F362366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 147 | 251 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_11433258|Ga0111539_114332582 |
| Length | 96 |
| Sequence | LEEIRLAHHASALKAMRQGVKRNERNRQNLSQLKSQVKKLRAAIATGDAAEAKKALGETVSQIDKAAKKGVIHDNAASRYKSRLSRRLNGMSAPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 102 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 103 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 104 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 105 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 108 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 109 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 110 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 133 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 134 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 135 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 136 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 137 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 138 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 139 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.76 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 90.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10074752 | 3300003320 | Bacteria | 4929 |
| 2 | Ga0070676_10426966 | 3300005328 | Unclassified | 927 |
| 3 | Ga0070683_100826511 | 3300005329 | Unclassified | 888 |
| 4 | Ga0068869_100578266 | 3300005334 | Bacteria | 947 |
| 5 | Ga0068869_101380559 | 3300005334 | Bacteria | 623 |
| 6 | Ga0070691_10553941 | 3300005341 | Bacteria | 672 |
| 7 | Ga0070661_100374467 | 3300005344 | Unclassified | 1121 |
| 8 | Ga0070668_101788565 | 3300005347 | Bacteria | 565 |
| 9 | Ga0070669_100388841 | 3300005353 | Unclassified | 1139 |
| 10 | Ga0070669_101745739 | 3300005353 | Unclassified | 543 |
| 11 | Ga0070671_101547717 | 3300005355 | Bacteria | 587 |
| 12 | Ga0070674_101462740 | 3300005356 | Archaea | 613 |
| 13 | Ga0070705_100014173 | 3300005440 | Bacteria | 4096 |
| 14 | Ga0070705_100153162 | 3300005440 | Bacteria | 1532 |
| 15 | Ga0070700_100058914 | 3300005441 | Bacteria | 2415 |
| 16 | Ga0070700_100652452 | 3300005441 | Archaea | 831 |
| 17 | Ga0070700_100901165 | 3300005441 | Bacteria | 720 |
| 18 | Ga0070700_101001569 | 3300005441 | Bacteria | 687 |
| 19 | Ga0070694_100008437 | 3300005444 | Bacteria | 6304 |
| 20 | Ga0070694_100085906 | 3300005444 | Unclassified | 2198 |
| 21 | Ga0070694_100135178 | 3300005444 | Bacteria | 1786 |
| 22 | Ga0070694_100488927 | 3300005444 | Archaea | 978 |
| 23 | Ga0070694_100709289 | 3300005444 | Bacteria | 819 |
| 24 | Ga0070694_100713557 | 3300005444 | Bacteria | 816 |
| 25 | Ga0070694_101015525 | 3300005444 | Bacteria | 689 |
| 26 | Ga0070708_100761071 | 3300005445 | Bacteria | 911 |
| 27 | Ga0070708_101636845 | 3300005445 | Bacteria | 599 |
| 28 | Ga0070708_101666623 | 3300005445 | Unclassified | 593 |
| 29 | Ga0070662_100930361 | 3300005457 | Unclassified | 743 |
| 30 | Ga0070706_100024659 | 3300005467 | Bacteria | 5537 |
| 31 | Ga0070706_100047753 | 3300005467 | Bacteria | 3951 |
| 32 | Ga0070706_100770071 | 3300005467 | Bacteria | 891 |
| 33 | Ga0070706_101984224 | 3300005467 | Bacteria | 527 |
| 34 | Ga0070707_100021996 | 3300005468 | Bacteria | 6029 |
| 35 | Ga0070707_100315373 | 3300005468 | Bacteria | 1520 |
| 36 | Ga0070698_100006796 | 3300005471 | Bacteria | 12401 |
| 37 | Ga0070698_100063921 | 3300005471 | Bacteria | 3710 |
| 38 | Ga0070698_100090281 | 3300005471 | Bacteria | 3047 |
| 39 | Ga0070698_101627862 | 3300005471 | Bacteria | 598 |
| 40 | Ga0070699_100003673 | 3300005518 | Bacteria | 13595 |
| 41 | Ga0070699_100020859 | 3300005518 | Bacteria | 5650 |
| 42 | Ga0070699_100564599 | 3300005518 | Bacteria | 1036 |
| 43 | Ga0070699_101786710 | 3300005518 | Bacteria | 563 |
| 44 | Ga0070697_100054782 | 3300005536 | Unclassified | 3242 |
| 45 | Ga0070697_100068070 | 3300005536 | Bacteria | 2914 |
| 46 | Ga0070672_101466143 | 3300005543 | Bacteria | 611 |
| 47 | Ga0070695_100034447 | 3300005545 | Bacteria | 3175 |
| 48 | Ga0070695_100276281 | 3300005545 | Bacteria | 1232 |
| 49 | Ga0070695_101643747 | 3300005545 | Archaea | 537 |
| 50 | Ga0070696_100081683 | 3300005546 | Bacteria | 2290 |
| 51 | Ga0070696_100240581 | 3300005546 | Bacteria | 1365 |
| 52 | Ga0070696_100792036 | 3300005546 | Bacteria | 780 |
| 53 | Ga0070696_100822966 | 3300005546 | Archaea | 766 |
| 54 | Ga0070693_101385454 | 3300005547 | Archaea | 546 |
| 55 | Ga0070665_100000099 | 3300005548 | Bacteria | 163970 |
