F362366

General Info

Members Datasets Scaffolds Average Seq Length
251 147 251 87

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11433258|Ga0111539_114332582
Length 96
Sequence LEEIRLAHHASALKAMRQGVKRNERNRQNLSQLKSQVKKLRAAIATGDAAEAKKALGETVSQIDKAAKKGVIHDNAASRYKSRLSRRLNGMSAPRA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 0
Rhizoplane 0
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10074752 3300003320 Bacteria 4929
2 Ga0070676_10426966 3300005328 Unclassified 927
3 Ga0070683_100826511 3300005329 Unclassified 888
4 Ga0068869_100578266 3300005334 Bacteria 947
5 Ga0068869_101380559 3300005334 Bacteria 623
6 Ga0070691_10553941 3300005341 Bacteria 672
7 Ga0070661_100374467 3300005344 Unclassified 1121
8 Ga0070668_101788565 3300005347 Bacteria 565
9 Ga0070669_100388841 3300005353 Unclassified 1139
10 Ga0070669_101745739 3300005353 Unclassified 543
11 Ga0070671_101547717 3300005355 Bacteria 587
12 Ga0070674_101462740 3300005356 Archaea 613
13 Ga0070705_100014173 3300005440 Bacteria 4096
14 Ga0070705_100153162 3300005440 Bacteria 1532
15 Ga0070700_100058914 3300005441 Bacteria 2415
16 Ga0070700_100652452 3300005441 Archaea 831
17 Ga0070700_100901165 3300005441 Bacteria 720
18 Ga0070700_101001569 3300005441 Bacteria 687
19 Ga0070694_100008437 3300005444 Bacteria 6304
20 Ga0070694_100085906 3300005444 Unclassified 2198
21 Ga0070694_100135178 3300005444 Bacteria 1786
22 Ga0070694_100488927 3300005444 Archaea 978
23 Ga0070694_100709289 3300005444 Bacteria 819
24 Ga0070694_100713557 3300005444 Bacteria 816
25 Ga0070694_101015525 3300005444 Bacteria 689
26 Ga0070708_100761071 3300005445 Bacteria 911
27 Ga0070708_101636845 3300005445 Bacteria 599
28 Ga0070708_101666623 3300005445 Unclassified 593
29 Ga0070662_100930361 3300005457 Unclassified 743
30 Ga0070706_100024659 3300005467 Bacteria 5537
31 Ga0070706_100047753 3300005467 Bacteria 3951
32 Ga0070706_100770071 3300005467 Bacteria 891
33 Ga0070706_101984224 3300005467 Bacteria 527
34 Ga0070707_100021996 3300005468 Bacteria 6029
35 Ga0070707_100315373 3300005468 Bacteria 1520
36 Ga0070698_100006796 3300005471 Bacteria 12401
37 Ga0070698_100063921 3300005471 Bacteria 3710
38 Ga0070698_100090281 3300005471 Bacteria 3047
39 Ga0070698_101627862 3300005471 Bacteria 598
40 Ga0070699_100003673 3300005518 Bacteria 13595
41 Ga0070699_100020859 3300005518 Bacteria 5650
42 Ga0070699_100564599 3300005518 Bacteria 1036
43 Ga0070699_101786710 3300005518 Bacteria 563
44 Ga0070697_100054782 3300005536 Unclassified 3242
45 Ga0070697_100068070 3300005536 Bacteria 2914
46 Ga0070672_101466143 3300005543 Bacteria 611
47 Ga0070695_100034447 3300005545 Bacteria 3175
48 Ga0070695_100276281 3300005545 Bacteria 1232
49 Ga0070695_101643747 3300005545 Archaea 537
50 Ga0070696_100081683 3300005546 Bacteria 2290
51 Ga0070696_100240581 3300005546 Bacteria 1365
52 Ga0070696_100792036 3300005546 Bacteria 780
53 Ga0070696_100822966 3300005546 Archaea 766
54 Ga0070693_101385454 3300005547 Archaea 546
55 Ga0070665_100000099 3300005548 Bacteria 163970
56 Ga0070704_100076766 3300005549 Bacteria 2445
57 Ga0070704_100100054 3300005549 Bacteria 2182
58 Ga0070704_100123737 3300005549 Archaea 1992
59 Ga0070704_100240208 3300005549 Unclassified 1482
60 Ga0070704_100654435 3300005549 Bacteria 928
61 Ga0068857_101673083 3300005577 Bacteria 622
62 Ga0068854_102234382 3300005578 Bacteria 506
63 Ga0068856_100501406 3300005614 Unclassified 1235
64 Ga0070702_100714460 3300005615 Bacteria 765
65 Ga0068859_100429175 3300005617 Bacteria 1418
66 Ga0068864_102568432 3300005618 Bacteria 515
67 Ga0068861_100045883 3300005719 Bacteria 3293
68 Ga0068863_100000601 3300005841 Bacteria 36569
69 Ga0068858_100004572 3300005842 Bacteria 13546
