F362307

General Info

Members Datasets Scaffolds Average Seq Length
251 172 502 141

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10201099|Ga0075365_102010992
Length 161
Sequence MEPLTLASGSRDLWKDLCGTIRDVSDCVFCQIISGEVPGHLVLETDDLVAFLDARPVFKGHVLLAPRQHVETLPDLPAELRDGFVEAAQRLATAVKDGLAAQGSFVAINNTVSQSVPHLHLHVVPRTKGDGLRGFFWPRTKYADGEAASYCERLRAALEDS

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
103 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2643221641 Nocardioides sp. Root122 Isolate Unclassified
172 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0.4
Rhizoplane 4.78
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10201099 3300006038 Bacteria 1395
2 Ga0065714_10002203 3300005288 Bacteria 58048
3 Ga0065712_10000140 3300005290 Bacteria 58055
4 Ga0065715_10089561 3300005293 Bacteria 9479
5 Ga0070690_100119485 3300005330 Bacteria 1768
6 Ga0068869_100072748 3300005334 Bacteria 2547
7 Ga0070682_100117096 3300005337 Bacteria 1783
8 Ga0068868_100076260 3300005338 Bacteria 2680
9 Ga0068868_101501411 3300005338 Bacteria 631
10 Ga0070689_100009650 3300005340 Bacteria 6847
11 Ga0070687_100027503 3300005343 Bacteria 2749
12 Ga0070661_100267071 3300005344 Bacteria 1324
13 Ga0070671_100023477 3300005355 Bacteria 5047
14 Ga0070673_100022922 3300005364 Bacteria 4555
15 Ga0070688_100059160 3300005365 Bacteria 2415
16 Ga0070667_100089331 3300005367 Bacteria 2647
17 Ga0070714_100517207 3300005435 Bacteria 1140
18 Ga0070714_100908941 3300005435 Bacteria 855
19 Ga0070714_101665204 3300005435 Bacteria 623
20 Ga0070713_100112403 3300005436 Bacteria 2376
21 Ga0070711_100174039 3300005439 Bacteria 1643
22 Ga0070705_100129327 3300005440 Bacteria 1645
23 Ga0070694_100023104 3300005444 Bacteria 3994
24 Ga0070681_10161789 3300005458 Unclassified 2162
25 Ga0068867_100008583 3300005459 Bacteria 7213
26 Ga0070665_100029705 3300005548 Bacteria 5500
27 Ga0070665_100300814 3300005548 Bacteria 1607
28 Ga0070664_100381458 3300005564 Bacteria 1287
29 Ga0068854_100028172 3300005578 Bacteria 3879
30 Ga0070702_100007877 3300005615 Bacteria 5124
31 Ga0068864_100277427 3300005618 Bacteria 1563
32 Ga0068861_101207323 3300005719 Bacteria 732
33 Ga0070717_10133012 3300006028 Bacteria 2140
34 Ga0070717_10198790 3300006028 Bacteria 1755
35 Ga0070717_10688060 3300006028 Bacteria 929
36 Ga0070717_11251349 3300006028 Bacteria 675
37 Ga0075365_10044056 3300006038 Bacteria 2922
38 Ga0075365_10281549 3300006038 Bacteria 1170
39 Ga0075368_10345856 3300006042 Bacteria 647
40 Ga0070716_100124717 3300006173 Bacteria 1618
41 Ga0070712_100039696 3300006175 Bacteria 3223
42 Ga0075367_10041258 3300006178 Bacteria 2697
43 Ga0097621_100084620 3300006237 Bacteria 2644
44 Ga0075370_10421610 3300006353 Bacteria 802
45 Ga0105250_10093741 3300009092 Bacteria 1223
46 Ga0105240_10005318 3300009093 Bacteria 19206
47 Ga0111539_10516786 3300009094 Bacteria 1391
48 Ga0111539_11313284 3300009094 Bacteria 839
49 Ga0105245_10021819 3300009098 Bacteria 5620
50 Ga0105245_10902579 3300009098 Bacteria 925
51 Ga0114129_10680584 3300009147 Bacteria 1324
52 Ga0105243_10032578 3300009148 Bacteria 4028
53 Ga0105241_10168235 3300009174 Bacteria 1808
54 Ga0105242_10119002 3300009176 Bacteria 2263
55 Ga0105248_10090913 3300009177 Bacteria 3437
