F362997

General Info

Members Datasets Scaffolds Average Seq Length
252 133 504 194

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100232672|Ga0070669_1002326723
Length 232
Sequence VKQRPSRKLVENRKASLNCAKNGASDEGLGNHREINSIAVVPKEEETRGAFRYGAVVATLVGVCALFVSDYTAYVQRQQVRAAVWPILEFESSNTPDIHFTLSNKGVGPAIIRHVTVTVDGKPVVNWSAALEKILGPGYHRLSESDMSGHVLSPGESVTVFTPRDPENNPLNFDKSNPLWVGMNKDRERIAVEICYGSTLGEFWTLRSGGRSRSTTTEVRSCPSVSAESFEQ

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 32.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100232672 3300005353 Bacteria 1461
2 JGI25405J52794_10019450 3300003911 Bacteria 1362
3 Ga0065715_10001208 3300005293 Bacteria 7273
4 Ga0070676_10008430 3300005328 Bacteria 5557
5 Ga0070676_10079155 3300005328 Unclassified 1989
6 Ga0070670_100010933 3300005331 Bacteria 7753
7 Ga0070670_100038640 3300005331 Bacteria 4104
8 Ga0070670_100101851 3300005331 Bacteria 2473
9 Ga0068869_100061109 3300005334 Bacteria 2762
10 Ga0070666_10563070 3300005335 Unclassified 829
11 Ga0068868_100319378 3300005338 Bacteria 1323
12 Ga0068868_100595143 3300005338 Unclassified 979
13 Ga0070660_100234235 3300005339 Bacteria 1494
14 Ga0070691_10144188 3300005341 Bacteria 1216
15 Ga0070687_100007648 3300005343 Bacteria 4521
16 Ga0070668_100011142 3300005347 Bacteria 6694
17 Ga0070668_100123071 3300005347 Unclassified 2075
18 Ga0070668_100500868 3300005347 Bacteria 1051
19 Ga0070669_100107551 3300005353 Bacteria 2113
20 Ga0070669_100142909 3300005353 Unclassified 1846
21 Ga0070669_100176357 3300005353 Bacteria 1669
22 Ga0070675_100065972 3300005354 Unclassified 2993
23 Ga0070675_100131430 3300005354 Bacteria 2134
24 Ga0070675_100216564 3300005354 Bacteria 1666
25 Ga0070675_100670610 3300005354 Unclassified 943
26 Ga0070671_100215601 3300005355 Bacteria 1628
27 Ga0070671_100593786 3300005355 Unclassified 957
28 Ga0070673_100116891 3300005364 Bacteria 2219
29 Ga0070673_100165448 3300005364 Bacteria 1884
30 Ga0070673_100341236 3300005364 Unclassified 1327
31 Ga0070659_100527740 3300005366 Unclassified 1008
32 Ga0070667_100064180 3300005367 Bacteria 3115
33 Ga0070667_100134574 3300005367 Bacteria 2160
34 Ga0070667_100158631 3300005367 Bacteria 1991
35 Ga0070667_100189236 3300005367 Bacteria 1823
36 Ga0070667_100249690 3300005367 Bacteria 1586
37 Ga0070667_100429310 3300005367 Archaea 1205
38 Ga0070709_10060110 3300005434 Unclassified 2414
39 Ga0070709_10064950 3300005434 Unclassified 2335
40 Ga0070714_100088287 3300005435 Unclassified 2713
41 Ga0070714_100133072 3300005435 Bacteria 2223
42 Ga0070714_100938608 3300005435 Unclassified 841
43 Ga0070713_100004757 3300005436 Bacteria 9183
44 Ga0070713_100115673 3300005436 Bacteria 2344
45 Ga0070710_10056979 3300005437 Bacteria 2213
46 Ga0070710_10359797 3300005437 Bacteria 965
47 Ga0070711_100064408 3300005439 Unclassified 2561
48 Ga0070711_100092277 3300005439 Bacteria 2185
