824 Ga0207654_100038244 523
21 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_672091_673692 523
22 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_19638_21239 523
23 3300006177 Ga0075362_10000303 Ga0075362_1000030310 525
24 3300049568 Ga0501031_0000446 Ga0501031_0000446_20971_22587 525
25 3300049569 Ga0501032_0021993 Ga0501032_0021993_1216_2832 525
26 3300049571 Ga0501034_0033532 Ga0501034_0033532_3536_5152 525
27 3300049572 Ga0501036_0002986 Ga0501036_0002986_1829_3445 525
28 3300049573 Ga0501037_0000121 Ga0501037_0000121_66192_67808 525
29 3300049574 Ga0501038_0007638 Ga0501038_0007638_3631_5247 525
30 3300049579 Ga0501043_0002262 Ga0501043_0002262_2041_3657 525
31 3300049580 Ga0501046_0000922 Ga0501046_0000922_16472_18088 525
32 3300049581 Ga0501047_0003170 Ga0501047_0003170_6561_8177 525
33 3300049582 Ga0501048_0002409 Ga0501048_0002409_7240_8856 525
34 3300049586 Ga0501070_0153717 Ga0501070_0153717_108_1724 525
35 3300049589 Ga0501073_0080084 Ga0501073_0080084_245_1861 525
36 3300049822 Ga0501035_0000801 Ga0501035_0000801_25566_27182 525
37 3300049823 Ga0501044_0043314 Ga0501044_0043314_598_2214 525
38 3300050489 nmdc:mga03683_20_c2 nmdc:mga03683_20_c2_10555_12159 525
39 3300046674 Ga0495588_0000116 Ga0495588_0000116_88370_89977 526
40 3300053123 Ga0500614_000001 Ga0500614_000001_286948_288555 526
41 3300053722 Ga0500649_000013 Ga0500649_000013_34980_36587 526
42 3300009177 Ga0105248_10055586 Ga0105248_100555863 530
43 3300005289 Ga0065704_10113903 Ga0065704_101139031 532
44 3300005327 Ga0070658_10000491 Ga0070658_1000049116 532
45 3300005327 Ga0070658_10032861 Ga0070658_100328614 532
46 3300005330 Ga0070690_100003368 Ga0070690_1000033689 532
47 3300005339 Ga0070660_100000835 Ga0070660_10000083511 532
48 3300005341 Ga0070691_10001833 Ga0070691_100018333 532
49 3300005366 Ga0070659_100000558 Ga0070659_10000055810 532
50 3300005530 Ga0070679_100006231 Ga0070679_1000062312 532
51 3300005563 Ga0068855_100000211 Ga0068855_1000002118 532
52 3300005577 Ga0068857_100000002 Ga0068857_10000000237 532
53 3300005614 Ga0068856_100000001 Ga0068856_100000001233 532
54 3300005614 Ga0068856_100008801 Ga0068856_1000088015 532
55 3300005985 Ga0081539_10041518 Ga0081539_100415182 532
56 3300009093 Ga0105240_10000003 Ga0105240_10000003794 532
57 3300009098 Ga0105245_10001190 Ga0105245_1000119015 532
58 3300009148 Ga0105243_10000001 Ga0105243_10000001498 532
59 3300009176 Ga0105242_10000135 Ga0105242_1000013548 532
60 3300009545 Ga0105237_10041073 Ga0105237_100410732 532
61 3300013296 Ga0157374_10000195 Ga0157374_1000019535 532
62 3300014745 Ga0157377_10025959 Ga0157377_100259592 532
63 3300025909 Ga0207705_10001105 Ga0207705_100011053 532
64 3300025909 Ga0207705_10021205 Ga0207705_100212054 532
65 3300025913 Ga0207695_10000005 Ga0207695_10000005804 532
66 3300025917 Ga0207660_10166707 Ga0207660_101667071 532
67 3300025919 Ga0207657_10007630 Ga0207657_100076309 532
68 3300025921 Ga0207652_10011519 Ga0207652_100115194 532
69 3300025927 Ga0207687_10001069 Ga0207687_1000106911 532
70 3300025932 Ga0207690_10007132 Ga0207690_100071324 532
71 3300025934 Ga0207686_10000001 Ga0207686_10000001645 532