56 Ga0105237_11030329 3300009545 Bacteria 830
57 Ga0105249_10050188 3300009553 Bacteria 3804
58 Ga0105239_10019900 3300010375 Bacteria 7409
59 Ga0105239_10779171 3300010375 Bacteria 1095
60 Ga0105246_11108805 3300011119 Bacteria 723
61 Ga0157369_10354154 3300013105 Bacteria 1524
62 Ga0157369_10668388 3300013105 Unclassified 1070
63 Ga0157374_10047885 3300013296 Bacteria 3964
64 Ga0163162_10422243 3300013306 Bacteria 1466
65 Ga0157380_10013657 3300014326 Bacteria 5929
66 Ga0157380_10055053 3300014326 Bacteria 3158
67 Ga0157380_10371544 3300014326 Bacteria 1346
68 Ga0182008_10071047 3300014497 Bacteria 1712
69 Ga0157377_10004930 3300014745 Bacteria 6215
70 Ga0157376_10010608 3300014969 Bacteria 6748
71 Ga0213872_10000207 3300021361 Bacteria 52310
72 Ga0213874_10059418 3300021377 Bacteria 1194
73 Ga0213876_10003330 3300021384 Bacteria 9205
74 Ga0213876_10014586 3300021384 Bacteria 4163
75 Ga0213876_10078096 3300021384 Bacteria 1749
76 Ga0213875_10060240 3300021388 Bacteria 1776
77 Ga0213875_10091375 3300021388 Bacteria 1420
78 Ga0207643_10007259 3300025908 Bacteria 5947
79 Ga0207707_10363817 3300025912 Bacteria 1245
80 Ga0207707_10924346 3300025912 Bacteria 720
81 Ga0207695_10012114 3300025913 Bacteria 10363
82 Ga0207657_11410397 3300025919 Bacteria 523
83 Ga0207649_10411710 3300025920 Bacteria 1014
84 Ga0207659_10362794 3300025926 Bacteria 1204
85 Ga0207687_10199117 3300025927 Bacteria 1564
86 Ga0207687_10433651 3300025927 Bacteria 1087
87 Ga0207700_10077674 3300025928 Bacteria 2580
88 Ga0207664_10156402 3300025929 Bacteria 1941
89 Ga0207664_10347692 3300025929 Bacteria 1312
90 Ga0207644_10150732 3300025931 Bacteria 1799
91 Ga0207686_10090753 3300025934 Bacteria 2016
92 Ga0207670_10052421 3300025936 Bacteria 2743
93 Ga0207704_10143443 3300025938 Bacteria 1674
94 Ga0207704_11065072 3300025938 Bacteria 686
95 Ga0207711_10171017 3300025941 Bacteria 1971
96 Ga0207689_10002120 3300025942 Bacteria 18654
97 Ga0207679_10234637 3300025945 Bacteria 1551
98 Ga0207640_10110038 3300025981 Bacteria 1951
99 Ga0207658_10118241 3300025986 Bacteria 2108
100 Ga0207708_10012529 3300026075 Bacteria 6322
101 Ga0207648_10020676 3300026089 Bacteria 5925
102 Ga0207676_10049964 3300026095 Bacteria 3257
103 Ga0207675_100027880 3300026118 Bacteria 5261
104 Ga0207675_100036538 3300026118 Bacteria 4582
105 Ga0268266_10069813 3300028379 Unclassified 3045
106 Ga0268266_10176542 3300028379 Bacteria 1942
107 Ga0314311_1014698 3300030733 Bacteria 636
108 Ga0307408_101739741 3300031548 Bacteria 595
109 Ga0307405_10063876 3300031731 Bacteria 2337
110 Ga0307407_10068238 3300031903 Bacteria 2105
111 Ga0307412_10071930 3300031911 Bacteria 2362
112 Ga0307412_11242755 3300031911 Bacteria 668
113 Ga0307409_100021959 3300031995 Bacteria 4389
114 Ga0307409_100222344 3300031995 Bacteria 1705
115 Ga0307409_100918524 3300031995 Bacteria 890
116 Ga0307416_100000326 3300032002 Bacteria 24620
117 Ga0307416_100040273 3300032002 Bacteria 3628
118 Ga0307415_100001274 3300032126 Bacteria 11867
119 Ga0307415_100485642 3300032126 Bacteria 1076
120 Ga0307415_100690230 3300032126 Bacteria 920
121 Ga0373937_0604495 3300036401 Bacteria 1041
122 Ga0436364_0034763 3300037853 Bacteria 5770
123 Ga0436364_0048902 3300037853 Bacteria 2779
124 Ga0436364_0379493 3300037853 Bacteria 10371