49 Ga0070711_100129664 3300005439 Unclassified 1876
50 Ga0070708_100800447 3300005445 Unclassified 886
51 Ga0070678_100816530 3300005456 Unclassified 848
52 Ga0068867_100236263 3300005459 Bacteria 1480
53 Ga0070706_100308191 3300005467 Bacteria 1477
54 Ga0070707_100028149 3300005468 Bacteria 5346
55 Ga0070707_100033769 3300005468 Bacteria 4878
56 Ga0070707_100460093 3300005468 Unclassified 1233
57 Ga0070707_100670385 3300005468 Unclassified 1000
58 Ga0070698_100006990 3300005471 Bacteria 12218
59 Ga0070698_100190598 3300005471 Bacteria 1988
60 Ga0070697_100007124 3300005536 Bacteria 8695
61 Ga0070697_100428251 3300005536 Bacteria 1150
62 Ga0070697_100487661 3300005536 Bacteria 1077
63 Ga0070672_100033189 3300005543 Bacteria 3906
64 Ga0070672_100081884 3300005543 Bacteria 2589
65 Ga0070665_100039399 3300005548 Bacteria 4751
66 Ga0070665_100940647 3300005548 Unclassified 877
67 Ga0070704_100538085 3300005549 Bacteria 1019
68 Ga0070704_100645580 3300005549 Unclassified 934
69 Ga0070664_100622742 3300005564 Bacteria 1002
70 Ga0068852_100537128 3300005616 Unclassified 1168
71 Ga0068861_100190300 3300005719 Unclassified 1715
72 Ga0068860_100109848 3300005843 Bacteria 2635
73 Ga0068862_100100020 3300005844 Bacteria 2536
74 Ga0081455_10002999 3300005937 Bacteria 19694
75 Ga0081455_10007231 3300005937 Bacteria 11724
76 Ga0081455_10015513 3300005937 Bacteria 7397
77 Ga0081455_10044007 3300005937 Bacteria 3900
78 Ga0081455_10168504 3300005937 Bacteria 1671
79 Ga0081540_1001169 3300005983 Bacteria 23052
80 Ga0081540_1016889 3300005983 Bacteria 4543
81 Ga0081540_1099606 3300005983 Bacteria 1255
82 Ga0081539_10264199 3300005985 Unclassified 757
83 Ga0070717_10025335 3300006028 Unclassified 4717
84 Ga0070717_10102675 3300006028 Bacteria 2429
85 Ga0070717_10125307 3300006028 Bacteria 2205
86 Ga0070716_100258031 3300006173 Bacteria 1191
87 Ga0070712_100150079 3300006175 Bacteria 1789
88 Ga0070712_100214254 3300006175 Unclassified 1521
89 Ga0070712_100524097 3300006175 Bacteria 996
90 Ga0097621_100053593 3300006237 Bacteria 3288
91 Ga0097621_100498167 3300006237 Bacteria 1103
92 Ga0068871_100056739 3300006358 Bacteria 3185
93 Ga0068871_100063844 3300006358 Bacteria 3013
94 Ga0075433_10181895 3300006852 Bacteria 1871
95 Ga0075433_10622159 3300006852 Unclassified 947
96 Ga0075434_100144528 3300006871 Unclassified 2399
97 Ga0068865_100210150 3300006881 Bacteria 1516
98 Ga0068865_100235022 3300006881 Bacteria 1440
99 Ga0099795_10044598 3300007788 Unclassified 1591
100 Ga0105240_10154801 3300009093 Archaea 2727
101 Ga0105240_10370451 3300009093 Unclassified 1620
102 Ga0105245_10282441 3300009098 Unclassified 1623
103 Ga0105245_10924988 3300009098 Unclassified 914
104 Ga0114129_10054110 3300009147 Bacteria 5628
105 Ga0105243_10021172 3300009148 Bacteria 4935
106 Ga0105249_10122843 3300009553 Bacteria 2470
107 Ga0105239_10104025 3300010375 Unclassified 3143