| 56 | Ga0070704_100076766 | 3300005549 | Bacteria | 2445 |
| 57 | Ga0070704_100100054 | 3300005549 | Bacteria | 2182 |
| 58 | Ga0070704_100123737 | 3300005549 | Archaea | 1992 |
| 59 | Ga0070704_100240208 | 3300005549 | Unclassified | 1482 |
| 60 | Ga0070704_100654435 | 3300005549 | Bacteria | 928 |
| 61 | Ga0068857_101673083 | 3300005577 | Bacteria | 622 |
| 62 | Ga0068854_102234382 | 3300005578 | Bacteria | 506 |
| 63 | Ga0068856_100501406 | 3300005614 | Unclassified | 1235 |
| 64 | Ga0070702_100714460 | 3300005615 | Bacteria | 765 |
| 65 | Ga0068859_100429175 | 3300005617 | Bacteria | 1418 |
| 66 | Ga0068864_102568432 | 3300005618 | Bacteria | 515 |
| 67 | Ga0068861_100045883 | 3300005719 | Bacteria | 3293 |
| 68 | Ga0068863_100000601 | 3300005841 | Bacteria | 36569 |
| 69 | Ga0068858_100004572 | 3300005842 | Bacteria | 13546 |
| 70 | Ga0068860_100242311 | 3300005843 | Unclassified | 1754 |
| 71 | Ga0068860_102113109 | 3300005843 | Unclassified | 584 |
| 72 | Ga0068862_100725150 | 3300005844 | Bacteria | 965 |
| 73 | Ga0068862_102317997 | 3300005844 | Bacteria | 548 |
| 74 | Ga0081455_10034063 | 3300005937 | Bacteria | 4568 |
| 75 | Ga0070717_10496660 | 3300006028 | Bacteria | 1102 |
| 76 | Ga0075365_10052057 | 3300006038 | Bacteria | 2706 |
| 77 | Ga0075365_10123120 | 3300006038 | Bacteria | 1790 |
| 78 | Ga0075368_10082423 | 3300006042 | Unclassified | 1310 |
| 79 | Ga0075368_10400976 | 3300006042 | Bacteria | 602 |
| 80 | Ga0075363_100040625 | 3300006048 | Bacteria | 2452 |
| 81 | Ga0075364_10231206 | 3300006051 | Bacteria | 1256 |
| 82 | Ga0075364_10458477 | 3300006051 | Bacteria | 871 |
| 83 | Ga0075367_10011977 | 3300006178 | Unclassified | 4607 |
| 84 | Ga0075367_10999955 | 3300006178 | Bacteria | 534 |
| 85 | Ga0075366_10175768 | 3300006195 | Unclassified | 1300 |
| 86 | Ga0075428_101345918 | 3300006844 | Bacteria | 750 |
| 87 | Ga0075428_101496412 | 3300006844 | Unclassified | 707 |
| 88 | Ga0075431_100000177 | 3300006847 | Bacteria | 45440 |
| 89 | Ga0075431_100182479 | 3300006847 | Bacteria | 2153 |
| 90 | Ga0075431_102029310 | 3300006847 | Bacteria | 530 |
| 91 | Ga0075433_10062474 | 3300006852 | Bacteria | 3262 |
| 92 | Ga0075433_10233512 | 3300006852 | Bacteria | 1633 |
| 93 | Ga0075433_11401881 | 3300006852 | Bacteria | 604 |
| 94 | Ga0075433_11715424 | 3300006852 | Bacteria | 541 |
| 95 | Ga0075434_100236194 | 3300006871 | Bacteria | 1848 |
| 96 | Ga0075434_101151359 | 3300006871 | Unclassified | 788 |
| 97 | Ga0075436_100099104 | 3300006914 | Bacteria | 2028 |
| 98 | Ga0075436_100830489 | 3300006914 | Bacteria | 689 |
| 99 | Ga0097620_100429109 | 3300006931 | Bacteria | 1418 |
| 100 | Ga0075435_100718152 | 3300007076 | Bacteria | 869 |
| 101 | Ga0075435_101949021 | 3300007076 | Unclassified | 516 |
| 102 | Ga0105240_10005027 | 3300009093 | Bacteria | 19848 |
| 103 | Ga0105240_10141630 | 3300009093 | Bacteria | 2874 |
| 104 | Ga0105240_10191397 | 3300009093 | Bacteria | 2405 |
| 105 | Ga0111539_10059840 | 3300009094 | Bacteria | 4516 |
| 106 | Ga0111539_10314589 | 3300009094 | Bacteria | 1822 |
| 107 | Ga0111539_11433258 | 3300009094 | Bacteria | 801 |
| 108 | Ga0105247_10170192 | 3300009101 | Unclassified | 1448 |
| 109 | Ga0105247_10232508 | 3300009101 | Bacteria | 1252 |
| 110 | Ga0114129_10011178 | 3300009147 | Bacteria | 12799 |
| 111 | Ga0114129_10065310 | 3300009147 | Bacteria | 5079 |
| 112 | Ga0114129_10356206 | 3300009147 | Bacteria | 1937 |
| 113 | Ga0114129_11493834 | 3300009147 | Bacteria | 830 |
| 114 | Ga0105241_10475031 | 3300009174 | Unclassified | 1110 |
| 115 | Ga0105248_12253964 | 3300009177 | Unclassified | 620 |
| 116 | Ga0105237_10010702 | 3300009545 | Bacteria | 9737 |
| 117 | Ga0105238_10594462 | 3300009551 | Unclassified | 1114 |
| 118 | Ga0105239_11030110 | 3300010375 | Unclassified | 947 |
| 119 | Ga0105246_11606772 | 3300011119 | Bacteria | 614 |
| 120 | Ga0157374_10577413 | 3300013296 | Unclassified | 1133 |
| 121 | Ga0157380_10048616 | 3300014326 | Bacteria | 3341 |
| 122 | Ga0157380_10056279 | 3300014326 | Bacteria | 3127 |
| 123 | Ga0157377_10000087 | 3300014745 | Bacteria | 69130 |
| 124 | Ga0207653_10004673 | 3300025885 | Bacteria | 4292 |
| 125 | Ga0207710_10450579 | 3300025900 | Unclassified | 664 |
| 126 | Ga0207645_10790553 | 3300025907 | Unclassified | 645 |
| 127 | Ga0207684_10046772 | 3300025910 | Bacteria | 3671 |
| 128 | Ga0207684_10191640 | 3300025910 | Unclassified | 1763 |
| 129 | Ga0207684_10505196 | 3300025910 | Bacteria | 1036 |
| 130 | Ga0207684_11551825 | 3300025910 | Unclassified | 537 |