125 Ga0436364_0477978 3300037853 Bacteria 1022
126 Ga0436364_1168266 3300037853 Bacteria 1167
127 Ga0436364_1314596 3300037853 Unclassified 3190
128 Ga0436364_1368906 3300037853 Unclassified 665
129 Ga0436364_1389894 3300037853 Bacteria 1223
130 Ga0436365_0113444 3300039437 Bacteria 4213
131 Ga0436365_0764181 3300039437 Bacteria 2327
132 Ga0436365_1436448 3300039437 Bacteria 4869
133 Ga0436365_1647331 3300039437 Bacteria 1609
134 Ga0436365_1855365 3300039437 Bacteria 34389
135 Ga0436360_0529650 3300039438 Bacteria 638
136 Ga0436361_1052449 3300039447 Bacteria 57332
137 Ga0436363_0642522 3300039450 Bacteria 1878
138 Ga0436363_0674753 3300039450 Bacteria 1360
139 Ga0436363_1228630 3300039450 Bacteria 1072
140 Ga0436363_1535671 3300039450 Bacteria 1860
141 Ga0436363_1660567 3300039450 Bacteria 1504
142 Ga0436362_0026593 3300039453 Unclassified 594
143 Ga0436362_0055506 3300039453 Bacteria 1694
144 Ga0436362_0841889 3300039453 Bacteria 1127
145 Ga0436362_1109095 3300039453 Unclassified 3674
146 Ga0439465_0363921 3300041413 Bacteria 547
147 Ga0451789_0114300 3300041443 Bacteria 2212
148 Ga0451791_0392889 3300041451 Bacteria 830
149 Ga0451793_1831901 3300041452 Bacteria 1460
150 Ga0451797_0952396 3300041453 Bacteria 544
151 Ga0451795_0739506 3300041456 Bacteria 556
152 Ga0451833_1388387 3300041491 Bacteria 576
153 Ga0451841_0144115 3300041498 Bacteria 1188
154 Ga0451849_1512413 3300041505 Bacteria 978
155 Ga0451843_0346221 3300041509 Bacteria 3079
156 Ga0451853_1589649 3300041512 Bacteria 1263
157 Ga0450923_073678 3300042125 Bacteria 760
158 Ga0466972_0450352 3300044658 Bacteria 605
159 Ga0466965_0483925 3300044683 Bacteria 692
160 Ga0466966_0040138 3300044684 Bacteria 3013
161 Ga0466966_0041719 3300044684 Bacteria 2948
162 Ga0466963_0177842 3300044694 Bacteria 1485
163 Ga0466963_0391213 3300044694 Bacteria 980
164 Ga0466963_0572947 3300044694 Bacteria 797
165 Ga0466968_0081079 3300044735 Bacteria 1426
166 Ga0466970_0047198 3300044765 Bacteria 2295
167 Ga0466960_0196834 3300044901 Bacteria 1099
168 Ga0466959_0120475 3300045049 Bacteria 1866
169 Ga0466959_0305564 3300045049 Bacteria 1089
170 Ga0466959_0706945 3300045049 Bacteria 675
171 Ga0466959_0736796 3300045049 Archaea 660
172 Ga0466959_1040642 3300045049 Unclassified 545
173 Ga0466958_0008834 3300045836 Bacteria 5599
174 Ga0466967_0003243 3300045976 Bacteria 10528
175 Ga0466967_0010804 3300045976 Bacteria 6870
176 Ga0466967_0055286 3300045976 Bacteria 3496
177 Ga0466967_0084278 3300045976 Bacteria 2876
178 Ga0466967_0574147 3300045976 Bacteria 1111
179 Ga0466967_1246677 3300045976 Bacteria 741
180 Ga0495664_0410805 3300046477 Bacteria 812
181 Ga0495618_0256004 3300046514 Bacteria 1097
182 Ga0495628_0575079 3300046516 Bacteria 807
183 Ga0495645_0838037 3300046543 Bacteria 549
184 Ga0495667_0068930 3300046559 Bacteria 2309
185 Ga0495646_0483164 3300046680 Bacteria 637
186 Ga0495684_0200219 3300047471 Bacteria 1472
187 Ga0496104_0098117 3300048907 Bacteria 2805
188 Ga0496105_0292237 3300048908 Bacteria 1312
189 Ga0496106_0282372 3300048909 Unclassified 1330
190 Ga0496107_0442844 3300048910 Unclassified 965
191 Ga0496108_0317006 3300048911 Unclassified 1359
192 Ga0496108_0559788 3300048911 Bacteria 997
193 Ga0496114_0597392 3300048917 Bacteria 973