108 Ga0157373_10139278 3300013100 Unclassified 1706
109 Ga0157373_10249688 3300013100 Bacteria 1255
110 Ga0157371_10266224 3300013102 Unclassified 1236
111 Ga0157374_10048405 3300013296 Bacteria 3944
112 Ga0157374_10080470 3300013296 Bacteria 3090
113 Ga0157374_10095534 3300013296 Bacteria 2842
114 Ga0157374_10118474 3300013296 Bacteria 2553
115 Ga0157374_10176218 3300013296 Bacteria 2087
116 Ga0157374_10193471 3300013296 Bacteria 1990
117 Ga0157374_10359695 3300013296 Unclassified 1447
118 Ga0157378_10154796 3300013297 Unclassified 2138
119 Ga0157378_10357114 3300013297 Bacteria 1429
120 Ga0157378_10808294 3300013297 Unclassified 964
121 Ga0157378_11033169 3300013297 Bacteria 857
122 Ga0163162_10076988 3300013306 Bacteria 3399
123 Ga0163162_10223665 3300013306 Bacteria 2012
124 Ga0163162_10276945 3300013306 Bacteria 1810
125 Ga0163162_10382411 3300013306 Unclassified 1541
126 Ga0163162_11347893 3300013306 Unclassified 811
127 Ga0157372_10047396 3300013307 Bacteria 4776
128 Ga0157372_10113880 3300013307 Bacteria 3100
129 Ga0157372_11027908 3300013307 Unclassified 954
130 Ga0157375_10045980 3300013308 Bacteria 4252
131 Ga0157375_10047316 3300013308 Bacteria 4200
132 Ga0157375_10268635 3300013308 Bacteria 1867
133 Ga0157376_10017159 3300014969 Bacteria 5514
134 Ga0157376_10096601 3300014969 Bacteria 2572
135 Ga0157376_10421452 3300014969 Bacteria 1295
136 Ga0157376_10484316 3300014969 Unclassified 1213
137 Ga0163161_10487955 3300017792 Bacteria 1001
138 Ga0207666_1009123 3300025271 Bacteria 1336
139 Ga0207697_10005583 3300025315 Bacteria 5826
140 Ga0207697_10012046 3300025315 Bacteria 3640
141 Ga0207697_10239652 3300025315 Bacteria 801
142 Ga0207697_10331685 3300025315 Unclassified 675
143 Ga0207682_10162543 3300025893 Bacteria 1012
144 Ga0207692_10326657 3300025898 Bacteria 940
145 Ga0207680_10038729 3300025903 Bacteria 2761
146 Ga0207685_10068971 3300025905 Bacteria 1427
147 Ga0207685_10069789 3300025905 Bacteria 1420
148 Ga0207699_10112809 3300025906 Bacteria 1745
149 Ga0207699_10205316 3300025906 Unclassified 1337
150 Ga0207645_10002000 3300025907 Bacteria 16372
151 Ga0207645_10004936 3300025907 Bacteria 9779
152 Ga0207645_10034472 3300025907 Bacteria 3253
153 Ga0207645_10082979 3300025907 Unclassified 2055
154 Ga0207684_10097774 3300025910 Bacteria 2506
155 Ga0207684_10194103 3300025910 Bacteria 1751
156 Ga0207695_10212766 3300025913 Bacteria 1843
157 Ga0207693_10021071 3300025915 Bacteria 5180
158 Ga0207693_10196011 3300025915 Unclassified 1589
159 Ga0207693_10378008 3300025915 Bacteria 1108
160 Ga0207693_10458278 3300025915 Unclassified 996
161 Ga0207663_10195470 3300025916 Bacteria 1455
162 Ga0207663_10405626 3300025916 Unclassified 1043
163 Ga0207662_10005245 3300025918 Bacteria 6880
164 Ga0207662_10207898 3300025918 Bacteria 1269
165 Ga0207657_10765120 3300025919 Unclassified 748
166 Ga0207646_10018910 3300025922 Bacteria 6415