72 3300025935 Ga0207709_10000002 Ga0207709_10000002763 532
73 3300025949 Ga0207667_10000466 Ga0207667_1000046627 532
74 3300026078 Ga0207702_10000001 Ga0207702_10000001782 532
75 3300026089 Ga0207648_10213787 Ga0207648_102137871 532
76 3300026116 Ga0207674_10000001 Ga0207674_10000001461 532
77 3300028558 Ga0265326_10000683 Ga0265326_100006837 532
78 3300028558 Ga0265326_10011203 Ga0265326_100112032 532
79 3300028573 Ga0265334_10000049 Ga0265334_1000004962 532
80 3300028577 Ga0265318_10008117 Ga0265318_100081172 532
81 3300028800 Ga0265338_10000003 Ga0265338_10000003456 532
82 3300031251 Ga0265327_10006648 Ga0265327_100066487 532
83 3300031251 Ga0265327_10012154 Ga0265327_100121544 532
84 3300031344 Ga0265316_10029572 Ga0265316_100295725 532
85 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_38183_39796 532
86 3300053724 Ga0500570_000005 Ga0500570_000005_62633_64243 532
87 3300001915 JGI24741J21665_1000559 JGI24741J21665_10005594 533
88 3300001990 JGI24737J22298_10000228 JGI24737J22298_1000022812 533
89 3300002067 JGI24735J21928_10000227 JGI24735J21928_100002275 533
90 3300002244 JGI24742J22300_10000011 JGI24742J22300_1000001114 533
91 3300003323 rootH1_10116708 rootH1_1011670810 533
92 3300003323 rootH1_10189042 rootH1_101890421 533
93 3300005327 Ga0070658_10000012 Ga0070658_10000012303 533
94 3300005327 Ga0070658_10000015 Ga0070658_1000001575 533
95 3300005327 Ga0070658_10002596 Ga0070658_100025969 533
96 3300005327 Ga0070658_10041091 Ga0070658_100410912 533
97 3300005328 Ga0070676_10001822 Ga0070676_100018228 533
98 3300005328 Ga0070676_10038762 Ga0070676_100387622 533
99 3300005329 Ga0070683_100000657 Ga0070683_1000006575 533
100 3300005335 Ga0070666_10032186 Ga0070666_100321863 533
101 3300005336 Ga0070680_100024901 Ga0070680_1000249018 533
102 3300005339 Ga0070660_100001769 Ga0070660_10000176910 533
103 3300005339 Ga0070660_100030056 Ga0070660_1000300564 533
104 3300005355 Ga0070671_100000001 Ga0070671_100000001517 533
105 3300005356 Ga0070674_100022246 Ga0070674_1000222462 533
106 3300005364 Ga0070673_100001360 Ga0070673_1000013604 533
107 3300005364 Ga0070673_100175924 Ga0070673_1001759241 533
108 3300005367 Ga0070667_100000001 Ga0070667_100000001751 533
109 3300005367 Ga0070667_100013945 Ga0070667_1000139453 533
110 3300005456 Ga0070678_100000234 Ga0070678_1000002345 533
111 3300005458 Ga0070681_10003950 Ga0070681_100039505 533
112 3300005458 Ga0070681_10135090 Ga0070681_101350902 533
113 3300005466 Ga0070685_10001561 Ga0070685_100015618 533
114 3300005530 Ga0070679_100000652 Ga0070679_10000065230 533
115 3300005530 Ga0070679_100004498 Ga0070679_1000044989 533
116 3300005530 Ga0070679_100021794 Ga0070679_1000217943 533
117 3300005535 Ga0070684_100003619 Ga0070684_1000036197 533
118 3300005543 Ga0070672_100005074 Ga0070672_1000050743 533
119 3300005563 Ga0068855_100000003 Ga0068855_10000000387 533
120 3300005563 Ga0068855_100053150 Ga0068855_1000531502 533
121 3300005614 Ga0068856_100000866 Ga0068856_1000008662 533
122 3300005614 Ga0068856_100046085 Ga0068856_1000460852 533
123 3300005841 Ga0068863_100145252 Ga0068863_1001452521 533
124 3300005843 Ga0068860_100005217 Ga0068860_1000052178 533
125 3300005937 Ga0081455_10000003 Ga0081455_10000003340 533