| 131 | Ga0207654_10226239 | 3300025911 | Bacteria | 1243 |
| 132 | Ga0207695_10010964 | 3300025913 | Bacteria | 11021 |
| 133 | Ga0207695_10096138 | 3300025913 | Bacteria | 2964 |
| 134 | Ga0207671_10008486 | 3300025914 | Bacteria | 8706 |
| 135 | Ga0207649_10506164 | 3300025920 | Unclassified | 919 |
| 136 | Ga0207646_10009322 | 3300025922 | Bacteria | 9709 |
| 137 | Ga0207646_10233880 | 3300025922 | Bacteria | 1660 |
| 138 | Ga0207681_10158605 | 3300025923 | Bacteria | 1703 |
| 139 | Ga0207694_10044961 | 3300025924 | Unclassified | 3410 |
| 140 | Ga0207670_11555088 | 3300025936 | Bacteria | 562 |
| 141 | Ga0207669_11261810 | 3300025937 | Bacteria | 627 |
| 142 | Ga0207669_11577816 | 3300025937 | Unclassified | 560 |
| 143 | Ga0207665_10076808 | 3300025939 | Bacteria | 2291 |
| 144 | Ga0207711_11628488 | 3300025941 | Unclassified | 589 |
| 145 | Ga0207689_10134622 | 3300025942 | Bacteria | 2035 |
| 146 | Ga0207689_10650320 | 3300025942 | Bacteria | 888 |
| 147 | Ga0207689_11814944 | 3300025942 | Bacteria | 503 |
| 148 | Ga0207661_10735187 | 3300025944 | Bacteria | 908 |
| 149 | Ga0207668_10983553 | 3300025972 | Bacteria | 754 |
| 150 | Ga0207703_10006369 | 3300026035 | Bacteria | 9433 |
| 151 | Ga0207703_11271541 | 3300026035 | Bacteria | 708 |
| 152 | Ga0207703_11724729 | 3300026035 | Bacteria | 602 |
| 153 | Ga0207639_10498287 | 3300026041 | Unclassified | 1112 |
| 154 | Ga0207678_11162803 | 3300026067 | Bacteria | 683 |
| 155 | Ga0207708_10078344 | 3300026075 | Bacteria | 2537 |
| 156 | Ga0207708_10820452 | 3300026075 | Bacteria | 802 |
| 157 | Ga0207708_11276023 | 3300026075 | Bacteria | 643 |
| 158 | Ga0207702_10399723 | 3300026078 | Unclassified | 1325 |
| 159 | Ga0207641_10030669 | 3300026088 | Bacteria | 4454 |
| 160 | Ga0207676_10551810 | 3300026095 | Unclassified | 1101 |
| 161 | Ga0207674_10791108 | 3300026116 | Bacteria | 915 |
| 162 | Ga0207675_100068527 | 3300026118 | Bacteria | 3316 |
| 163 | Ga0209971_1119920 | 3300027682 | Bacteria | 646 |
| 164 | Ga0209966_1072198 | 3300027695 | Unclassified | 757 |
| 165 | Ga0209813_10253903 | 3300027866 | Bacteria | 669 |
| 166 | Ga0207428_10259735 | 3300027907 | Bacteria | 1294 |
| 167 | Ga0207428_10965819 | 3300027907 | Bacteria | 600 |
| 168 | Ga0268266_10000116 | 3300028379 | Bacteria | 163984 |
| 169 | Ga0268265_10644732 | 3300028380 | Bacteria | 1017 |
| 170 | Ga0268265_12263148 | 3300028380 | Bacteria | 550 |
| 171 | Ga0307511_10000140 | 3300030521 | Bacteria | 67183 |
| 172 | Ga0265771_1004867 | 3300031010 | Unclassified | 833 |
| 173 | Ga0316575_10149982 | 3300031665 | Bacteria | 962 |
| 174 | Ga0316578_10417594 | 3300031728 | Bacteria | 794 |
| 175 | Ga0316583_10232260 | 3300032133 | Bacteria | 639 |
| 176 | Ga0316585_10170767 | 3300032137 | Bacteria | 718 |
| 177 | Ga0373961_0212191 | 3300035241 | Unclassified | 687 |
| 178 | Ga0316574_0024057 | 3300035398 | Bacteria | 3642 |
| 179 | Ga0316582_0045916 | 3300036647 | Unclassified | 2752 |
| 180 | Ga0316584_0064881 | 3300036712 | Bacteria | 2735 |
| 181 | Ga0316584_0936288 | 3300036712 | Bacteria | 582 |
| 182 | Ga0436364_1415213 | 3300037853 | Bacteria | 772 |
| 183 | Ga0439435_0089259 | 3300042436 | Bacteria | 934 |
| 184 | Ga0453684_1086801 | 3300044712 | Bacteria | 846 |
| 185 | Ga0495638_0055872 | 3300046460 | Bacteria | 2450 |
| 186 | Ga0501031_0118100 | 3300049568 | Bacteria | 1733 |
| 187 | Ga0501038_1389089 | 3300049574 | Bacteria | 505 |
| 188 | Ga0501039_0307109 | 3300049575 | Unclassified | 1247 |
| 189 | Ga0501040_0449569 | 3300049576 | Bacteria | 927 |
| 190 | Ga0501041_0162080 | 3300049577 | Bacteria | 1398 |
| 191 | Ga0501042_0170816 | 3300049578 | Bacteria | 1569 |
| 192 | Ga0501048_0826066 | 3300049582 | Bacteria | 666 |
| 193 | Ga0501070_0240023 | 3300049586 | Bacteria | 1484 |
| 194 | Ga0501072_0189611 | 3300049588 | Bacteria | 1640 |
| 195 | Ga0501072_1276132 | 3300049588 | Bacteria | 570 |
| 196 | Ga0501074_0168731 | 3300049590 | Bacteria | 1563 |
| 197 | Ga0501074_0651544 | 3300049590 | Bacteria | 744 |
| 198 | Ga0501075_0200457 | 3300049591 | Bacteria | 1522 |
| 199 | Ga0501075_0383835 | 3300049591 | Bacteria | 1071 |
| 200 | Ga0501075_0859706 | 3300049591 | Bacteria | 690 |
| 201 | Ga0501075_0863731 | 3300049591 | Bacteria | 688 |
| 202 | Ga0501076_0021719 | 3300049592 | Bacteria | 4927 |
| 203 | Ga0501076_0370085 | 3300049592 | Bacteria | 1178 |
| 204 | Ga0501076_0571777 | 3300049592 | Bacteria | 932 |
| 205 | Ga0501077_1012963 | 3300049593 | Bacteria | 534 |
| 206 | Ga0501077_1064439 | 3300049593 | Bacteria | 520 |