167 Ga0207646_10338788 3300025922 Unclassified 1359
168 Ga0207681_10058622 3300025923 Bacteria 2637
169 Ga0207681_10129662 3300025923 Bacteria 1862
170 Ga0207650_10140998 3300025925 Bacteria 1895
171 Ga0207650_10264119 3300025925 Bacteria 1397
172 Ga0207659_10119743 3300025926 Unclassified 2016
173 Ga0207659_10156113 3300025926 Bacteria 1787
174 Ga0207659_10310539 3300025926 Archaea 1298
175 Ga0207659_10366261 3300025926 Unclassified 1199
176 Ga0207700_10023545 3300025928 Unclassified 4248
177 Ga0207700_10090404 3300025928 Bacteria 2416
178 Ga0207700_10136264 3300025928 Unclassified 2011
179 Ga0207700_10176619 3300025928 Bacteria 1785
180 Ga0207700_10572569 3300025928 Bacteria 1004
181 Ga0207664_10096667 3300025929 Unclassified 2432
182 Ga0207664_10718172 3300025929 Unclassified 899
183 Ga0207644_10059903 3300025931 Bacteria 2754
184 Ga0207644_10371610 3300025931 Unclassified 1165
185 Ga0207690_10495686 3300025932 Unclassified 987
186 Ga0207706_10022300 3300025933 Bacteria 5681
187 Ga0207706_10067209 3300025933 Bacteria 3154
188 Ga0207706_10223171 3300025933 Bacteria 1650
189 Ga0207686_10351094 3300025934 Bacteria 1110
190 Ga0207669_10009743 3300025937 Bacteria 4591
191 Ga0207704_10075047 3300025938 Bacteria 2161
192 Ga0207704_10489065 3300025938 Unclassified 989
193 Ga0207665_10215473 3300025939 Unclassified 1405
194 Ga0207665_10275672 3300025939 Unclassified 1250
195 Ga0207691_10007558 3300025940 Bacteria 10462
196 Ga0207691_10047334 3300025940 Bacteria 3946
197 Ga0207691_10116253 3300025940 Unclassified 2374
198 Ga0207679_10597935 3300025945 Unclassified 994
199 Ga0207651_10032527 3300025960 Bacteria 3352
200 Ga0207651_10064182 3300025960 Unclassified 2569
201 Ga0207651_10105847 3300025960 Bacteria 2099
202 Ga0207651_10742086 3300025960 Bacteria 867
203 Ga0207712_10373286 3300025961 Archaea 1192
204 Ga0207668_10097861 3300025972 Unclassified 2172
205 Ga0207668_10160719 3300025972 Bacteria 1750
206 Ga0207658_10060803 3300025986 Bacteria 2820
207 Ga0207658_10133721 3300025986 Bacteria 1996
208 Ga0207658_10240441 3300025986 Bacteria 1533
209 Ga0207658_10350691 3300025986 Unclassified 1285
210 Ga0207658_10684118 3300025986 Bacteria 926
211 Ga0207677_10224721 3300026023 Bacteria 1508
212 Ga0207677_10272692 3300026023 Bacteria 1385
213 Ga0207677_10293105 3300026023 Bacteria 1341
214 Ga0207702_11198124 3300026078 Unclassified 754
215 Ga0207648_10282974 3300026089 Bacteria 1483
216 Ga0207683_10073450 3300026121 Unclassified 3026
217 Ga0207683_10083080 3300026121 Unclassified 2846
218 Ga0268266_10138733 3300028379 Bacteria 2180
219 Ga0268265_10126581 3300028380 Bacteria 2115
220 Ga0268264_10308839 3300028381 Bacteria 1491
221 Ga0373935_0087184 3300035692 Bacteria 2038
222 Ga0373935_0160941 3300035692 Unclassified 1530
223 Ga0373927_0467380 3300035695 Bacteria 833
224 Ga0373947_0115221 3300035725 Bacteria 1703