126 3300006038 Ga0075365_10012114 Ga0075365_100121142 533
127 3300006042 Ga0075368_10000191 Ga0075368_100001917 533
128 3300006051 Ga0075364_10000866 Ga0075364_1000086612 533
129 3300006051 Ga0075364_10014195 Ga0075364_100141955 533
130 3300006178 Ga0075367_10000188 Ga0075367_1000018811 533
131 3300006178 Ga0075367_10001863 Ga0075367_100018637 533
132 3300006195 Ga0075366_10000372 Ga0075366_1000037216 533
133 3300006237 Ga0097621_100000370 Ga0097621_10000037015 533
134 3300006358 Ga0068871_100000156 Ga0068871_10000015629 533
135 3300006844 Ga0075428_100095603 Ga0075428_1000956033 533
136 3300006846 Ga0075430_100117852 Ga0075430_1001178521 533
137 3300009093 Ga0105240_10003943 Ga0105240_1000394315 533
138 3300009098 Ga0105245_10000002 Ga0105245_10000002205 533
139 3300009098 Ga0105245_10001369 Ga0105245_100013697 533
140 3300009174 Ga0105241_10000003 Ga0105241_10000003215 533
141 3300009174 Ga0105241_10024499 Ga0105241_100244992 533
142 3300009176 Ga0105242_10035606 Ga0105242_100356062 533
143 3300009551 Ga0105238_10069328 Ga0105238_100693283 533
144 3300009553 Ga0105249_10000802 Ga0105249_100008028 533
145 3300010375 Ga0105239_10014654 Ga0105239_100146547 533
146 3300013100 Ga0157373_10000042 Ga0157373_1000004238 533
147 3300013105 Ga0157369_10003103 Ga0157369_100031036 533
148 3300013105 Ga0157369_10016700 Ga0157369_100167005 533
149 3300013296 Ga0157374_10000031 Ga0157374_10000031167 533
150 3300013296 Ga0157374_10002313 Ga0157374_1000231313 533
151 3300013296 Ga0157374_10007870 Ga0157374_100078707 533
152 3300013297 Ga0157378_10016124 Ga0157378_100161242 533
153 3300013307 Ga0157372_10032188 Ga0157372_100321883 533
154 3300014325 Ga0163163_10079688 Ga0163163_100796883 533
155 3300014969 Ga0157376_10000001 Ga0157376_10000001150 533
156 3300025903 Ga0207680_10021780 Ga0207680_100217803 533
157 3300025907 Ga0207645_10001792 Ga0207645_100017926 533
158 3300025909 Ga0207705_10000011 Ga0207705_10000011270 533
159 3300025909 Ga0207705_10000056 Ga0207705_10000056121 533
160 3300025909 Ga0207705_10001854 Ga0207705_100018548 533
161 3300025909 Ga0207705_10033441 Ga0207705_100334415 533
162 3300025911 Ga0207654_10000002 Ga0207654_10000002994 533
163 3300025912 Ga0207707_10005833 Ga0207707_1000583310 533
164 3300025913 Ga0207695_10015645 Ga0207695_100156452 533
165 3300025917 Ga0207660_10001351 Ga0207660_1000135115 533
166 3300025919 Ga0207657_10004283 Ga0207657_100042835 533
167 3300025919 Ga0207657_10038163 Ga0207657_100381634 533
168 3300025921 Ga0207652_10001980 Ga0207652_100019809 533
169 3300025921 Ga0207652_10005637 Ga0207652_100056373 533
170 3300025921 Ga0207652_10030767 Ga0207652_100307675 533
171 3300025921 Ga0207652_10044184 Ga0207652_100441842 533
172 3300025927 Ga0207687_10000001 Ga0207687_100000011006 533
173 3300025927 Ga0207687_10023453 Ga0207687_100234535 533
174 3300025931 Ga0207644_10000001 Ga0207644_10000001919 533
175 3300025940 Ga0207691_10022874 Ga0207691_100228745 533
176 3300025944 Ga0207661_10001361 Ga0207661_100013615 533
177 3300025949 Ga0207667_10000008 Ga0207667_1000000886 533
178 3300025949 Ga0207667_10015676 Ga0207667_100156764 533
179 3300025949 Ga0207667_10063293 Ga0207667_100632931 533