| 207 | Ga0501079_0042744 | 3300049741 | Bacteria | 3499 |
| 208 | Ga0501079_0354924 | 3300049741 | Bacteria | 1149 |
| 209 | Ga0501079_0541741 | 3300049741 | Bacteria | 915 |
| 210 | Ga0501080_0851467 | 3300049742 | Bacteria | 797 |
| 211 | Ga0501081_0047921 | 3300049743 | Bacteria | 2940 |
| 212 | Ga0501081_0106806 | 3300049743 | Bacteria | 1985 |
| 213 | Ga0501081_0275605 | 3300049743 | Unclassified | 1231 |
| 214 | Ga0501083_0612767 | 3300049744 | Bacteria | 708 |
| 215 | Ga0501035_0636713 | 3300049822 | Bacteria | 866 |
| 216 | Ga0501045_0125718 | 3300049824 | Bacteria | 1905 |
| 217 | Ga0501045_0206539 | 3300049824 | Bacteria | 1463 |
| 218 | Ga0501045_1081654 | 3300049824 | Bacteria | 587 |
| 219 | nmdc:mga03n38_149400_c1 | 3300050490 | Bacteria | 1174 |
| 220 | nmdc:mga00v17_288590_c1 | 3300050491 | Bacteria | 1065 |
| 221 | nmdc:mga00v17_49886_c1 | 3300050491 | Bacteria | 2540 |
| 222 | nmdc:mga00v17_550985_c1 | 3300050491 | Unclassified | 746 |
| 223 | nmdc:mga0yw44_53240_c1 | 3300050492 | Bacteria | 2457 |
| 224 | nmdc:mga0k408_139526_c1 | 3300050493 | Unclassified | 1441 |
| 225 | nmdc:mga06z11_724676_c1 | 3300050494 | Bacteria | 606 |
| 226 | nmdc:mga06z11_7880_c1 | 3300050494 | Unclassified | 4410 |
| 227 | nmdc:mga06z11_875692_c1 | 3300050494 | Bacteria | 547 |
| 228 | nmdc:mga04h51_81736_c1 | 3300050495 | Unclassified | 1148 |
| 229 | nmdc:mga07m45_863104_c1 | 3300050496 | Bacteria | 518 |
| 230 | nmdc:mga05p37_1105132_c1 | 3300050507 | Bacteria | 830 |
| 231 | nmdc:mga05p37_1514356_c1 | 3300050507 | Bacteria | 667 |
| 232 | nmdc:mga05p37_227859_c1 | 3300050507 | Bacteria | 2246 |
| 233 | nmdc:mga05p37_31419_c2 | 3300050507 | Bacteria | 5633 |
| 234 | nmdc:mga05p37_477090_c1 | 3300050507 | Bacteria | 1438 |
| 235 | nmdc:mga06r32_1679_c1 | 3300050510 | Bacteria | 19938 |
| 236 | nmdc:mga06r32_41750_c1 | 3300050510 | Bacteria | 4359 |
| 237 | nmdc:mga08y16_352562_c1 | 3300050511 | Bacteria | 1511 |
| 238 | nmdc:mga08y16_9539_c1 | 3300050511 | Bacteria | 10186 |
| 239 | nmdc:mga0n895_137534_c1 | 3300050512 | Bacteria | 2470 |
| 240 | nmdc:mga0n895_314149_c1 | 3300050512 | Bacteria | 1588 |
| 241 | nmdc:mga0rr50_1681677_c1 | 3300050513 | Unclassified | 535 |
| 242 | nmdc:mga0rr50_706447_c1 | 3300050513 | Bacteria | 860 |
| 243 | nmdc:mga08x19_134281_c1 | 3300050514 | Bacteria | 1667 |
| 244 | nmdc:mga08x19_700510_c1 | 3300050514 | Bacteria | 719 |
| 245 | nmdc:mga0a205_1195867_c1 | 3300050515 | Bacteria | 608 |
| 246 | nmdc:mga0a205_14918_c1 | 3300050515 | Bacteria | 7250 |
| 247 | nmdc:mga0a205_204266_c1 | 3300050515 | Bacteria | 1865 |
| 248 | Ga0501084_0407510 | 3300054114 | Bacteria | 1149 |
| 249 | Ga0501082_0102621 | 3300060353 | Unclassified | 2474 |
| 250 | Ga0501082_0908488 | 3300060353 | Bacteria | 770 |
| 251 | Ga0501082_1031310 | 3300060353 | Bacteria | 719 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100564599 | Ga0070699_1005645992 | 75 |
| 2 | 3300006844 | Ga0075428_101345918 | Ga0075428_1013459182 | 75 |
| 3 | 3300009094 | Ga0111539_10314589 | Ga0111539_103145892 | 75 |
| 4 | 3300009147 | Ga0114129_10011178 | Ga0114129_100111785 | 75 |
| 5 | 3300009147 | Ga0114129_10065310 | Ga0114129_100653104 | 75 |
| 6 | 3300009147 | Ga0114129_11493834 | Ga0114129_114938342 | 75 |
| 7 | 3300014326 | Ga0157380_10056279 | Ga0157380_100562792 | 75 |
| 8 | 3300025910 | Ga0207684_11551825 | Ga0207684_115518252 | 75 |
| 9 | 3300042436 | Ga0439435_0089259 | Ga0439435_0089259_256_501 | 75 |
| 10 | 3300044712 | Ga0453684_1086801 | Ga0453684_1086801_451_690 | 75 |
| 11 | 3300046460 | Ga0495638_0055872 | Ga0495638_0055872_930_1172 | 75 |
| 12 | 3300049568 | Ga0501031_0118100 | Ga0501031_0118100_25_267 | 75 |
| 13 | 3300049575 | Ga0501039_0307109 | Ga0501039_0307109_248_487 | 75 |
| 14 | 3300049576 | Ga0501040_0449569 | Ga0501040_0449569_383_622 | 75 |
| 15 | 3300049577 | Ga0501041_0162080 | Ga0501041_0162080_585_824 | 75 |
| 16 | 3300049578 | Ga0501042_0170816 | Ga0501042_0170816_982_1224 | 75 |
| 17 | 3300049582 | Ga0501048_0826066 | Ga0501048_0826066_109_348 | 75 |
| 18 | 3300049586 | Ga0501070_0240023 | Ga0501070_0240023_1219_1461 | 75 |
| 19 | 3300049588 | Ga0501072_0189611 | Ga0501072_0189611_444_683 | 75 |
| 20 | 3300049588 | Ga0501072_1276132 | Ga0501072_1276132_139_381 | 75 |
| 21 | 3300049590 | Ga0501074_0168731 | Ga0501074_0168731_601_843 | 75 |
| 22 | 3300049590 | Ga0501074_0651544 | Ga0501074_0651544_173_415 | 75 |
| 23 | 3300049591 | Ga0501075_0200457 | Ga0501075_0200457_254_493 | 75 |
| 24 | 3300049591 | Ga0501075_0383835 | Ga0501075_0383835_148_390 | 75 |