225 Ga0373947_0483187 3300035725 Unclassified 841
226 Ga0373925_0371132 3300037068 Unclassified 1164
227 Ga0395905_0780855 3300037471 Unclassified 858
228 Ga0466964_0020551 3300044706 Bacteria 2544
229 Ga0466967_0252585 3300045976 Unclassified 1685
230 Ga0495592_0152867 3300046454 Archaea 1594
231 Ga0495651_0319368 3300046462 Bacteria 1036
232 Ga0495580_0300114 3300046472 Unclassified 1094
233 Ga0495652_0109024 3300046529 Bacteria 2230
234 Ga0495586_0236872 3300046535 Bacteria 1040
235 Ga0495587_0277079 3300046536 Unclassified 940
236 Ga0495645_0079909 3300046543 Unclassified 2348
237 Ga0495659_0051490 3300046664 Bacteria 1500
238 Ga0495599_0363981 3300046678 Bacteria 865
239 Ga0495623_0129916 3300046679 Unclassified 1509
240 Ga0495669_0303313 3300046684 Unclassified 770
241 Ga0495604_0366545 3300047317 Archaea 954
242 Ga0495674_0163028 3300047319 Unclassified 1864
243 Ga0495675_0152519 3300047444 Archaea 1427
244 Ga0496100_0055665 3300048903 Bacteria 2585
245 Ga0496102_0299083 3300048905 Bacteria 1517
246 Ga0496102_0671700 3300048905 Bacteria 959
247 Ga0496104_0230702 3300048907 Bacteria 1763
248 Ga0496108_0160461 3300048911 Bacteria 1943
249 Ga0496112_0134517 3300048915 Bacteria 2443
250 nmdc:mga05p37_91418_c1 3300050507 Bacteria 3750
251 Ga0495601_0261207 3300053077 Bacteria 1130
252 Ga0495612_0176073 3300053078 Bacteria 938
253 Ga0070669_100232672
254 JGI25405J52794_10019450
255 Ga0065715_10001208
256 Ga0070676_10008430
257 Ga0070676_10079155
258 Ga0070670_100010933
259 Ga0070670_100038640
260 Ga0070670_100101851
261 Ga0068869_100061109
262 Ga0070666_10563070
263 Ga0068868_100319378
264 Ga0068868_100595143
265 Ga0070660_100234235
266 Ga0070691_10144188
267 Ga0070687_100007648
268 Ga0070668_100011142
269 Ga0070668_100123071
270 Ga0070668_100500868
271 Ga0070669_100107551
272 Ga0070669_100142909
273 Ga0070669_100176357
274 Ga0070675_100065972
275 Ga0070675_100131430
276 Ga0070675_100216564
277 Ga0070675_100670610
278 Ga0070671_100215601
279 Ga0070671_100593786
280 Ga0070673_100116891
281 Ga0070673_100165448
282 Ga0070673_100341236
283 Ga0070659_100527740
284 Ga0070667_100064180
285 Ga0070667_100134574
286 Ga0070667_100158631
287 Ga0070667_100189236
288 Ga0070667_100249690
289 Ga0070667_100429310
290 Ga0070709_10060110
291 Ga0070709_10064950
292 Ga0070714_100088287
293 Ga0070714_100133072
294 Ga0070714_100938608
295 Ga0070713_100004757
296 Ga0070713_100115673
297 Ga0070710_10056979
298 Ga0070710_10359797
299 Ga0070711_100064408
300 Ga0070711_100092277
301 Ga0070711_100129664
302 Ga0070708_100800447
303 Ga0070678_100816530
304 Ga0068867_100236263
305 Ga0070706_100308191
306 Ga0070707_100028149
307 Ga0070707_100033769
308 Ga0070707_100460093
309 Ga0070707_100670385
310 Ga0070698_100006990
311 Ga0070698_100190598
312 Ga0070697_100007124
313 Ga0070697_100428251
314 Ga0070697_100487661
315 Ga0070672_100033189
316 Ga0070672_100081884