194 Ga0496126_0933558 3300048929 Unclassified 656
195 Ga0501031_0018592 3300049568 Bacteria 4526
196 Ga0501031_0123752 3300049568 Bacteria 1689
197 Ga0501031_0138819 3300049568 Bacteria 1588
198 Ga0501033_0633560 3300049570 Bacteria 731
199 Ga0501034_0023867 3300049571 Bacteria 6227
200 Ga0501036_0018439 3300049572 Bacteria 5847
201 Ga0501036_1515606 3300049572 Bacteria 542
202 Ga0501037_0028102 3300049573 Bacteria 4154
203 Ga0501038_0000378 3300049574 Bacteria 38322
204 Ga0501039_0095046 3300049575 Bacteria 2323
205 Ga0501039_0316553 3300049575 Bacteria 1227
206 Ga0501040_0003988 3300049576 Bacteria 9590
207 Ga0501040_0078937 3300049576 Bacteria 2278
208 Ga0501041_0523558 3300049577 Bacteria 755
209 Ga0501042_0012192 3300049578 Bacteria 5817
210 Ga0501042_0065476 3300049578 Bacteria 2597
211 Ga0501043_0022852 3300049579 Bacteria 4904
212 Ga0501046_0271263 3300049580 Bacteria 1244
213 Ga0501048_0001191 3300049582 Bacteria 19694
214 Ga0501048_0094060 3300049582 Bacteria 2114
215 Ga0501067_0098589 3300049583 Bacteria 1623
216 Ga0501068_0022628 3300049584 Bacteria 3676
217 Ga0501071_0005266 3300049587 Bacteria 8293
218 Ga0501071_0049686 3300049587 Bacteria 3020
219 Ga0501071_0263651 3300049587 Bacteria 1302
220 Ga0501072_0079729 3300049588 Bacteria 2593
221 Ga0501074_0015043 3300049590 Bacteria 5629
222 Ga0501074_1118180 3300049590 Bacteria 553
223 Ga0501075_0020110 3300049591 Bacteria 4849
224 Ga0501075_0365437 3300049591 Bacteria 1100
225 Ga0501076_0073277 3300049592 Bacteria 2742
226 Ga0501076_0932521 3300049592 Bacteria 716
227 Ga0501077_0071178 3300049593 Bacteria 2204
228 Ga0501261_116428 3300049690 Bacteria 525
229 Ga0501079_1093750 3300049741 Bacteria 628
230 Ga0501080_0112800 3300049742 Bacteria 2520
231 Ga0501081_0599541 3300049743 Bacteria 825
232 Ga0501035_0260911 3300049822 Bacteria 1469
233 Ga0501044_0108428 3300049823 Bacteria 2787
234 Ga0501045_0000713 3300049824 Bacteria 21161
235 Ga0501045_0901547 3300049824 Bacteria 650
236 nmdc:mga03n38_673326_c1 3300050490 Bacteria 594
237 nmdc:mga0yw44_181858_c1 3300050492 Bacteria 1384
238 nmdc:mga0yw44_705313_c1 3300050492 Bacteria 685
239 nmdc:mga06z11_358647_c1 3300050494 Bacteria 873
240 nmdc:mga08y16_1085819_c1 3300050511 Bacteria 776
241 nmdc:mga08y16_775519_c1 3300050511 Bacteria 953
242 Ga0500573_0211584 3300053140 Bacteria 1023
243 Ga0500616_0080986 3300053153 Bacteria 1631
244 Ga0501084_0050774 3300054114 Bacteria 3470
245 Ga0501084_0554544 3300054114 Bacteria 971
246 Ga0501082_0021995 3300060353 Bacteria 5498
247 Ga0530510_0014252 3300061734 Bacteria 5605
248 Ga0530510_0257587 3300061734 Bacteria 1301
249 Ga0530510_0654501 3300061734 Bacteria 800
250 2644231178 2643221641 Bacteria 4490190
251 8054610520 8054609563 Bacteria 5170090
252 Ga0075365_10201099
253 Ga0065714_10002203
254 Ga0065712_10000140
255 Ga0065715_10089561
256 Ga0070690_100119485
257 Ga0068869_100072748
258 Ga0070682_100117096
259 Ga0068868_100076260
260 Ga0068868_101501411
261 Ga0070689_100009650
262 Ga0070687_100027503
263 Ga0070661_100267071
264 Ga0070671_100023477
265 Ga0070673_100022922
266 Ga0070688_100059160
267 Ga0070667_100089331
268 Ga0070714_100517207
269 Ga0070714_100908941
270 Ga0070714_101665204
271 Ga0070713_100112403
272 Ga0070711_100174039
273 Ga0070705_100129327
274 Ga0070694_100023104
275 Ga0070681_10161789
276 Ga0068867_100008583
277 Ga0070665_100029705
278 Ga0070665_100300814
279 Ga0070664_100381458
280 Ga0068854_100028172
281 Ga0070702_100007877
282 Ga0068864_100277427
283 Ga0068861_101207323
284 Ga0070717_10133012
285 Ga0070717_10198790
286 Ga0070717_10688060
287 Ga0070717_11251349
288 Ga0075365_10044056
289 Ga0075365_10281549
290 Ga0075368_10345856
291 Ga0070716_100124717
292 Ga0070712_100039696
293 Ga0075367_10041258
294 Ga0097621_100084620
295 Ga0075370_10421610
296 Ga0105250_10093741
297 Ga0105240_10005318
298 Ga0111539_10516786
299 Ga0111539_11313284
300 Ga0105245_10021819
301 Ga0105245_10902579
302 Ga0114129_10680584
303 Ga0105243_10032578
304 Ga0105241_10168235
305 Ga0105242_10119002
306 Ga0105248_10090913
307 Ga0105237_11030329
308 Ga0105249_10050188
309 Ga0105239_10019900
310 Ga0105239_10779171
311 Ga0105246_11108805
312 Ga0157369_10354154
313 Ga0157369_10668388
314 Ga0157374_10047885
315 Ga0163162_10422243
316 Ga0157380_10013657
317 Ga0157380_10055053
318 Ga0157380_10371544
319 Ga0182008_10071047
320 Ga0157377_10004930
321 Ga0157376_10010608
322 Ga0213872_10000207
323 Ga0213874_10059418
324 Ga0213876_10003330
325 Ga0213876_10014586
326 Ga0213876_10078096
327 Ga0213875_10060240
328 Ga0213875_10091375
329 Ga0207643_10007259
330 Ga0207707_10363817
331 Ga0207707_10924346
332 Ga0207695_10012114
333 Ga0207657_11410397
334 Ga0207649_10411710
335 Ga0207659_10362794
336 Ga0207687_10199117
337 Ga0207687_10433651
338 Ga0207700_10077674
339 Ga0207664_10156402
340 Ga0207664_10347692
341 Ga0207644_10150732
342 Ga0207686_10090753
343 Ga0207670_10052421
344 Ga0207704_10143443
345 Ga0207704_11065072
346 Ga0207711_10171017
347 Ga0207689_10002120
348 Ga0207679_10234637
349 Ga0207640_10110038
350 Ga0207658_10118241
351 Ga0207708_10012529
352 Ga0207648_10020676
353 Ga0207676_10049964
354 Ga0207675_100027880
355 Ga0207675_100036538
356 Ga0268266_10069813
357 Ga0268266_10176542
358 Ga0314311_1014698
359 Ga0307408_101739741
360 Ga0307405_10063876
361 Ga0307407_10068238
362 Ga0307412_10071930
363 Ga0307412_11242755
364 Ga0307409_100021959
365 Ga0307409_100222344
366 Ga0307409_100918524
367 Ga0307416_100000326
368 Ga0307416_100040273
369 Ga0307415_100001274
370 Ga0307415_100485642
371 Ga0307415_100690230
372 Ga0373937_0604495
373 Ga0436364_0034763
374 Ga0436364_0048902
375 Ga0436364_0379493
376 Ga0436364_0477978
377 Ga0436364_1168266
378 Ga0436364_1314596
379 Ga0436364_1368906
380 Ga0436364_1389894
381 Ga0436365_0113444
382 Ga0436365_0764181
383 Ga0436365_1436448
384 Ga0436365_1647331
385 Ga0436365_1855365
386 Ga0436360_0529650
387 Ga0436361_1052449
388 Ga0436363_0642522
389 Ga0436363_0674753
390 Ga0436363_1228630
391 Ga0436363_1535671
392 Ga0436363_1660567
393 Ga0436362_0026593
394 Ga0436362_0055506
395 Ga0436362_0841889
396 Ga0436362_1109095
397 Ga0439465_0363921
398 Ga0451789_0114300
399 Ga0451791_0392889
400 Ga0451793_1831901
401 Ga0451797_0952396
402 Ga0451795_0739506
403 Ga0451833_1388387
404 Ga0451841_0144115
405 Ga0451849_1512413
406 Ga0451843_0346221
407 Ga0451853_1589649
408 Ga0450923_073678
409 Ga0466972_0450352
410 Ga0466965_0483925
411 Ga0466966_0040138
412 Ga0466966_0041719
413 Ga0466963_0177842
414 Ga0466963_0391213
415 Ga0466963_0572947
416 Ga0466968_0081079
417 Ga0466970_0047198
418 Ga0466960_0196834
419 Ga0466959_0120475
420 Ga0466959_0305564
421 Ga0466959_0706945
422 Ga0466959_0736796
423 Ga0466959_1040642
424 Ga0466958_0008834
425 Ga0466967_0003243
426 Ga0466967_0010804
427 Ga0466967_0055286
428 Ga0466967_0084278
429 Ga0466967_0574147
430 Ga0466967_1246677
431 Ga0495664_0410805
432 Ga0495618_0256004
433 Ga0495628_0575079
434 Ga0495645_0838037
435 Ga0495667_0068930
436 Ga0495646_0483164
437 Ga0495684_0200219
438 Ga0496104_0098117
439 Ga0496105_0292237
440 Ga0496106_0282372
441 Ga0496107_0442844
442 Ga0496108_0317006
443 Ga0496108_0559788
444 Ga0496114_0597392
445 Ga0496126_0933558
446 Ga0501031_0018592
447 Ga0501031_0123752
448 Ga0501031_0138819
449 Ga0501033_0633560
450 Ga0501034_0023867
451 Ga0501036_0018439
452 Ga0501036_1515606
453 Ga0501037_0028102
454 Ga0501038_0000378
455 Ga0501039_0095046
456 Ga0501039_0316553
457 Ga0501040_0003988
458 Ga0501040_0078937
459 Ga0501041_0523558
460 Ga0501042_0012192
461 Ga0501042_0065476
462 Ga0501043_0022852
463 Ga0501046_0271263
464 Ga0501048_0001191
465 Ga0501048_0094060
466 Ga0501067_0098589
467 Ga0501068_0022628
468 Ga0501071_0005266
469 Ga0501071_0049686
470 Ga0501071_0263651
471 Ga0501072_0079729
472 Ga0501074_0015043
473 Ga0501074_1118180
474 Ga0501075_0020110
475 Ga0501075_0365437
476 Ga0501076_0073277
477 Ga0501076_0932521
478 Ga0501077_0071178
479 Ga0501261_116428
480 Ga0501079_1093750
481 Ga0501080_0112800
482 Ga0501081_0599541
483 Ga0501035_0260911
484 Ga0501044_0108428
485 Ga0501045_0000713
486 Ga0501045_0901547
487 nmdc:mga03n38_673326_c1
488 nmdc:mga0yw44_181858_c1
489 nmdc:mga0yw44_705313_c1
490 nmdc:mga06z11_358647_c1
491 nmdc:mga08y16_1085819_c1
492 nmdc:mga08y16_775519_c1
493 Ga0500573_0211584
494 Ga0500616_0080986
495 Ga0501084_0050774
496 Ga0501084_0554544
497 Ga0501082_0021995
498 Ga0530510_0014252
499 Ga0530510_0257587
500 Ga0530510_0654501
501 2644231178
502 8054610520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

34

129

0.96

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

26

133

0.92

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

17

133

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.935 2 136
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.919 1 136
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9176 2 136
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9133 4 141
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9112 6 140
ID Description Score Start End Superfamily
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9508 3 107 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9507 18 104 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9432 18 107 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9283 5 140 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9199 1 107 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9906 2 101 GO:0009117
GO:0016787
AF-A0A7J9YY17-F1-model_v4 HIT domain-containing protein 0.9879 1 108 GO:0003824
GO:0009117
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9809 2 101 GO:0009117
GO:0016787
AF-D2EFV4-F1-model_v4 Histidine triad (HIT) protein 0.9806 2 141 GO:0003824
GO:0009117
GO:0016020
AF-A0A7J9YY17-F1-model_v4 HIT domain-containing protein 0.9789 1 108 GO:0003824
GO:0009117

Map