| 25 | 3300049591 | Ga0501075_0859706 | Ga0501075_0859706_432_674 | 75 |
| 26 | 3300049591 | Ga0501075_0863731 | Ga0501075_0863731_434_676 | 75 |
| 27 | 3300049592 | Ga0501076_0021719 | Ga0501076_0021719_3626_3865 | 75 |
| 28 | 3300049592 | Ga0501076_0370085 | Ga0501076_0370085_214_453 | 75 |
| 29 | 3300049593 | Ga0501077_1064439 | Ga0501077_1064439_228_467 | 75 |
| 30 | 3300049741 | Ga0501079_0042744 | Ga0501079_0042744_2120_2359 | 75 |
| 31 | 3300049741 | Ga0501079_0541741 | Ga0501079_0541741_369_611 | 75 |
| 32 | 3300049742 | Ga0501080_0851467 | Ga0501080_0851467_262_501 | 75 |
| 33 | 3300049743 | Ga0501081_0047921 | Ga0501081_0047921_819_1058 | 75 |
| 34 | 3300049743 | Ga0501081_0275605 | Ga0501081_0275605_15_257 | 75 |
| 35 | 3300049744 | Ga0501083_0612767 | Ga0501083_0612767_277_519 | 75 |
| 36 | 3300049822 | Ga0501035_0636713 | Ga0501035_0636713_369_611 | 75 |
| 37 | 3300049824 | Ga0501045_0125718 | Ga0501045_0125718_1419_1661 | 75 |
| 38 | 3300049824 | Ga0501045_0206539 | Ga0501045_0206539_776_1015 | 75 |
| 39 | 3300049824 | Ga0501045_1081654 | Ga0501045_1081654_325_570 | 75 |
| 40 | 3300050490 | nmdc:mga03n38_149400_c1 | nmdc:mga03n38_149400_c1_199_441 | 75 |
| 41 | 3300050494 | nmdc:mga06z11_875692_c1 | nmdc:mga06z11_875692_c1_114_356 | 75 |
| 42 | 3300050496 | nmdc:mga07m45_863104_c1 | nmdc:mga07m45_863104_c1_246_488 | 75 |
| 43 | 3300050507 | nmdc:mga05p37_1105132_c1 | nmdc:mga05p37_1105132_c1_311_553 | 75 |
| 44 | 3300050507 | nmdc:mga05p37_1514356_c1 | nmdc:mga05p37_1514356_c1_394_630 | 75 |
| 45 | 3300050507 | nmdc:mga05p37_31419_c2 | nmdc:mga05p37_31419_c2_4980_5222 | 75 |
| 46 | 3300050507 | nmdc:mga05p37_477090_c1 | nmdc:mga05p37_477090_c1_219_470 | 75 |
| 47 | 3300050510 | nmdc:mga06r32_41750_c1 | nmdc:mga06r32_41750_c1_731_973 | 75 |
| 48 | 3300050511 | nmdc:mga08y16_352562_c1 | nmdc:mga08y16_352562_c1_711_953 | 75 |
| 49 | 3300050512 | nmdc:mga0n895_137534_c1 | nmdc:mga0n895_137534_c1_18_269 | 75 |
| 50 | 3300054114 | Ga0501084_0407510 | Ga0501084_0407510_134_373 | 75 |
| 51 | 3300060353 | Ga0501082_0102621 | Ga0501082_0102621_216_455 | 75 |
| 52 | 3300060353 | Ga0501082_1031310 | Ga0501082_1031310_98_340 | 75 |
| 53 | 3300005355 | Ga0070671_101547717 | Ga0070671_1015477171 | 77 |
| 54 | 3300005615 | Ga0070702_100714460 | Ga0070702_1007144602 | 77 |
| 55 | 3300025937 | Ga0207669_11577816 | Ga0207669_115778162 | 77 |
| 56 | 3300036647 | Ga0316582_0045916 | Ga0316582_0045916_1392_1646 | 78 |
| 57 | 3300036712 | Ga0316584_0936288 | Ga0316584_0936288_153_407 | 78 |
| 58 | 3300049743 | Ga0501081_0106806 | Ga0501081_0106806_556_816 | 78 |
| 59 | 3300005328 | Ga0070676_10426966 | Ga0070676_104269662 | 80 |
| 60 | 3300005329 | Ga0070683_100826511 | Ga0070683_1008265111 | 80 |
| 61 | 3300005353 | Ga0070669_101745739 | Ga0070669_1017457391 | 80 |
| 62 | 3300005577 | Ga0068857_101673083 | Ga0068857_1016730832 | 80 |
| 63 | 3300005578 | Ga0068854_102234382 | Ga0068854_1022343822 | 80 |
| 64 | 3300014745 | Ga0157377_10000087 | Ga0157377_1000008768 | 80 |
| 65 | 3300025907 | Ga0207645_10790553 | Ga0207645_107905532 | 80 |
| 66 | 3300025936 | Ga0207670_11555088 | Ga0207670_115550881 | 80 |
| 67 | 3300025942 | Ga0207689_11814944 | Ga0207689_118149442 | 80 |
| 68 | 3300025944 | Ga0207661_10735187 | Ga0207661_107351872 | 80 |
| 69 | 3300026116 | Ga0207674_10791108 | Ga0207674_107911082 | 80 |
| 70 | 3300005445 | Ga0070708_101666623 | Ga0070708_1016666231 | 81 |
| 71 | 3300005467 | Ga0070706_100024659 | Ga0070706_1000246597 | 81 |
| 72 | 3300005468 | Ga0070707_100315373 | Ga0070707_1003153732 | 81 |
| 73 | 3300005471 | Ga0070698_100090281 | Ga0070698_1000902814 | 81 |
| 74 | 3300005518 | Ga0070699_100020859 | Ga0070699_1000208596 | 81 |
| 75 | 3300005536 | Ga0070697_100054782 | Ga0070697_1000547822 | 81 |
| 76 | 3300006028 | Ga0070717_10496660 | Ga0070717_104966602 | 81 |
| 77 | 3300006914 | Ga0075436_100830489 | Ga0075436_1008304892 | 81 |
| 78 | 3300007076 | Ga0075435_101949021 | Ga0075435_1019490212 | 81 |
| 79 | 3300025910 | Ga0207684_10191640 | Ga0207684_101916402 | 81 |
| 80 | 3300025922 | Ga0207646_10233880 | Ga0207646_102338802 | 81 |
| 81 | 3300025939 | Ga0207665_10076808 | Ga0207665_100768082 | 81 |
| 82 | 3300050513 | nmdc:mga0rr50_1681677_c1 | nmdc:mga0rr50_1681677_c1_133_387 | 81 |
| 83 | 3300050514 | nmdc:mga08x19_700510_c1 | nmdc:mga08x19_700510_c1_131_385 | 81 |
| 84 | 3300005334 | Ga0068869_100578266 | Ga0068869_1005782661 | 85 |
| 85 | 3300005334 | Ga0068869_101380559 | Ga0068869_1013805592 | 85 |
| 86 | 3300005341 | Ga0070691_10553941 | Ga0070691_105539411 | 85 |