317 Ga0070665_100039399
318 Ga0070665_100940647
319 Ga0070704_100538085
320 Ga0070704_100645580
321 Ga0070664_100622742
322 Ga0068852_100537128
323 Ga0068861_100190300
324 Ga0068860_100109848
325 Ga0068862_100100020
326 Ga0081455_10002999
327 Ga0081455_10007231
328 Ga0081455_10015513
329 Ga0081455_10044007
330 Ga0081455_10168504
331 Ga0081540_1001169
332 Ga0081540_1016889
333 Ga0081540_1099606
334 Ga0081539_10264199
335 Ga0070717_10025335
336 Ga0070717_10102675
337 Ga0070717_10125307
338 Ga0070716_100258031
339 Ga0070712_100150079
340 Ga0070712_100214254
341 Ga0070712_100524097
342 Ga0097621_100053593
343 Ga0097621_100498167
344 Ga0068871_100056739
345 Ga0068871_100063844
346 Ga0075433_10181895
347 Ga0075433_10622159
348 Ga0075434_100144528
349 Ga0068865_100210150
350 Ga0068865_100235022
351 Ga0099795_10044598
352 Ga0105240_10154801
353 Ga0105240_10370451
354 Ga0105245_10282441
355 Ga0105245_10924988
356 Ga0114129_10054110
357 Ga0105243_10021172
358 Ga0105249_10122843
359 Ga0105239_10104025
360 Ga0157373_10139278
361 Ga0157373_10249688
362 Ga0157371_10266224
363 Ga0157374_10048405
364 Ga0157374_10080470
365 Ga0157374_10095534
366 Ga0157374_10118474
367 Ga0157374_10176218
368 Ga0157374_10193471
369 Ga0157374_10359695
370 Ga0157378_10154796
371 Ga0157378_10357114
372 Ga0157378_10808294
373 Ga0157378_11033169
374 Ga0163162_10076988
375 Ga0163162_10223665
376 Ga0163162_10276945
377 Ga0163162_10382411
378 Ga0163162_11347893
379 Ga0157372_10047396
380 Ga0157372_10113880
381 Ga0157372_11027908
382 Ga0157375_10045980
383 Ga0157375_10047316
384 Ga0157375_10268635
385 Ga0157376_10017159
386 Ga0157376_10096601
387 Ga0157376_10421452
388 Ga0157376_10484316
389 Ga0163161_10487955
390 Ga0207666_1009123
391 Ga0207697_10005583
392 Ga0207697_10012046
393 Ga0207697_10239652
394 Ga0207697_10331685
395 Ga0207682_10162543
396 Ga0207692_10326657
397 Ga0207680_10038729
398 Ga0207685_10068971
399 Ga0207685_10069789
400 Ga0207699_10112809
401 Ga0207699_10205316
402 Ga0207645_10002000
403 Ga0207645_10004936
404 Ga0207645_10034472
405 Ga0207645_10082979
406 Ga0207684_10097774
407 Ga0207684_10194103
408 Ga0207695_10212766
409 Ga0207693_10021071
410 Ga0207693_10196011
411 Ga0207693_10378008
412 Ga0207693_10458278
413 Ga0207663_10195470
414 Ga0207663_10405626
415 Ga0207662_10005245
416 Ga0207662_10207898
417 Ga0207657_10765120
418 Ga0207646_10018910
419 Ga0207646_10338788
420 Ga0207681_10058622
421 Ga0207681_10129662
422 Ga0207650_10140998
423 Ga0207650_10264119
424 Ga0207659_10119743
425 Ga0207659_10156113
426 Ga0207659_10310539
427 Ga0207659_10366261
428 Ga0207700_10023545
429 Ga0207700_10090404
430 Ga0207700_10136264
431 Ga0207700_10176619
432 Ga0207700_10572569
433 Ga0207664_10096667
434 Ga0207664_10718172
435 Ga0207644_10059903
436 Ga0207644_10371610
437 Ga0207690_10495686
438 Ga0207706_10022300
439 Ga0207706_10067209
440 Ga0207706_10223171