70 Ga0068860_100242311 3300005843 Unclassified 1754
71 Ga0068860_102113109 3300005843 Unclassified 584
72 Ga0068862_100725150 3300005844 Bacteria 965
73 Ga0068862_102317997 3300005844 Bacteria 548
74 Ga0081455_10034063 3300005937 Bacteria 4568
75 Ga0070717_10496660 3300006028 Bacteria 1102
76 Ga0075365_10052057 3300006038 Bacteria 2706
77 Ga0075365_10123120 3300006038 Bacteria 1790
78 Ga0075368_10082423 3300006042 Unclassified 1310
79 Ga0075368_10400976 3300006042 Bacteria 602
80 Ga0075363_100040625 3300006048 Bacteria 2452
81 Ga0075364_10231206 3300006051 Bacteria 1256
82 Ga0075364_10458477 3300006051 Bacteria 871
83 Ga0075367_10011977 3300006178 Unclassified 4607
84 Ga0075367_10999955 3300006178 Bacteria 534
85 Ga0075366_10175768 3300006195 Unclassified 1300
86 Ga0075428_101345918 3300006844 Bacteria 750
87 Ga0075428_101496412 3300006844 Unclassified 707
88 Ga0075431_100000177 3300006847 Bacteria 45440
89 Ga0075431_100182479 3300006847 Bacteria 2153
90 Ga0075431_102029310 3300006847 Bacteria 530
91 Ga0075433_10062474 3300006852 Bacteria 3262
92 Ga0075433_10233512 3300006852 Bacteria 1633
93 Ga0075433_11401881 3300006852 Bacteria 604
94 Ga0075433_11715424 3300006852 Bacteria 541
95 Ga0075434_100236194 3300006871 Bacteria 1848
96 Ga0075434_101151359 3300006871 Unclassified 788
97 Ga0075436_100099104 3300006914 Bacteria 2028
98 Ga0075436_100830489 3300006914 Bacteria 689
99 Ga0097620_100429109 3300006931 Bacteria 1418
100 Ga0075435_100718152 3300007076 Bacteria 869
101 Ga0075435_101949021 3300007076 Unclassified 516
102 Ga0105240_10005027 3300009093 Bacteria 19848
103 Ga0105240_10141630 3300009093 Bacteria 2874
104 Ga0105240_10191397 3300009093 Bacteria 2405
105 Ga0111539_10059840 3300009094 Bacteria 4516
106 Ga0111539_10314589 3300009094 Bacteria 1822
107 Ga0111539_11433258 3300009094 Bacteria 801
108 Ga0105247_10170192 3300009101 Unclassified 1448
109 Ga0105247_10232508 3300009101 Bacteria 1252
110 Ga0114129_10011178 3300009147 Bacteria 12799
111 Ga0114129_10065310 3300009147 Bacteria 5079
112 Ga0114129_10356206 3300009147 Bacteria 1937
113 Ga0114129_11493834 3300009147 Bacteria 830
114 Ga0105241_10475031 3300009174 Unclassified 1110
115 Ga0105248_12253964 3300009177 Unclassified 620
116 Ga0105237_10010702 3300009545 Bacteria 9737
117 Ga0105238_10594462 3300009551 Unclassified 1114
118 Ga0105239_11030110 3300010375 Unclassified 947
119 Ga0105246_11606772 3300011119 Bacteria 614
120 Ga0157374_10577413 3300013296 Unclassified 1133
121 Ga0157380_10048616 3300014326 Bacteria 3341
122 Ga0157380_10056279 3300014326 Bacteria 3127
123 Ga0157377_10000087 3300014745 Bacteria 69130
124 Ga0207653_10004673 3300025885 Bacteria 4292
125 Ga0207710_10450579 3300025900 Unclassified 664
126 Ga0207645_10790553 3300025907 Unclassified 645
127 Ga0207684_10046772 3300025910 Bacteria 3671
128 Ga0207684_10191640 3300025910 Unclassified 1763
129 Ga0207684_10505196 3300025910 Bacteria 1036
130 Ga0207684_11551825 3300025910 Unclassified 537
131 Ga0207654_10226239 3300025911 Bacteria 1243
132 Ga0207695_10010964 3300025913 Bacteria 11021
133 Ga0207695_10096138 3300025913 Bacteria 2964
134 Ga0207671_10008486 3300025914 Bacteria 8706
135 Ga0207649_10506164 3300025920 Unclassified 919
136 Ga0207646_10009322 3300025922 Bacteria 9709
137 Ga0207646_10233880 3300025922 Bacteria 1660
138 Ga0207681_10158605 3300025923 Bacteria 1703
139 Ga0207694_10044961 3300025924 Unclassified 3410
140 Ga0207670_11555088 3300025936 Bacteria 562
141 Ga0207669_11261810 3300025937 Bacteria 627
142 Ga0207669_11577816 3300025937 Unclassified 560
143 Ga0207665_10076808 3300025939 Bacteria 2291
144 Ga0207711_11628488 3300025941 Unclassified 589
145 Ga0207689_10134622 3300025942 Bacteria 2035