| 87 | 3300005347 | Ga0070668_101788565 | Ga0070668_1017885652 | 85 |
| 88 | 3300005353 | Ga0070669_100388841 | Ga0070669_1003888412 | 85 |
| 89 | 3300005356 | Ga0070674_101462740 | Ga0070674_1014627402 | 85 |
| 90 | 3300005440 | Ga0070705_100014173 | Ga0070705_1000141732 | 85 |
| 91 | 3300005440 | Ga0070705_100153162 | Ga0070705_1001531622 | 85 |
| 92 | 3300005441 | Ga0070700_100058914 | Ga0070700_1000589144 | 85 |
| 93 | 3300005441 | Ga0070700_100652452 | Ga0070700_1006524522 | 85 |
| 94 | 3300005441 | Ga0070700_100901165 | Ga0070700_1009011652 | 85 |
| 95 | 3300005441 | Ga0070700_101001569 | Ga0070700_1010015691 | 85 |
| 96 | 3300005444 | Ga0070694_100008437 | Ga0070694_1000084377 | 85 |
| 97 | 3300005444 | Ga0070694_100085906 | Ga0070694_1000859062 | 85 |
| 98 | 3300005444 | Ga0070694_100135178 | Ga0070694_1001351782 | 85 |
| 99 | 3300005444 | Ga0070694_100488927 | Ga0070694_1004889272 | 85 |
| 100 | 3300005444 | Ga0070694_100709289 | Ga0070694_1007092892 | 85 |
| 101 | 3300005444 | Ga0070694_100713557 | Ga0070694_1007135571 | 85 |
| 102 | 3300005444 | Ga0070694_101015525 | Ga0070694_1010155252 | 85 |
| 103 | 3300005445 | Ga0070708_100761071 | Ga0070708_1007610712 | 85 |
| 104 | 3300005445 | Ga0070708_101636845 | Ga0070708_1016368452 | 85 |
| 105 | 3300005457 | Ga0070662_100930361 | Ga0070662_1009303611 | 85 |
| 106 | 3300005467 | Ga0070706_100047753 | Ga0070706_1000477534 | 85 |
| 107 | 3300005467 | Ga0070706_100770071 | Ga0070706_1007700712 | 85 |
| 108 | 3300005467 | Ga0070706_101984224 | Ga0070706_1019842242 | 85 |
| 109 | 3300005468 | Ga0070707_100021996 | Ga0070707_1000219964 | 85 |
| 110 | 3300005471 | Ga0070698_100006796 | Ga0070698_1000067969 | 85 |
| 111 | 3300005471 | Ga0070698_100063921 | Ga0070698_1000639214 | 85 |
| 112 | 3300005471 | Ga0070698_101627862 | Ga0070698_1016278622 | 85 |
| 113 | 3300005518 | Ga0070699_100003673 | Ga0070699_10000367310 | 85 |
| 114 | 3300005518 | Ga0070699_101786710 | Ga0070699_1017867101 | 85 |
| 115 | 3300005536 | Ga0070697_100068070 | Ga0070697_1000680702 | 85 |
| 116 | 3300005543 | Ga0070672_101466143 | Ga0070672_1014661431 | 85 |
| 117 | 3300005545 | Ga0070695_100034447 | Ga0070695_1000344472 | 85 |
| 118 | 3300005545 | Ga0070695_100276281 | Ga0070695_1002762812 | 85 |
| 119 | 3300005545 | Ga0070695_101643747 | Ga0070695_1016437472 | 85 |
| 120 | 3300005546 | Ga0070696_100081683 | Ga0070696_1000816832 | 85 |
| 121 | 3300005546 | Ga0070696_100240581 | Ga0070696_1002405812 | 85 |
| 122 | 3300005546 | Ga0070696_100792036 | Ga0070696_1007920362 | 85 |
| 123 | 3300005546 | Ga0070696_100822966 | Ga0070696_1008229661 | 85 |
| 124 | 3300005547 | Ga0070693_101385454 | Ga0070693_1013854542 | 85 |
| 125 | 3300005549 | Ga0070704_100076766 | Ga0070704_1000767662 | 85 |
| 126 | 3300005549 | Ga0070704_100100054 | Ga0070704_1001000542 | 85 |
| 127 | 3300005549 | Ga0070704_100123737 | Ga0070704_1001237373 | 85 |
| 128 | 3300005549 | Ga0070704_100240208 | Ga0070704_1002402082 | 85 |
| 129 | 3300005549 | Ga0070704_100654435 | Ga0070704_1006544352 | 85 |
| 130 | 3300005617 | Ga0068859_100429175 | Ga0068859_1004291753 | 85 |
| 131 | 3300005719 | Ga0068861_100045883 | Ga0068861_1000458832 | 85 |
| 132 | 3300005843 | Ga0068860_102113109 | Ga0068860_1021131091 | 85 |
| 133 | 3300005844 | Ga0068862_100725150 | Ga0068862_1007251501 | 85 |
| 134 | 3300005844 | Ga0068862_102317997 | Ga0068862_1023179972 | 85 |
| 135 | 3300005937 | Ga0081455_10034063 | Ga0081455_100340633 | 85 |
| 136 | 3300006038 | Ga0075365_10052057 | Ga0075365_100520572 | 85 |
| 137 | 3300006038 | Ga0075365_10123120 | Ga0075365_101231202 | 85 |
| 138 | 3300006042 | Ga0075368_10082423 | Ga0075368_100824232 | 85 |
| 139 | 3300006042 | Ga0075368_10400976 | Ga0075368_104009761 | 85 |
| 140 | 3300006048 | Ga0075363_100040625 | Ga0075363_1000406252 | 85 |
| 141 | 3300006051 | Ga0075364_10231206 | Ga0075364_102312062 | 85 |
| 142 | 3300006051 | Ga0075364_10458477 | Ga0075364_104584772 | 85 |
| 143 | 3300006178 | Ga0075367_10011977 | Ga0075367_100119773 | 85 |
| 144 | 3300006178 | Ga0075367_10999955 | Ga0075367_109999551 | 85 |
| 145 | 3300006195 | Ga0075366_10175768 | Ga0075366_101757682 | 85 |
| 146 | 3300006844 | Ga0075428_101496412 | Ga0075428_1014964122 | 85 |
| 147 | 3300006847 | Ga0075431_100000177 | Ga0075431_10000017721 | 85 |
| 148 | 3300006847 | Ga0075431_100182479 | Ga0075431_1001824792 | 85 |
| 149 | 3300006847 | Ga0075431_102029310 | Ga0075431_1020293102 | 85 |
| 150 | 3300006852 | Ga0075433_10062474 | Ga0075433_100624742 | 85 |