441 Ga0207686_10351094
442 Ga0207669_10009743
443 Ga0207704_10075047
444 Ga0207704_10489065
445 Ga0207665_10215473
446 Ga0207665_10275672
447 Ga0207691_10007558
448 Ga0207691_10047334
449 Ga0207691_10116253
450 Ga0207679_10597935
451 Ga0207651_10032527
452 Ga0207651_10064182
453 Ga0207651_10105847
454 Ga0207651_10742086
455 Ga0207712_10373286
456 Ga0207668_10097861
457 Ga0207668_10160719
458 Ga0207658_10060803
459 Ga0207658_10133721
460 Ga0207658_10240441
461 Ga0207658_10350691
462 Ga0207658_10684118
463 Ga0207677_10224721
464 Ga0207677_10272692
465 Ga0207677_10293105
466 Ga0207702_11198124
467 Ga0207648_10282974
468 Ga0207683_10073450
469 Ga0207683_10083080
470 Ga0268266_10138733
471 Ga0268265_10126581
472 Ga0268264_10308839
473 Ga0373935_0087184
474 Ga0373935_0160941
475 Ga0373927_0467380
476 Ga0373947_0115221
477 Ga0373947_0483187
478 Ga0373925_0371132
479 Ga0395905_0780855
480 Ga0466964_0020551
481 Ga0466967_0252585
482 Ga0495592_0152867
483 Ga0495651_0319368
484 Ga0495580_0300114
485 Ga0495652_0109024
486 Ga0495586_0236872
487 Ga0495587_0277079
488 Ga0495645_0079909
489 Ga0495659_0051490
490 Ga0495599_0363981
491 Ga0495623_0129916
492 Ga0495669_0303313
493 Ga0495604_0366545
494 Ga0495674_0163028
495 Ga0495675_0152519
496 Ga0496100_0055665
497 Ga0496102_0299083
498 Ga0496102_0671700
499 Ga0496104_0230702
500 Ga0496108_0160461
501 Ga0496112_0134517
502 nmdc:mga05p37_91418_c1
503 Ga0495601_0261207
504 Ga0495612_0176073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q48-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa cupb2 chaperone 0.745 52 172
3q48-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa cupb2 chaperone 0.701 52 173
5ghu-assembly1.cif.gz_A crystal structure of yadv chaperone at 1.63 angstrom 0.6141 52 172
1xi0-assembly1.cif.gz_A x-ray crystal structure of wild-type xerocomus chrysenteron lectin xcl 0.5823 74 181
4aby-assembly2.cif.gz_B crystal structure of deinococcus radiodurans recn head domain 0.5569 154 187
ID Description Score Start End Superfamily
af_P91641_1_215_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7745 151 182 2.40.320.10
af_D3ZYU1_95_563_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7725 154 190 2.130.10.10
af_Q4TTB0_48_317_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7572 154 186 3.80.10.10
af_A0A0R0LFK6_355_940_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7483 154 181 2.130.10.10
af_A0A1D6FTB2_49_265_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7168 147 181 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V5VD17-F1-model_v4 PDZ domain-containing protein 0.9597 67 195
AF-A0A1G8PUT6-F1-model_v4 Uncharacterized protein 0.9302 153 182 GO:0016020
AF-A0A2V5VD17-F1-model_v4 PDZ domain-containing protein 0.925 67 195
AF-A0A2K4IRP2-F1-model_v4 deleted 0.9123 153 182
AF-A0A2V5R8N8-F1-model_v4 Uncharacterized protein 0.9114 6 195 GO:0016020

Map