146 Ga0207689_10650320 3300025942 Bacteria 888
147 Ga0207689_11814944 3300025942 Bacteria 503
148 Ga0207661_10735187 3300025944 Bacteria 908
149 Ga0207668_10983553 3300025972 Bacteria 754
150 Ga0207703_10006369 3300026035 Bacteria 9433
151 Ga0207703_11271541 3300026035 Bacteria 708
152 Ga0207703_11724729 3300026035 Bacteria 602
153 Ga0207639_10498287 3300026041 Unclassified 1112
154 Ga0207678_11162803 3300026067 Bacteria 683
155 Ga0207708_10078344 3300026075 Bacteria 2537
156 Ga0207708_10820452 3300026075 Bacteria 802
157 Ga0207708_11276023 3300026075 Bacteria 643
158 Ga0207702_10399723 3300026078 Unclassified 1325
159 Ga0207641_10030669 3300026088 Bacteria 4454
160 Ga0207676_10551810 3300026095 Unclassified 1101
161 Ga0207674_10791108 3300026116 Bacteria 915
162 Ga0207675_100068527 3300026118 Bacteria 3316
163 Ga0209971_1119920 3300027682 Bacteria 646
164 Ga0209966_1072198 3300027695 Unclassified 757
165 Ga0209813_10253903 3300027866 Bacteria 669
166 Ga0207428_10259735 3300027907 Bacteria 1294
167 Ga0207428_10965819 3300027907 Bacteria 600
168 Ga0268266_10000116 3300028379 Bacteria 163984
169 Ga0268265_10644732 3300028380 Bacteria 1017
170 Ga0268265_12263148 3300028380 Bacteria 550
171 Ga0307511_10000140 3300030521 Bacteria 67183
172 Ga0265771_1004867 3300031010 Unclassified 833
173 Ga0316575_10149982 3300031665 Bacteria 962
174 Ga0316578_10417594 3300031728 Bacteria 794
175 Ga0316583_10232260 3300032133 Bacteria 639
176 Ga0316585_10170767 3300032137 Bacteria 718
177 Ga0373961_0212191 3300035241 Unclassified 687
178 Ga0316574_0024057 3300035398 Bacteria 3642
179 Ga0316582_0045916 3300036647 Unclassified 2752
180 Ga0316584_0064881 3300036712 Bacteria 2735
181 Ga0316584_0936288 3300036712 Bacteria 582
182 Ga0436364_1415213 3300037853 Bacteria 772
183 Ga0439435_0089259 3300042436 Bacteria 934
184 Ga0453684_1086801 3300044712 Bacteria 846
185 Ga0495638_0055872 3300046460 Bacteria 2450
186 Ga0501031_0118100 3300049568 Bacteria 1733
187 Ga0501038_1389089 3300049574 Bacteria 505
188 Ga0501039_0307109 3300049575 Unclassified 1247
189 Ga0501040_0449569 3300049576 Bacteria 927
190 Ga0501041_0162080 3300049577 Bacteria 1398
191 Ga0501042_0170816 3300049578 Bacteria 1569
192 Ga0501048_0826066 3300049582 Bacteria 666
193 Ga0501070_0240023 3300049586 Bacteria 1484
194 Ga0501072_0189611 3300049588 Bacteria 1640
195 Ga0501072_1276132 3300049588 Bacteria 570
196 Ga0501074_0168731 3300049590 Bacteria 1563
197 Ga0501074_0651544 3300049590 Bacteria 744
198 Ga0501075_0200457 3300049591 Bacteria 1522
199 Ga0501075_0383835 3300049591 Bacteria 1071
200 Ga0501075_0859706 3300049591 Bacteria 690
201 Ga0501075_0863731 3300049591 Bacteria 688
202 Ga0501076_0021719 3300049592 Bacteria 4927
203 Ga0501076_0370085 3300049592 Bacteria 1178
204 Ga0501076_0571777 3300049592 Bacteria 932
205 Ga0501077_1012963 3300049593 Bacteria 534
206 Ga0501077_1064439 3300049593 Bacteria 520
207 Ga0501079_0042744 3300049741 Bacteria 3499
208 Ga0501079_0354924 3300049741 Bacteria 1149
209 Ga0501079_0541741 3300049741 Bacteria 915
210 Ga0501080_0851467 3300049742 Bacteria 797
211 Ga0501081_0047921 3300049743 Bacteria 2940
212 Ga0501081_0106806 3300049743 Bacteria 1985
213 Ga0501081_0275605 3300049743 Unclassified 1231
214 Ga0501083_0612767 3300049744 Bacteria 708
215 Ga0501035_0636713 3300049822 Bacteria 866
216 Ga0501045_0125718 3300049824 Bacteria 1905
217 Ga0501045_0206539 3300049824 Bacteria 1463
218 Ga0501045_1081654 3300049824 Bacteria 587
219 nmdc:mga03n38_149400_c1 3300050490 Bacteria 1174
220 nmdc:mga00v17_288590_c1 3300050491 Bacteria 1065
221 nmdc:mga00v17_49886_c1 3300050491 Bacteria 2540
222 nmdc:mga00v17_550985_c1 3300050491 Unclassified 746