180 3300025960 Ga0207651_10000191 Ga0207651_100001918 533
181 3300025960 Ga0207651_10146270 Ga0207651_101462701 533
182 3300025961 Ga0207712_10006986 Ga0207712_100069864 533
183 3300025986 Ga0207658_10000003 Ga0207658_10000003628 533
184 3300026078 Ga0207702_10006320 Ga0207702_100063207 533
185 3300026078 Ga0207702_10014456 Ga0207702_100144564 533
186 3300026121 Ga0207683_10015104 Ga0207683_100151042 533
187 3300026121 Ga0207683_10018388 Ga0207683_100183884 533
188 3300027717 Ga0209998_10005866 Ga0209998_100058663 533
189 3300027866 Ga0209813_10000004 Ga0209813_10000004118 533
190 3300027907 Ga0207428_10006981 Ga0207428_1000698110 533
191 3300028379 Ga0268266_10001545 Ga0268266_100015456 533
192 3300028573 Ga0265334_10000184 Ga0265334_100001845 533
193 3300028573 Ga0265334_10017099 Ga0265334_100170993 533
194 3300028800 Ga0265338_10000192 Ga0265338_1000019290 533
195 3300028800 Ga0265338_10000601 Ga0265338_1000060141 533
196 3300028800 Ga0265338_10122433 Ga0265338_101224331 533
197 3300031240 Ga0265320_10037935 Ga0265320_100379351 533
198 3300031247 Ga0265340_10000077 Ga0265340_1000007710 533
199 3300031251 Ga0265327_10004018 Ga0265327_1000401812 533
200 3300037312 Ga0395899_0005886 Ga0395899_0005886_3110_4717 533
201 3300037418 Ga0395900_0000232 Ga0395900_0000232_26945_28555 533
202 3300037418 Ga0395900_0011364 Ga0395900_0011364_900_2507 533
203 3300037418 Ga0395900_0012595 Ga0395900_0012595_5108_6709 533
204 3300037418 Ga0395900_0164307 Ga0395900_0164307_572_2179 533
205 3300037466 Ga0395898_0016807 Ga0395898_0016807_3646_5256 533
206 3300037466 Ga0395898_0018336 Ga0395898_0018336_5095_6702 533
207 3300037471 Ga0395905_0000238 Ga0395905_0000238_13125_14732 533
208 3300037471 Ga0395905_0004532 Ga0395905_0004532_10647_12254 533
209 3300038443 Ga0395901_0000680 Ga0395901_0000680_2957_4567 533
210 3300046557 Ga0495622_0000082 Ga0495622_0000082_21876_23477 533
211 3300046683 Ga0495658_0001953 Ga0495658_0001953_14_1615 533
212 3300046694 Ga0495649_0000284 Ga0495649_0000284_997_2598 533
213 3300047320 Ga0495672_0000129 Ga0495672_0000129_25296_26906 533
214 3300048915 Ga0496112_0023282 Ga0496112_0023282_973_2580 533
215 3300049571 Ga0501034_0002719 Ga0501034_0002719_10432_12039 533
216 3300049581 Ga0501047_0000229 Ga0501047_0000229_8861_10468 533
217 3300049822 Ga0501035_0000033 Ga0501035_0000033_106905_108512 533
218 3300049823 Ga0501044_0048773 Ga0501044_0048773_20_1627 533
219 3300050491 nmdc:mga00v17_515_c1 nmdc:mga00v17_515_c1_15801_17402 533
220 3300050491 nmdc:mga00v17_52518_c1 nmdc:mga00v17_52518_c1_148_1749 533
221 3300050491 nmdc:mga00v17_666_c2 nmdc:mga00v17_666_c2_10575_12191 533
222 3300050494 nmdc:mga06z11_44_c1 nmdc:mga06z11_44_c1_26363_27964 533
223 3300050494 nmdc:mga06z11_6_c1 nmdc:mga06z11_6_c1_470_2071 533
224 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_29712_31313 533
225 3300050509 nmdc:mga0qj67_10614_c1 nmdc:mga0qj67_10614_c1_30_1631 533
226 3300050511 nmdc:mga08y16_1132_c1 nmdc:mga08y16_1132_c1_15561_17162 533
227 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_217435_219036 533
228 3300053087 Ga0500643_000010 Ga0500643_000010_386989_388602 533
229 3300053087 Ga0500643_000038 Ga0500643_000038_78300_79910 533
230 3300053088 Ga0500644_0000480 Ga0500644_0000480_6130_7731 533
231 3300053088 Ga0500644_0003341 Ga0500644_0003341_1505_3112 533
232 3300053090 Ga0500646_0002335 Ga0500646_0002335_2694_4301 533
233 3300053092 Ga0500583_0002166 Ga0500583_0002166_3600_5207 533
234 3300053093 Ga0500651_0000045 Ga0500651_0000045_16500_18137 533
235 3300053093 Ga0500651_0015284 Ga0500651_0015284_440_2077 533
236 3300053094 Ga0500566_0000001 Ga0500566_0000001_622989_624590 533
237 3300053098 Ga0500650_0000001 Ga0500650_0000001_433381_434988 533
238 3300053103 Ga0500555_000001 Ga0500555_000001_709396_710997 533
239 3300053104 Ga0500556_0000295 Ga0500556_0000295_22314_23921 533
240 3300053108 Ga0500562_000002 Ga0500562_000002_866823_868424 533
241 3300053108 Ga0500562_003053 Ga0500562_003053_490_2097 533
242 3300053117 Ga0500593_000001 Ga0500593_000001_610458_612074 533
243 3300053118 Ga0500594_0000001 Ga0500594_0000001_1094458_1096065 533
244 3300053118 Ga0500594_0000196 Ga0500594_0000196_10657_12258 533
245 3300053123 Ga0500614_000647 Ga0500614_000647_2372_4009 533
246 3300053129 Ga0500628_000012 Ga0500628_000012_49874_51475 533
247 3300053133 Ga0500655_000437 Ga0500655_000437_1571_3178 533
248 3300053133 Ga0500655_005766 Ga0500655_005766_484_2097 533
249 3300053137 Ga0500561_0000001 Ga0500561_0000001_594824_596425 533
250 3300053142 Ga0500577_0001573 Ga0500577_0001573_2448_4055 533
251 3300053147 Ga0500589_000016 Ga0500589_000016_53187_54788 533
252 3300053147 Ga0500589_012636 Ga0500589_012636_574_2184 533

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

184

457

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsg-assembly1.cif.gz_C-2 pilb from geobacter metallireducens bound to adp 0.8943 140 531
5tsg-assembly1.cif.gz_B-2 pilb from geobacter metallireducens bound to adp 0.891 140 530
5tsh-assembly1.cif.gz_A pilb from geobacter metallireducens bound to amp-pnp 0.8733 140 531
5tsh-assembly1.cif.gz_F pilb from geobacter metallireducens bound to amp-pnp 0.8729 140 530
5tsg-assembly1.cif.gz_C-2 pilb from geobacter metallireducens bound to adp 0.87 140 531
ID Description Score Start End Superfamily
4phtB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9027 246 530 3.40.50.300
af_P36645_186_456_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9026 251 533 3.40.50.300
5tsgD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9025 251 530 3.40.50.300
5oiuB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8813 136 243 3.30.450.90
af_P36645_186_456_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8805 251 533 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A455V6V1-F1-model_v4 deleted 0.9304 242 431
AF-A0A655V1I4-F1-model_v4 deleted 0.927 280 532
AF-A0A182SD16-F1-model_v4 T2SP_E domain-containing protein 0.9246 258 530 GO:0005524
GO:0005886
GO:0016887
AF-A0A7Y5LDS9-F1-model_v4 Flp pilus assembly complex ATPase component TadA 0.924 341 533 GO:0005524
GO:0005886
GO:0016887
AF-A0A149PUD3-F1-model_v4 General secretion pathway protein GspE 0.9216 279 531 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.88 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map