| 151 | 3300006852 | Ga0075433_10233512 | Ga0075433_102335122 | 85 |
| 152 | 3300006852 | Ga0075433_11401881 | Ga0075433_114018811 | 85 |
| 153 | 3300006852 | Ga0075433_11715424 | Ga0075433_117154241 | 85 |
| 154 | 3300006871 | Ga0075434_101151359 | Ga0075434_1011513592 | 85 |
| 155 | 3300006931 | Ga0097620_100429109 | Ga0097620_1004291092 | 85 |
| 156 | 3300009094 | Ga0111539_10059840 | Ga0111539_100598402 | 85 |
| 157 | 3300009094 | Ga0111539_11433258 | Ga0111539_114332582 | 85 |
| 158 | 3300009101 | Ga0105247_10232508 | Ga0105247_102325082 | 85 |
| 159 | 3300009147 | Ga0114129_10356206 | Ga0114129_103562061 | 85 |
| 160 | 3300011119 | Ga0105246_11606772 | Ga0105246_116067721 | 85 |
| 161 | 3300013296 | Ga0157374_10577413 | Ga0157374_105774132 | 85 |
| 162 | 3300014326 | Ga0157380_10048616 | Ga0157380_100486162 | 85 |
| 163 | 3300025885 | Ga0207653_10004673 | Ga0207653_100046732 | 85 |
| 164 | 3300025910 | Ga0207684_10046772 | Ga0207684_100467724 | 85 |
| 165 | 3300025910 | Ga0207684_10505196 | Ga0207684_105051962 | 85 |
| 166 | 3300025922 | Ga0207646_10009322 | Ga0207646_100093224 | 85 |
| 167 | 3300025923 | Ga0207681_10158605 | Ga0207681_101586052 | 85 |
| 168 | 3300025937 | Ga0207669_11261810 | Ga0207669_112618101 | 85 |
| 169 | 3300025942 | Ga0207689_10134622 | Ga0207689_101346222 | 85 |
| 170 | 3300025942 | Ga0207689_10650320 | Ga0207689_106503202 | 85 |
| 171 | 3300025972 | Ga0207668_10983553 | Ga0207668_109835531 | 85 |
| 172 | 3300026035 | Ga0207703_11271541 | Ga0207703_112715411 | 85 |
| 173 | 3300026067 | Ga0207678_11162803 | Ga0207678_111628032 | 85 |
| 174 | 3300026075 | Ga0207708_10078344 | Ga0207708_100783444 | 85 |
| 175 | 3300026075 | Ga0207708_10820452 | Ga0207708_108204522 | 85 |
| 176 | 3300026075 | Ga0207708_11276023 | Ga0207708_112760232 | 85 |
| 177 | 3300026095 | Ga0207676_10551810 | Ga0207676_105518101 | 85 |
| 178 | 3300026118 | Ga0207675_100068527 | Ga0207675_1000685272 | 85 |
| 179 | 3300027682 | Ga0209971_1119920 | Ga0209971_11199201 | 85 |
| 180 | 3300027695 | Ga0209966_1072198 | Ga0209966_10721981 | 85 |
| 181 | 3300027866 | Ga0209813_10253903 | Ga0209813_102539032 | 85 |
| 182 | 3300027907 | Ga0207428_10259735 | Ga0207428_102597352 | 85 |
| 183 | 3300027907 | Ga0207428_10965819 | Ga0207428_109658192 | 85 |
| 184 | 3300028380 | Ga0268265_10644732 | Ga0268265_106447321 | 85 |
| 185 | 3300028380 | Ga0268265_12263148 | Ga0268265_122631482 | 85 |
| 186 | 3300031665 | Ga0316575_10149982 | Ga0316575_101499822 | 85 |
| 187 | 3300031728 | Ga0316578_10417594 | Ga0316578_104175942 | 85 |
| 188 | 3300032133 | Ga0316583_10232260 | Ga0316583_102322602 | 85 |
| 189 | 3300032137 | Ga0316585_10170767 | Ga0316585_101707672 | 85 |
| 190 | 3300035241 | Ga0373961_0212191 | Ga0373961_0212191_200_472 | 85 |
| 191 | 3300035398 | Ga0316574_0024057 | Ga0316574_0024057_1324_1599 | 85 |
| 192 | 3300036712 | Ga0316584_0064881 | Ga0316584_0064881_568_843 | 85 |
| 193 | 3300049574 | Ga0501038_1389089 | Ga0501038_1389089_149_424 | 85 |
| 194 | 3300049592 | Ga0501076_0571777 | Ga0501076_0571777_572_850 | 85 |
| 195 | 3300049593 | Ga0501077_1012963 | Ga0501077_1012963_75_365 | 85 |
| 196 | 3300049741 | Ga0501079_0354924 | Ga0501079_0354924_832_1107 | 85 |
| 197 | 3300050491 | nmdc:mga00v17_288590_c1 | nmdc:mga00v17_288590_c1_394_666 | 85 |
| 198 | 3300050491 | nmdc:mga00v17_49886_c1 | nmdc:mga00v17_49886_c1_742_1011 | 85 |
| 199 | 3300050491 | nmdc:mga00v17_550985_c1 | nmdc:mga00v17_550985_c1_100_372 | 85 |
| 200 | 3300050492 | nmdc:mga0yw44_53240_c1 | nmdc:mga0yw44_53240_c1_1292_1564 | 85 |
| 201 | 3300050493 | nmdc:mga0k408_139526_c1 | nmdc:mga0k408_139526_c1_500_775 | 85 |
| 202 | 3300050494 | nmdc:mga06z11_724676_c1 | nmdc:mga06z11_724676_c1_224_496 | 85 |
| 203 | 3300050494 | nmdc:mga06z11_7880_c1 | nmdc:mga06z11_7880_c1_2440_2715 | 85 |
| 204 | 3300050495 | nmdc:mga04h51_81736_c1 | nmdc:mga04h51_81736_c1_496_771 | 85 |
| 205 | 3300050507 | nmdc:mga05p37_227859_c1 | nmdc:mga05p37_227859_c1_773_1048 | 85 |
| 206 | 3300050510 | nmdc:mga06r32_1679_c1 | nmdc:mga06r32_1679_c1_14927_15199 | 85 |
| 207 | 3300050511 | nmdc:mga08y16_9539_c1 | nmdc:mga08y16_9539_c1_8980_9252 | 85 |
| 208 | 3300050515 | nmdc:mga0a205_1195867_c1 | nmdc:mga0a205_1195867_c1_96_368 | 85 |
| 209 | 3300050515 | nmdc:mga0a205_14918_c1 | nmdc:mga0a205_14918_c1_3721_4002 | 85 |
| 210 | 3300050515 | nmdc:mga0a205_204266_c1 | nmdc:mga0a205_204266_c1_465_740 | 85 |
| 211 | 3300060353 | Ga0501082_0908488 | Ga0501082_0908488_182_457 | 85 |
| 212 | 3300003320 | rootH2_10074752 | rootH2_100747525 | 86 |