223 nmdc:mga0yw44_53240_c1 3300050492 Bacteria 2457
224 nmdc:mga0k408_139526_c1 3300050493 Unclassified 1441
225 nmdc:mga06z11_724676_c1 3300050494 Bacteria 606
226 nmdc:mga06z11_7880_c1 3300050494 Unclassified 4410
227 nmdc:mga06z11_875692_c1 3300050494 Bacteria 547
228 nmdc:mga04h51_81736_c1 3300050495 Unclassified 1148
229 nmdc:mga07m45_863104_c1 3300050496 Bacteria 518
230 nmdc:mga05p37_1105132_c1 3300050507 Bacteria 830
231 nmdc:mga05p37_1514356_c1 3300050507 Bacteria 667
232 nmdc:mga05p37_227859_c1 3300050507 Bacteria 2246
233 nmdc:mga05p37_31419_c2 3300050507 Bacteria 5633
234 nmdc:mga05p37_477090_c1 3300050507 Bacteria 1438
235 nmdc:mga06r32_1679_c1 3300050510 Bacteria 19938
236 nmdc:mga06r32_41750_c1 3300050510 Bacteria 4359
237 nmdc:mga08y16_352562_c1 3300050511 Bacteria 1511
238 nmdc:mga08y16_9539_c1 3300050511 Bacteria 10186
239 nmdc:mga0n895_137534_c1 3300050512 Bacteria 2470
240 nmdc:mga0n895_314149_c1 3300050512 Bacteria 1588
241 nmdc:mga0rr50_1681677_c1 3300050513 Unclassified 535
242 nmdc:mga0rr50_706447_c1 3300050513 Bacteria 860
243 nmdc:mga08x19_134281_c1 3300050514 Bacteria 1667
244 nmdc:mga08x19_700510_c1 3300050514 Bacteria 719
245 nmdc:mga0a205_1195867_c1 3300050515 Bacteria 608
246 nmdc:mga0a205_14918_c1 3300050515 Bacteria 7250
247 nmdc:mga0a205_204266_c1 3300050515 Bacteria 1865
248 Ga0501084_0407510 3300054114 Bacteria 1149
249 Ga0501082_0102621 3300060353 Unclassified 2474
250 Ga0501082_0908488 3300060353 Bacteria 770
251 Ga0501082_1031310 3300060353 Bacteria 719

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100564599 Ga0070699_1005645992 75
2 3300006844 Ga0075428_101345918 Ga0075428_1013459182 75
3 3300009094 Ga0111539_10314589 Ga0111539_103145892 75
4 3300009147 Ga0114129_10011178 Ga0114129_100111785 75
5 3300009147 Ga0114129_10065310 Ga0114129_100653104 75
6 3300009147 Ga0114129_11493834 Ga0114129_114938342 75
7 3300014326 Ga0157380_10056279 Ga0157380_100562792 75
8 3300025910 Ga0207684_11551825 Ga0207684_115518252 75
9 3300042436 Ga0439435_0089259 Ga0439435_0089259_256_501 75
10 3300044712 Ga0453684_1086801 Ga0453684_1086801_451_690 75
11 3300046460 Ga0495638_0055872 Ga0495638_0055872_930_1172 75
12 3300049568 Ga0501031_0118100 Ga0501031_0118100_25_267 75
13 3300049575 Ga0501039_0307109 Ga0501039_0307109_248_487 75
14 3300049576 Ga0501040_0449569 Ga0501040_0449569_383_622 75
15 3300049577 Ga0501041_0162080 Ga0501041_0162080_585_824 75
16 3300049578 Ga0501042_0170816 Ga0501042_0170816_982_1224 75
17 3300049582 Ga0501048_0826066 Ga0501048_0826066_109_348 75
18 3300049586 Ga0501070_0240023 Ga0501070_0240023_1219_1461 75
19 3300049588 Ga0501072_0189611 Ga0501072_0189611_444_683 75
20 3300049588 Ga0501072_1276132 Ga0501072_1276132_139_381 75
21 3300049590 Ga0501074_0168731 Ga0501074_0168731_601_843 75
22 3300049590 Ga0501074_0651544 Ga0501074_0651544_173_415 75
23 3300049591 Ga0501075_0200457 Ga0501075_0200457_254_493 75
24 3300049591 Ga0501075_0383835 Ga0501075_0383835_148_390 75
25 3300049591 Ga0501075_0859706 Ga0501075_0859706_432_674 75
26 3300049591 Ga0501075_0863731 Ga0501075_0863731_434_676 75
27 3300049592 Ga0501076_0021719 Ga0501076_0021719_3626_3865 75
28 3300049592 Ga0501076_0370085 Ga0501076_0370085_214_453 75
29 3300049593 Ga0501077_1064439 Ga0501077_1064439_228_467 75
30 3300049741 Ga0501079_0042744 Ga0501079_0042744_2120_2359 75
31 3300049741 Ga0501079_0541741 Ga0501079_0541741_369_611 75
32 3300049742 Ga0501080_0851467 Ga0501080_0851467_262_501 75
33 3300049743 Ga0501081_0047921 Ga0501081_0047921_819_1058 75
34 3300049743 Ga0501081_0275605 Ga0501081_0275605_15_257 75
35 3300049744 Ga0501083_0612767 Ga0501083_0612767_277_519 75
36 3300049822 Ga0501035_0636713 Ga0501035_0636713_369_611 75
37 3300049824 Ga0501045_0125718 Ga0501045_0125718_1419_1661 75
38 3300049824 Ga0501045_0206539 Ga0501045_0206539_776_1015 75
39 3300049824 Ga0501045_1081654 Ga0501045_1081654_325_570 75
40 3300050490 nmdc:mga03n38_149400_c1 nmdc:mga03n38_149400_c1_199_441 75
41 3300050494 nmdc:mga06z11_875692_c1 nmdc:mga06z11_875692_c1_114_356 75
42 3300050496 nmdc:mga07m45_863104_c1 nmdc:mga07m45_863104_c1_246_488 75
43 3300050507 nmdc:mga05p37_1105132_c1 nmdc:mga05p37_1105132_c1_311_553 75
44 3300050507 nmdc:mga05p37_1514356_c1 nmdc:mga05p37_1514356_c1_394_630 75
45 3300050507 nmdc:mga05p37_31419_c2 nmdc:mga05p37_31419_c2_4980_5222 75
46 3300050507 nmdc:mga05p37_477090_c1 nmdc:mga05p37_477090_c1_219_470 75
47 3300050510 nmdc:mga06r32_41750_c1 nmdc:mga06r32_41750_c1_731_973 75
48 3300050511 nmdc:mga08y16_352562_c1 nmdc:mga08y16_352562_c1_711_953 75
49 3300050512 nmdc:mga0n895_137534_c1 nmdc:mga0n895_137534_c1_18_269 75
50 3300054114 Ga0501084_0407510 Ga0501084_0407510_134_373 75
51 3300060353 Ga0501082_0102621 Ga0501082_0102621_216_455 75
52 3300060353 Ga0501082_1031310 Ga0501082_1031310_98_340 75
53 3300005355 Ga0070671_101547717 Ga0070671_1015477171 77
54 3300005615 Ga0070702_100714460 Ga0070702_1007144602 77
55 3300025937 Ga0207669_11577816 Ga0207669_115778162 77
56 3300036647 Ga0316582_0045916 Ga0316582_0045916_1392_1646 78
57 3300036712 Ga0316584_0936288 Ga0316584_0936288_153_407 78
58 3300049743 Ga0501081_0106806 Ga0501081_0106806_556_816 78
59 3300005328 Ga0070676_10426966 Ga0070676_104269662 80
60 3300005329 Ga0070683_100826511 Ga0070683_1008265111 80
61 3300005353 Ga0070669_101745739 Ga0070669_1017457391 80
62 3300005577 Ga0068857_101673083 Ga0068857_1016730832 80
63 3300005578 Ga0068854_102234382 Ga0068854_1022343822 80
64 3300014745 Ga0157377_10000087 Ga0157377_1000008768 80
65 3300025907 Ga0207645_10790553 Ga0207645_107905532 80
66 3300025936 Ga0207670_11555088 Ga0207670_115550881 80
67 3300025942 Ga0207689_11814944 Ga0207689_118149442 80
68 3300025944 Ga0207661_10735187 Ga0207661_107351872 80
69 3300026116 Ga0207674_10791108 Ga0207674_107911082 80
70 3300005445 Ga0070708_101666623 Ga0070708_1016666231 81
71 3300005467 Ga0070706_100024659 Ga0070706_1000246597 81
72 3300005468 Ga0070707_100315373 Ga0070707_1003153732 81
73 3300005471 Ga0070698_100090281 Ga0070698_1000902814 81
74 3300005518 Ga0070699_100020859 Ga0070699_1000208596 81
75 3300005536 Ga0070697_100054782 Ga0070697_1000547822 81
76 3300006028 Ga0070717_10496660 Ga0070717_104966602 81
77 3300006914 Ga0075436_100830489 Ga0075436_1008304892 81
78 3300007076 Ga0075435_101949021 Ga0075435_1019490212 81
79 3300025910 Ga0207684_10191640 Ga0207684_101916402 81
80 3300025922 Ga0207646_10233880 Ga0207646_102338802 81
81 3300025939 Ga0207665_10076808 Ga0207665_100768082 81
82 3300050513 nmdc:mga0rr50_1681677_c1 nmdc:mga0rr50_1681677_c1_133_387 81
83 3300050514 nmdc:mga08x19_700510_c1 nmdc:mga08x19_700510_c1_131_385 81
84 3300005334 Ga0068869_100578266 Ga0068869_1005782661 85
85 3300005334 Ga0068869_101380559 Ga0068869_1013805592 85
86 3300005341 Ga0070691_10553941 Ga0070691_105539411 85
87 3300005347 Ga0070668_101788565 Ga0070668_1017885652 85
88 3300005353 Ga0070669_100388841 Ga0070669_1003888412 85
89 3300005356 Ga0070674_101462740 Ga0070674_1014627402 85
90 3300005440 Ga0070705_100014173 Ga0070705_1000141732 85
91 3300005440 Ga0070705_100153162 Ga0070705_1001531622 85
92 3300005441 Ga0070700_100058914 Ga0070700_1000589144 85
93 3300005441 Ga0070700_100652452 Ga0070700_1006524522 85
94 3300005441 Ga0070700_100901165 Ga0070700_1009011652 85
95 3300005441 Ga0070700_101001569 Ga0070700_1010015691 85
96 3300005444 Ga0070694_100008437 Ga0070694_1000084377 85
97 3300005444 Ga0070694_100085906 Ga0070694_1000859062 85
98 3300005444 Ga0070694_100135178 Ga0070694_1001351782 85
99 3300005444 Ga0070694_100488927 Ga0070694_1004889272 85
100 3300005444 Ga0070694_100709289 Ga0070694_1007092892 85
101 3300005444 Ga0070694_100713557 Ga0070694_1007135571 85
102 3300005444 Ga0070694_101015525 Ga0070694_1010155252 85
103 3300005445 Ga0070708_100761071 Ga0070708_1007610712 85
104 3300005445 Ga0070708_101636845 Ga0070708_1016368452 85
105 3300005457 Ga0070662_100930361 Ga0070662_1009303611 85
106 3300005467 Ga0070706_100047753 Ga0070706_1000477534 85
107 3300005467 Ga0070706_100770071 Ga0070706_1007700712 85
108 3300005467 Ga0070706_101984224 Ga0070706_1019842242 85
109 3300005468 Ga0070707_100021996 Ga0070707_1000219964 85
110 3300005471 Ga0070698_100006796 Ga0070698_1000067969 85
111 3300005471 Ga0070698_100063921 Ga0070698_1000639214 85
112 3300005471 Ga0070698_101627862 Ga0070698_1016278622 85
113 3300005518 Ga0070699_100003673 Ga0070699_10000367310 85
114 3300005518 Ga0070699_101786710 Ga0070699_1017867101 85
115 3300005536 Ga0070697_100068070 Ga0070697_1000680702 85
116 3300005543 Ga0070672_101466143 Ga0070672_1014661431 85
117 3300005545 Ga0070695_100034447 Ga0070695_1000344472 85
118 3300005545 Ga0070695_100276281 Ga0070695_1002762812 85
119 3300005545 Ga0070695_101643747 Ga0070695_1016437472 85
120 3300005546 Ga0070696_100081683 Ga0070696_1000816832 85
121 3300005546 Ga0070696_100240581 Ga0070696_1002405812 85
122 3300005546 Ga0070696_100792036 Ga0070696_1007920362 85
123 3300005546 Ga0070696_100822966 Ga0070696_1008229661 85
124 3300005547 Ga0070693_101385454 Ga0070693_1013854542 85
125 3300005549 Ga0070704_100076766 Ga0070704_1000767662 85
126 3300005549 Ga0070704_100100054 Ga0070704_1001000542 85
127 3300005549 Ga0070704_100123737 Ga0070704_1001237373 85
128 3300005549 Ga0070704_100240208 Ga0070704_1002402082 85
129 3300005549 Ga0070704_100654435 Ga0070704_1006544352 85
130 3300005617 Ga0068859_100429175 Ga0068859_1004291753 85
131 3300005719 Ga0068861_100045883 Ga0068861_1000458832 85
132 3300005843 Ga0068860_102113109 Ga0068860_1021131091 85
133 3300005844 Ga0068862_100725150 Ga0068862_1007251501 85
134 3300005844 Ga0068862_102317997 Ga0068862_1023179972 85
135 3300005937 Ga0081455_10034063 Ga0081455_100340633 85
136 3300006038 Ga0075365_10052057 Ga0075365_100520572 85
137 3300006038 Ga0075365_10123120 Ga0075365_101231202 85
138 3300006042 Ga0075368_10082423 Ga0075368_100824232 85
139 3300006042 Ga0075368_10400976 Ga0075368_104009761 85
140 3300006048 Ga0075363_100040625 Ga0075363_1000406252 85
141 3300006051 Ga0075364_10231206 Ga0075364_102312062 85
142 3300006051 Ga0075364_10458477 Ga0075364_104584772 85
143 3300006178 Ga0075367_10011977 Ga0075367_100119773 85
144 3300006178 Ga0075367_10999955 Ga0075367_109999551 85
145 3300006195 Ga0075366_10175768 Ga0075366_101757682 85
146 3300006844 Ga0075428_101496412 Ga0075428_1014964122 85
147 3300006847 Ga0075431_100000177 Ga0075431_10000017721 85
148 3300006847 Ga0075431_100182479 Ga0075431_1001824792 85
149 3300006847 Ga0075431_102029310 Ga0075431_1020293102 85
150 3300006852 Ga0075433_10062474 Ga0075433_100624742 85
151 3300006852 Ga0075433_10233512 Ga0075433_102335122 85
152 3300006852 Ga0075433_11401881 Ga0075433_114018811 85
153 3300006852 Ga0075433_11715424 Ga0075433_117154241 85
154 3300006871 Ga0075434_101151359 Ga0075434_1011513592 85
155 3300006931 Ga0097620_100429109 Ga0097620_1004291092 85
156 3300009094 Ga0111539_10059840 Ga0111539_100598402 85
157 3300009094 Ga0111539_11433258 Ga0111539_114332582 85
158 3300009101 Ga0105247_10232508 Ga0105247_102325082 85
159 3300009147 Ga0114129_10356206 Ga0114129_103562061 85
160 3300011119 Ga0105246_11606772 Ga0105246_116067721 85
161 3300013296 Ga0157374_10577413 Ga0157374_105774132 85
162 3300014326 Ga0157380_10048616 Ga0157380_100486162 85
163 3300025885 Ga0207653_10004673 Ga0207653_100046732 85
164 3300025910 Ga0207684_10046772 Ga0207684_100467724 85
165 3300025910 Ga0207684_10505196 Ga0207684_105051962 85
166 3300025922 Ga0207646_10009322 Ga0207646_100093224 85
167 3300025923 Ga0207681_10158605 Ga0207681_101586052 85
168 3300025937 Ga0207669_11261810 Ga0207669_112618101 85
169 3300025942 Ga0207689_10134622 Ga0207689_101346222 85
170 3300025942 Ga0207689_10650320 Ga0207689_106503202 85
171 3300025972 Ga0207668_10983553 Ga0207668_109835531 85
172 3300026035 Ga0207703_11271541 Ga0207703_112715411 85
173 3300026067 Ga0207678_11162803 Ga0207678_111628032 85
174 3300026075 Ga0207708_10078344 Ga0207708_100783444 85
175 3300026075 Ga0207708_10820452 Ga0207708_108204522 85
176 3300026075 Ga0207708_11276023 Ga0207708_112760232 85
177 3300026095 Ga0207676_10551810 Ga0207676_105518101 85
178 3300026118 Ga0207675_100068527 Ga0207675_1000685272 85
179 3300027682 Ga0209971_1119920 Ga0209971_11199201 85
180 3300027695 Ga0209966_1072198 Ga0209966_10721981 85
181 3300027866 Ga0209813_10253903 Ga0209813_102539032 85
182 3300027907 Ga0207428_10259735 Ga0207428_102597352 85
183 3300027907 Ga0207428_10965819 Ga0207428_109658192 85
184 3300028380 Ga0268265_10644732 Ga0268265_106447321 85
185 3300028380 Ga0268265_12263148 Ga0268265_122631482 85
186 3300031665 Ga0316575_10149982 Ga0316575_101499822 85
187 3300031728 Ga0316578_10417594 Ga0316578_104175942 85
188 3300032133 Ga0316583_10232260 Ga0316583_102322602 85
189 3300032137 Ga0316585_10170767 Ga0316585_101707672 85
190 3300035241 Ga0373961_0212191 Ga0373961_0212191_200_472 85
191 3300035398 Ga0316574_0024057 Ga0316574_0024057_1324_1599 85
192 3300036712 Ga0316584_0064881 Ga0316584_0064881_568_843 85
193 3300049574 Ga0501038_1389089 Ga0501038_1389089_149_424 85
194 3300049592 Ga0501076_0571777 Ga0501076_0571777_572_850 85
195 3300049593 Ga0501077_1012963 Ga0501077_1012963_75_365 85
196 3300049741 Ga0501079_0354924 Ga0501079_0354924_832_1107 85
197 3300050491 nmdc:mga00v17_288590_c1 nmdc:mga00v17_288590_c1_394_666 85
198 3300050491 nmdc:mga00v17_49886_c1 nmdc:mga00v17_49886_c1_742_1011 85
199 3300050491 nmdc:mga00v17_550985_c1 nmdc:mga00v17_550985_c1_100_372 85
200 3300050492 nmdc:mga0yw44_53240_c1 nmdc:mga0yw44_53240_c1_1292_1564 85
201 3300050493 nmdc:mga0k408_139526_c1 nmdc:mga0k408_139526_c1_500_775 85
202 3300050494 nmdc:mga06z11_724676_c1 nmdc:mga06z11_724676_c1_224_496 85
203 3300050494 nmdc:mga06z11_7880_c1 nmdc:mga06z11_7880_c1_2440_2715 85
204 3300050495 nmdc:mga04h51_81736_c1 nmdc:mga04h51_81736_c1_496_771 85
205 3300050507 nmdc:mga05p37_227859_c1 nmdc:mga05p37_227859_c1_773_1048 85
206 3300050510 nmdc:mga06r32_1679_c1 nmdc:mga06r32_1679_c1_14927_15199 85
207 3300050511 nmdc:mga08y16_9539_c1 nmdc:mga08y16_9539_c1_8980_9252 85
208 3300050515 nmdc:mga0a205_1195867_c1 nmdc:mga0a205_1195867_c1_96_368 85
209 3300050515 nmdc:mga0a205_14918_c1 nmdc:mga0a205_14918_c1_3721_4002 85
210 3300050515 nmdc:mga0a205_204266_c1 nmdc:mga0a205_204266_c1_465_740 85
211 3300060353 Ga0501082_0908488 Ga0501082_0908488_182_457 85
212 3300003320 rootH2_10074752 rootH2_100747525 86
213 3300005344 Ga0070661_100374467 Ga0070661_1003744671 86
214 3300005548 Ga0070665_100000099 Ga0070665_10000009958 86
215 3300005614 Ga0068856_100501406 Ga0068856_1005014061 86
216 3300005618 Ga0068864_102568432 Ga0068864_1025684322 86
217 3300005841 Ga0068863_100000601 Ga0068863_10000060133 86
218 3300005842 Ga0068858_100004572 Ga0068858_1000045728 86
219 3300005843 Ga0068860_100242311 Ga0068860_1002423112 86
220 3300006871 Ga0075434_100236194 Ga0075434_1002361942 86
221 3300006914 Ga0075436_100099104 Ga0075436_1000991042 86
222 3300007076 Ga0075435_100718152 Ga0075435_1007181522 86
223 3300009093 Ga0105240_10005027 Ga0105240_100050273 86
224 3300009093 Ga0105240_10141630 Ga0105240_101416303 86
225 3300009093 Ga0105240_10191397 Ga0105240_101913972 86
226 3300009101 Ga0105247_10170192 Ga0105247_101701921 86
227 3300009174 Ga0105241_10475031 Ga0105241_104750312 86
228 3300009177 Ga0105248_12253964 Ga0105248_122539641 86
229 3300009545 Ga0105237_10010702 Ga0105237_100107025 86
230 3300009551 Ga0105238_10594462 Ga0105238_105944621 86
231 3300010375 Ga0105239_11030110 Ga0105239_110301102 86
232 3300025900 Ga0207710_10450579 Ga0207710_104505791 86
233 3300025911 Ga0207654_10226239 Ga0207654_102262392 86
234 3300025913 Ga0207695_10010964 Ga0207695_100109647 86
235 3300025913 Ga0207695_10096138 Ga0207695_100961383 86
236 3300025914 Ga0207671_10008486 Ga0207671_100084864 86
237 3300025920 Ga0207649_10506164 Ga0207649_105061641 86
238 3300025924 Ga0207694_10044961 Ga0207694_100449612 86
239 3300025941 Ga0207711_11628488 Ga0207711_116284882 86
240 3300026035 Ga0207703_10006369 Ga0207703_100063694 86
241 3300026035 Ga0207703_11724729 Ga0207703_117247292 86
242 3300026041 Ga0207639_10498287 Ga0207639_104982872 86
243 3300026078 Ga0207702_10399723 Ga0207702_103997232 86
244 3300026088 Ga0207641_10030669 Ga0207641_100306693 86
245 3300028379 Ga0268266_10000116 Ga0268266_1000011680 86
246 3300030521 Ga0307511_10000140 Ga0307511_1000014040 86
247 3300031010 Ga0265771_1004867 Ga0265771_10048671 86
248 3300037853 Ga0436364_1415213 Ga0436364_1415213_116_379 86
249 3300050512 nmdc:mga0n895_314149_c1 nmdc:mga0n895_314149_c1_408_692 86
250 3300050513 nmdc:mga0rr50_706447_c1 nmdc:mga0rr50_706447_c1_108_392 86
251 3300050514 nmdc:mga08x19_134281_c1 nmdc:mga08x19_134281_c1_1011_1295 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

7

89

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_S rnase r bound to a 30s degradation intermediate (state ii) 0.9647 5 83
8cec-assembly1.cif.gz_S rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9597 5 83
7qv2-assembly1.cif.gz_t bacillus subtilis collided disome (collided 70s) 0.9581 6 83
5v93-assembly1.cif.gz_t cryo-em structure of the 70s ribosome from mycobacterium tuberculosis bound with capreomycin 0.9544 9 83
7qv3-assembly1.cif.gz_t bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9508 5 83
ID Description Score Start End Superfamily
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9561 50 80 3.40.50.1010
4kd0T00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9523 6 84 1.20.58.110
5iwaT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.943 6 84 1.20.58.110
af_P9WH41_1_86_1.20.58.110 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9417 1 83 1.20.58.110
4kdaT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9417 6 84 1.20.58.110
ID Description Score Start End GO Terms
AF-A0A2M8DMK7-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9943 14 83 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C5G4I4-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9884 24 83 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2M6ZWJ6-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9877 14 83 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A2H0UW60-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9859 24 83 GO:0003735
GO:0006412
GO:0015935
GO:0070181
AF-A0A3N6B8Z8-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9791 24 83 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181

Feature Viewer

pLDDT pTM Quality
90.18 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map