| 213 | 3300005344 | Ga0070661_100374467 | Ga0070661_1003744671 | 86 |
| 214 | 3300005548 | Ga0070665_100000099 | Ga0070665_10000009958 | 86 |
| 215 | 3300005614 | Ga0068856_100501406 | Ga0068856_1005014061 | 86 |
| 216 | 3300005618 | Ga0068864_102568432 | Ga0068864_1025684322 | 86 |
| 217 | 3300005841 | Ga0068863_100000601 | Ga0068863_10000060133 | 86 |
| 218 | 3300005842 | Ga0068858_100004572 | Ga0068858_1000045728 | 86 |
| 219 | 3300005843 | Ga0068860_100242311 | Ga0068860_1002423112 | 86 |
| 220 | 3300006871 | Ga0075434_100236194 | Ga0075434_1002361942 | 86 |
| 221 | 3300006914 | Ga0075436_100099104 | Ga0075436_1000991042 | 86 |
| 222 | 3300007076 | Ga0075435_100718152 | Ga0075435_1007181522 | 86 |
| 223 | 3300009093 | Ga0105240_10005027 | Ga0105240_100050273 | 86 |
| 224 | 3300009093 | Ga0105240_10141630 | Ga0105240_101416303 | 86 |
| 225 | 3300009093 | Ga0105240_10191397 | Ga0105240_101913972 | 86 |
| 226 | 3300009101 | Ga0105247_10170192 | Ga0105247_101701921 | 86 |
| 227 | 3300009174 | Ga0105241_10475031 | Ga0105241_104750312 | 86 |
| 228 | 3300009177 | Ga0105248_12253964 | Ga0105248_122539641 | 86 |
| 229 | 3300009545 | Ga0105237_10010702 | Ga0105237_100107025 | 86 |
| 230 | 3300009551 | Ga0105238_10594462 | Ga0105238_105944621 | 86 |
| 231 | 3300010375 | Ga0105239_11030110 | Ga0105239_110301102 | 86 |
| 232 | 3300025900 | Ga0207710_10450579 | Ga0207710_104505791 | 86 |
| 233 | 3300025911 | Ga0207654_10226239 | Ga0207654_102262392 | 86 |
| 234 | 3300025913 | Ga0207695_10010964 | Ga0207695_100109647 | 86 |
| 235 | 3300025913 | Ga0207695_10096138 | Ga0207695_100961383 | 86 |
| 236 | 3300025914 | Ga0207671_10008486 | Ga0207671_100084864 | 86 |
| 237 | 3300025920 | Ga0207649_10506164 | Ga0207649_105061641 | 86 |
| 238 | 3300025924 | Ga0207694_10044961 | Ga0207694_100449612 | 86 |
| 239 | 3300025941 | Ga0207711_11628488 | Ga0207711_116284882 | 86 |
| 240 | 3300026035 | Ga0207703_10006369 | Ga0207703_100063694 | 86 |
| 241 | 3300026035 | Ga0207703_11724729 | Ga0207703_117247292 | 86 |
| 242 | 3300026041 | Ga0207639_10498287 | Ga0207639_104982872 | 86 |
| 243 | 3300026078 | Ga0207702_10399723 | Ga0207702_103997232 | 86 |
| 244 | 3300026088 | Ga0207641_10030669 | Ga0207641_100306693 | 86 |
| 245 | 3300028379 | Ga0268266_10000116 | Ga0268266_1000011680 | 86 |
| 246 | 3300030521 | Ga0307511_10000140 | Ga0307511_1000014040 | 86 |
| 247 | 3300031010 | Ga0265771_1004867 | Ga0265771_10048671 | 86 |
| 248 | 3300037853 | Ga0436364_1415213 | Ga0436364_1415213_116_379 | 86 |
| 249 | 3300050512 | nmdc:mga0n895_314149_c1 | nmdc:mga0n895_314149_c1_408_692 | 86 |
| 250 | 3300050513 | nmdc:mga0rr50_706447_c1 | nmdc:mga0rr50_706447_c1_108_392 | 86 |
| 251 | 3300050514 | nmdc:mga08x19_134281_c1 | nmdc:mga08x19_134281_c1_1011_1295 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdv-assembly1.cif.gz_S | rnase r bound to a 30s degradation intermediate (state ii) | 0.9647 | 5 | 83 |
| 8cec-assembly1.cif.gz_S | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9597 | 5 | 83 |
| 7qv2-assembly1.cif.gz_t | bacillus subtilis collided disome (collided 70s) | 0.9581 | 6 | 83 |
| 5v93-assembly1.cif.gz_t | cryo-em structure of the 70s ribosome from mycobacterium tuberculosis bound with capreomycin | 0.9544 | 9 | 83 |
| 7qv3-assembly1.cif.gz_t | bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) | 0.9508 | 5 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFB7_11_132_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9561 | 50 | 80 | 3.40.50.1010 |
| 4kd0T00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9523 | 6 | 84 | 1.20.58.110 |
| 5iwaT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.943 | 6 | 84 | 1.20.58.110 |
| af_P9WH41_1_86_1.20.58.110 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9417 | 1 | 83 | 1.20.58.110 |
| 4kdaT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9417 | 6 | 84 | 1.20.58.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8DMK7-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9943 | 14 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7C5G4I4-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9884 | 24 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2M6ZWJ6-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9877 | 14 | 83 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A2H0UW60-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9859 | 24 | 83 |
GO:0003735
GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A3N6B8Z8-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9791 | 24 | 83 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar