F362248

General Info

Members Datasets Scaffolds Average Seq Length
251 136 502 300

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100005856|Ga0070699_1000058562
Length 361
Sequence VSTRIVYSARYRVDIGPHVFPTRKYDLVYDALGRPPAIDPPPATWEELALVHTPEYLEKLRTGTMSDEDIAQLELPWSPEMVEGFRVMVGGTIQAALFAADLEGRSSKSEIGGISDFRVAAHIGGGLHHAFPNHGEGFCPFNDVAVATRVLQRRGIERIAIVDLDVHHGNGSAFIFNGGAPLPPQARSEHSSALAGPGRSPRAYPEQNAADANVFTFSMHQQHNYPMWKPRGSLDVGLPDGTRDATFLGELDRALPKVVAHRPQCVFYLAGADPYEDDQLGGLRLTREGLRRRDRLVIDTFRKADVPVVVTLAGGYARRVEDTVAIHVATIEEAMTAAAAAGRRPAQPGAVPDRRASSGEG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.99
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100005856 3300005518 Bacteria 10738
2 Ga0065712_10072824 3300005290 Bacteria 4586
3 Ga0065715_10202302 3300005293 Bacteria 1355
4 Ga0065715_10217349 3300005293 Bacteria 1287
5 Ga0070676_10004007 3300005328 Bacteria 7730
6 Ga0070676_10146793 3300005328 Bacteria 1506
7 Ga0070690_100025581 3300005330 Bacteria 3635
8 Ga0070690_100140049 3300005330 Bacteria 1641
9 Ga0070670_100014725 3300005331 Bacteria 6716
10 Ga0070680_100136884 3300005336 Bacteria 2052
11 Ga0068868_100262288 3300005338 Bacteria 1457
12 Ga0068868_100521817 3300005338 Bacteria 1043
13 Ga0070689_100140319 3300005340 Bacteria 1943
14 Ga0070691_10039117 3300005341 Bacteria 2241
15 Ga0070687_100079797 3300005343 Bacteria 1782
16 Ga0070669_100298787 3300005353 Bacteria 1294
17 Ga0070675_100013846 3300005354 Bacteria 6350
18 Ga0070675_100033643 3300005354 Bacteria 4157
19 Ga0070675_100482077 3300005354 Bacteria 1116
20 Ga0070673_100037181 3300005364 Bacteria 3708
21 Ga0070673_100156835 3300005364 Bacteria 1932
22 Ga0070688_100079714 3300005365 Bacteria 2116
23 Ga0070713_100021462 3300005436 Bacteria 4969
24 Ga0070701_10005621 3300005438 Bacteria 5199
25 Ga0070701_10020189 3300005438 Bacteria 3160
26 Ga0070701_10162554 3300005438 Bacteria 1294
27 Ga0070705_100000288 3300005440 Bacteria 30044
28 Ga0070705_100075036 3300005440 Bacteria 2058
29 Ga0070700_100043795 3300005441 Bacteria 2754
30 Ga0070694_100006823 3300005444 Bacteria 6935
31 Ga0070694_100087048 3300005444 Unclassified 2184
32 Ga0070694_100192717 3300005444 Bacteria 1514
33 Ga0070708_100131653 3300005445 Bacteria 2315
34 Ga0070662_100076986 3300005457 Bacteria 2474
35 Ga0068867_100064990 3300005459 Bacteria 2714
36 Ga0068867_100161452 3300005459 Bacteria 1767
37 Ga0070685_10079500 3300005466 Bacteria 1962
38 Ga0070706_100072245 3300005467 Bacteria 3193
39 Ga0070706_100270260 3300005467 Bacteria 1586
40 Ga0070707_100023133 3300005468 Bacteria 5878
41 Ga0070698_100000175 3300005471 Bacteria 59995
42 Ga0070698_100002474 3300005471 Bacteria 20388
43 Ga0070698_100058771 3300005471 Bacteria 3887
44 Ga0070698_100199339 3300005471 Bacteria 1938
45 Ga0070699_100000422 3300005518 Bacteria 40663
46 Ga0070699_100002410 3300005518 Bacteria 16786
47 Ga0070699_100052795 3300005518 Bacteria 3517
48 Ga0070699_100116059 3300005518 Bacteria 2352
49 Ga0070697_100140927 3300005536 Bacteria 2028
50 Ga0070672_100166333 3300005543 Bacteria 1832
51 Ga0070672_100201037 3300005543 Bacteria 1666
52 Ga0070695_100003016 3300005545 Bacteria 9815
53 Ga0070695_100003966 3300005545 Bacteria 8646
54 Ga0070696_100001927 3300005546 Bacteria 13672
55 Ga0070696_100036162 3300005546 Bacteria 3403
56 Ga0070696_100073694 3300005546 Bacteria 2406
57 Ga0070696_100257249 3300005546 Unclassified 1322
58 Ga0070665_100063675 3300005548 Bacteria 3698
59 Ga0070704_100006945 3300005549 Bacteria 6712
60 Ga0070704_100039144 3300005549 Bacteria 3253
61 Ga0070704_100056462 3300005549 Bacteria 2788
62 Ga0070704_100057078 3300005549 Bacteria 2775
63 Ga0070704_100418914 3300005549 Bacteria 1146
64 Ga0070664_100276566 3300005564 Bacteria 1513
65 Ga0070664_100297576 3300005564 Bacteria 1458
66 Ga0068857_100147897 3300005577 Bacteria 2126
67 Ga0068857_100414869 3300005577 Bacteria 1254
68 Ga0070702_100010666 3300005615 Bacteria 4537
69 Ga0068859_100004314 3300005617 Bacteria 14503
70 Ga0068859_100007346 3300005617 Bacteria 11179
71 Ga0068859_100093356 3300005617 Bacteria 3061
72 Ga0068864_100384086 3300005618 Bacteria 1331
73 Ga0068864_100463719 3300005618 Bacteria 1213
74 Ga0068870_10048126 3300005840 Bacteria 2244
75 Ga0068870_10170206 3300005840 Bacteria 1299
76 Ga0068870_10173094 3300005840 Bacteria 1290
77 Ga0068863_100024942 3300005841 Bacteria 5703
78 Ga0068863_100071108 3300005841 Bacteria 3292
79 Ga0068863_100098938 3300005841 Bacteria 2771
80 Ga0068863_100214593 3300005841 Bacteria 1853
81 Ga0068858_100000970 3300005842 Bacteria 29675
82 Ga0068858_100036533 3300005842 Bacteria 4555
83 Ga0068858_100499105 3300005842 Bacteria 1176
84 Ga0068860_100008509 3300005843 Bacteria 10221
85 Ga0068860_100273110 3300005843 Bacteria 1650
86 Ga0068862_100075180 3300005844 Bacteria 2921
87 Ga0081455_10325664 3300005937 Bacteria 1093
88 Ga0075428_100040258 3300006844 Bacteria 5143
89 Ga0075428_100098824 3300006844 Bacteria 3182
90 Ga0075428_100232351 3300006844 Bacteria 1990
91 Ga0075430_100001102 3300006846 Bacteria 21482
92 Ga0075430_100214859 3300006846 Bacteria 1596
93 Ga0075433_10013066 3300006852 Bacteria 6735
94 Ga0075433_10023382 3300006852 Bacteria 5201
95 Ga0075433_10103847 3300006852 Bacteria 2517
96 Ga0075433_10121444 3300006852 Bacteria 2320
97 Ga0075434_100100747 3300006871 Bacteria 2895
98 Ga0075434_100303347 3300006871 Bacteria 1617
99 Ga0075434_100334648 3300006871 Bacteria 1534
100 Ga0075434_100516101 3300006871 Bacteria 1215
101 Ga0075436_100002218 3300006914 Bacteria 13409
102 Ga0097620_100004314 3300006931 Bacteria 14503
103 Ga0097620_100007346 3300006931 Bacteria 11179
104 Ga0097620_100093360 3300006931 Bacteria 3061
105 Ga0075435_100005188 3300007076 Bacteria 9061
106 Ga0075435_100095573 3300007076 Bacteria 2457
107 Ga0075435_100231853 3300007076 Bacteria 1569
108 Ga0105240_10026532 3300009093 Bacteria 7600
109 Ga0105240_10174515 3300009093 Bacteria 2542
110 Ga0111539_10005304 3300009094 Bacteria 16687
111 Ga0111539_10025243 3300009094 Bacteria 7285
112 Ga0111539_10114075 3300009094 Bacteria 3169
113 Ga0111539_10238326 3300009094 Bacteria 2117
114 Ga0111539_10281723 3300009094 Bacteria 1934
115 Ga0111539_10437882 3300009094 Bacteria 1522
116 Ga0105247_10007244 3300009101 Bacteria 6811
117 Ga0114129_10001158 3300009147 Bacteria 34926
118 Ga0114129_10013237 3300009147 Bacteria 11749
119 Ga0114129_10016799 3300009147 Bacteria 10417
120 Ga0114129_10029342 3300009147 Bacteria 7793
121 Ga0114129_10036700 3300009147 Bacteria 6920
122 Ga0114129_10057707 3300009147 Bacteria 5431
123 Ga0114129_10093604 3300009147 Bacteria 4162
124 Ga0114129_10094174 3300009147 Bacteria 4149
125 Ga0114129_10123908 3300009147 Bacteria 3554
126 Ga0114129_10152741 3300009147 Bacteria 3159
127 Ga0114129_10190324 3300009147 Bacteria 2787
128 Ga0114129_10405731 3300009147 Bacteria 1795
129 Ga0105243_10272674 3300009148 Bacteria 1520
130 Ga0105243_10317047 3300009148 Bacteria 1419
131 Ga0105242_10291377 3300009176 Bacteria 1486
132 Ga0105248_10001680 3300009177 Bacteria 24638
133 Ga0105248_10063534 3300009177 Bacteria 4144
134 Ga0105249_10013773 3300009553 Bacteria 7144
135 Ga0157378_10138772 3300013297 Bacteria 2256
136 Ga0163162_10501513 3300013306 Bacteria 1344
137 Ga0157375_10118079 3300013308 Bacteria 2759
138 Ga0157380_10360710 3300014326 Bacteria 1363
139 Ga0157379_10032107 3300014968 Bacteria 4679
140 Ga0207645_10005026 3300025907 Bacteria 9690
141 Ga0207643_10117001 3300025908 Bacteria 1575
142 Ga0207684_10306282 3300025910 Bacteria 1369
143 Ga0207695_10145546 3300025913 Unclassified 2314
144 Ga0207662_10031406 3300025918 Bacteria 3085
145 Ga0207662_10091045 3300025918 Bacteria 1876
146 Ga0207646_10456158 3300025922 Bacteria 1153
147 Ga0207681_10054415 3300025923 Bacteria 2721
148 Ga0207650_10008798 3300025925 Bacteria 6899
149 Ga0207659_10000159 3300025926 Bacteria 40400
150 Ga0207659_10380389 3300025926 Bacteria 1177
151 Ga0207706_10113330 3300025933 Bacteria 2385
152 Ga0207709_10229510 3300025935 Bacteria 1344
153 Ga0207670_10022591 3300025936 Bacteria 3901
154 Ga0207691_10156670 3300025940 Bacteria 2000
155 Ga0207691_10233967 3300025940 Bacteria 1590
156 Ga0207711_10017070 3300025941 Bacteria 6030
157 Ga0207711_10022593 3300025941 Bacteria 5262
158 Ga0207679_10119633 3300025945 Bacteria 2094
159 Ga0207679_10232709 3300025945 Bacteria 1557
160 Ga0207651_10142868 3300025960 Bacteria 1851
161 Ga0207703_10214948 3300026035 Bacteria 1716
162 Ga0207708_10001921 3300026075 Bacteria 15349
163 Ga0207708_10408297 3300026075 Bacteria 1124
164 Ga0207708_10416667 3300026075 Bacteria 1113
165 Ga0207641_10003384 3300026088 Bacteria 14155
166 Ga0207641_10184169 3300026088 Bacteria 1915
167 Ga0207648_10013172 3300026089 Bacteria 7708
168 Ga0207648_10106203 3300026089 Bacteria 2464
169 Ga0207674_10013496 3300026116 Bacteria 9060
170 Ga0207674_10272198 3300026116 Bacteria 1641
171 Ga0207675_100009579 3300026118 Bacteria 9061
172 Ga0207675_100082724 3300026118 Bacteria 3011
173 Ga0207675_100317394 3300026118 Bacteria 1521
174 Ga0207683_10054678 3300026121 Bacteria 3500
175 Ga0207428_10003986 3300027907 Bacteria 14172
176 Ga0207428_10009852 3300027907 Bacteria 8558
177 Ga0207428_10052845 3300027907 Bacteria 3242
178 Ga0207428_10141661 3300027907 Bacteria 1834
179 Ga0268266_10160868 3300028379 Bacteria 2031
180 Ga0268265_10000714 3300028380 Bacteria 32686
181 Ga0268264_10001966 3300028381 Bacteria 18469
182 Ga0268264_10017911 3300028381 Bacteria 5794
183 Ga0268264_10075117 3300028381 Bacteria 2873
184 Ga0307416_100028235 3300032002 Bacteria 4170
185 Ga0373930_0004264 3300034816 Bacteria 2315
186 Ga0373938_0006760 3300034957 Bacteria 1994
187 Ga0373929_0000093 3300035085 Bacteria 14945
188 Ga0373934_0035110 3300035086 Bacteria 1972
189 Ga0373940_0000166 3300035088 Bacteria 8802
190 Ga0373951_0000399 3300035091 Bacteria 12848
191 Ga0373932_0001244 3300035112 Bacteria 7235
192 Ga0373939_0000289 3300035114 Bacteria 13260
193 Ga0373941_0005025 3300035115 Bacteria 3084
194 Ga0373941_0009755 3300035115 Bacteria 2427
195 Ga0373960_0001238 3300035121 Bacteria 5597
196 Ga0373942_0000215 3300035207 Bacteria 15154
197 Ga0373961_0000432 3300035241 Bacteria 17284
198 Ga0373931_0010224 3300035691 Bacteria 4507
199 Ga0373937_0008238 3300036401 Bacteria 9051
200 Ga0439433_0003770 3300041999 Bacteria 3258
201 Ga0451576_0004321 3300045051 Bacteria 18561
202 Ga0495584_0027838 3300046491 Bacteria 2863
203 Ga0495642_0044317 3300046528 Bacteria 1815
204 Ga0495598_0000816 3300046537 Bacteria 5967
205 Ga0495621_0105207 3300046539 Unclassified 1078
206 Ga0495645_0012313 3300046543 Bacteria 6024
207 Ga0495656_0132381 3300046615 Bacteria 1188
208 Ga0495669_0016144 3300046684 Bacteria 3198
209 Ga0495636_0053300 3300047318 Bacteria 1698
210 Ga0495674_0270833 3300047319 Bacteria 1393
211 Ga0496104_0228717 3300048907 Bacteria 1772
212 Ga0496108_0138403 3300048911 Bacteria 2097
213 Ga0496109_0147926 3300048912 Bacteria 2198
214 Ga0496109_0355160 3300048912 Bacteria 1385
215 Ga0496114_0211327 3300048917 Bacteria 1702
216 Ga0501076_0207399 3300049592 Bacteria 1601
217 Ga0501081_0046769 3300049743 Bacteria 2976
218 nmdc:mga05p37_10350_c1 3300050507 Bacteria 11073
219 nmdc:mga05p37_124986_c1 3300050507 Bacteria 3159
220 nmdc:mga05p37_140480_c1 3300050507 Bacteria 2959
221 nmdc:mga05p37_1551_c1 3300050507 Bacteria 26706
222 nmdc:mga05p37_176915_c1 3300050507 Bacteria 2599
223 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
224 nmdc:mga05p37_29202_c1 3300050507 Bacteria 6732
225 nmdc:mga05p37_30035_c1 3300050507 Bacteria 6633
226 nmdc:mga05p37_331104_c1 3300050507 Bacteria 1799
227 nmdc:mga05p37_483158_c1 3300050507 Bacteria 1426
228 nmdc:mga05p37_94571_c1 3300050507 Bacteria 3682
229 nmdc:mga09592_338718_c1 3300050508 Bacteria 1302
230 nmdc:mga09592_77269_c1 3300050508 Bacteria 2832
231 nmdc:mga0qj67_158135_c1 3300050509 Bacteria 1839
232 nmdc:mga0qj67_6296_c1 3300050509 Bacteria 8711
233 nmdc:mga06r32_160297_c1 3300050510 Bacteria 2232
234 nmdc:mga08y16_19023_c1 3300050511 Bacteria 7234
235 nmdc:mga08y16_235660_c1 3300050511 Bacteria 1893
236 nmdc:mga0n895_202109_c1 3300050512 Bacteria 1634
237 nmdc:mga0n895_45030_c1 3300050512 Bacteria 4304
238 nmdc:mga0n895_52203_c1 3300050512 Bacteria 4013
239 nmdc:mga0n895_57105_c1 3300050512 Bacteria 3847
240 nmdc:mga0n895_85143_c1 3300050512 Bacteria 3155
241 nmdc:mga0rr50_244170_c1 3300050513 Bacteria 1489
242 nmdc:mga0rr50_36319_c1 3300050513 Bacteria 3548
243 nmdc:mga0rr50_87_c1 3300050513 Bacteria 52403
244 nmdc:mga08x19_58693_c1 3300050514 Bacteria 2490
245 nmdc:mga0a205_105655_c1 3300050515 Bacteria 2715
246 nmdc:mga0a205_134604_c1 3300050515 Bacteria 2372
247 nmdc:mga0a205_33928_c1 3300050515 Bacteria 4895
248 Ga0495619_0164051 3300053085 Bacteria 1535
249 Ga0590071_011819 3300059421 Bacteria 2043
250 Ga0590075_006317 3300059424 Bacteria 2811
251 Ga0530510_0029754 3300061734 Bacteria 3921
252 Ga0070699_100005856
253 Ga0065712_10072824
254 Ga0065715_10202302
255 Ga0065715_10217349
256 Ga0070676_10004007
257 Ga0070676_10146793
258 Ga0070690_100025581
259 Ga0070690_100140049
260 Ga0070670_100014725
261 Ga0070680_100136884
262 Ga0068868_100262288
263 Ga0068868_100521817
264 Ga0070689_100140319
265 Ga0070691_10039117
266 Ga0070687_100079797
267 Ga0070669_100298787
268 Ga0070675_100013846
269 Ga0070675_100033643
270 Ga0070675_100482077
271 Ga0070673_100037181
272 Ga0070673_100156835
273 Ga0070688_100079714
274 Ga0070713_100021462
275 Ga0070701_10005621
276 Ga0070701_10020189
277 Ga0070701_10162554
278 Ga0070705_100000288
279 Ga0070705_100075036
280 Ga0070700_100043795
281 Ga0070694_100006823
282 Ga0070694_100087048
283 Ga0070694_100192717
284 Ga0070708_100131653
285 Ga0070662_100076986
286 Ga0068867_100064990
287 Ga0068867_100161452
288 Ga0070685_10079500
289 Ga0070706_100072245
290 Ga0070706_100270260
291 Ga0070707_100023133
292 Ga0070698_100000175
293 Ga0070698_100002474
294 Ga0070698_100058771
295 Ga0070698_100199339
296 Ga0070699_100000422
297 Ga0070699_100002410
298 Ga0070699_100052795
299 Ga0070699_100116059
300 Ga0070697_100140927
301 Ga0070672_100166333
302 Ga0070672_100201037
303 Ga0070695_100003016
304 Ga0070695_100003966
305 Ga0070696_100001927
306 Ga0070696_100036162
307 Ga0070696_100073694
308 Ga0070696_100257249
309 Ga0070665_100063675
310 Ga0070704_100006945
311 Ga0070704_100039144
312 Ga0070704_100056462
313 Ga0070704_100057078
314 Ga0070704_100418914
315 Ga0070664_100276566
316 Ga0070664_100297576
317 Ga0068857_100147897
318 Ga0068857_100414869
319 Ga0070702_100010666
320 Ga0068859_100004314
321 Ga0068859_100007346
322 Ga0068859_100093356
323 Ga0068864_100384086
324 Ga0068864_100463719
325 Ga0068870_10048126
326 Ga0068870_10170206
327 Ga0068870_10173094
328 Ga0068863_100024942
329 Ga0068863_100071108
330 Ga0068863_100098938
331 Ga0068863_100214593
332 Ga0068858_100000970
333 Ga0068858_100036533
334 Ga0068858_100499105
335 Ga0068860_100008509
336 Ga0068860_100273110
337 Ga0068862_100075180
338 Ga0081455_10325664
339 Ga0075428_100040258
340 Ga0075428_100098824
341 Ga0075428_100232351
342 Ga0075430_100001102
343 Ga0075430_100214859
344 Ga0075433_10013066
345 Ga0075433_10023382
346 Ga0075433_10103847
347 Ga0075433_10121444
348 Ga0075434_100100747
349 Ga0075434_100303347
350 Ga0075434_100334648
351 Ga0075434_100516101
352 Ga0075436_100002218
353 Ga0097620_100004314
354 Ga0097620_100007346
355 Ga0097620_100093360
356 Ga0075435_100005188
357 Ga0075435_100095573
358 Ga0075435_100231853
359 Ga0105240_10026532
360 Ga0105240_10174515
361 Ga0111539_10005304
362 Ga0111539_10025243
363 Ga0111539_10114075
364 Ga0111539_10238326
365 Ga0111539_10281723
366 Ga0111539_10437882
367 Ga0105247_10007244
368 Ga0114129_10001158
369 Ga0114129_10013237
370 Ga0114129_10016799
371 Ga0114129_10029342
372 Ga0114129_10036700
373 Ga0114129_10057707
374 Ga0114129_10093604
375 Ga0114129_10094174
376 Ga0114129_10123908
377 Ga0114129_10152741
378 Ga0114129_10190324
379 Ga0114129_10405731
380 Ga0105243_10272674
381 Ga0105243_10317047
382 Ga0105242_10291377
383 Ga0105248_10001680
384 Ga0105248_10063534
385 Ga0105249_10013773
386 Ga0157378_10138772
387 Ga0163162_10501513
388 Ga0157375_10118079
389 Ga0157380_10360710
390 Ga0157379_10032107
391 Ga0207645_10005026
392 Ga0207643_10117001
393 Ga0207684_10306282
394 Ga0207695_10145546
395 Ga0207662_10031406
396 Ga0207662_10091045
397 Ga0207646_10456158
398 Ga0207681_10054415
399 Ga0207650_10008798
400 Ga0207659_10000159
401 Ga0207659_10380389
402 Ga0207706_10113330
403 Ga0207709_10229510
404 Ga0207670_10022591
405 Ga0207691_10156670
406 Ga0207691_10233967
407 Ga0207711_10017070
408 Ga0207711_10022593
409 Ga0207679_10119633
410 Ga0207679_10232709
411 Ga0207651_10142868
412 Ga0207703_10214948
413 Ga0207708_10001921
414 Ga0207708_10408297
415 Ga0207708_10416667
416 Ga0207641_10003384
417 Ga0207641_10184169
418 Ga0207648_10013172
419 Ga0207648_10106203
420 Ga0207674_10013496
421 Ga0207674_10272198
422 Ga0207675_100009579
423 Ga0207675_100082724
424 Ga0207675_100317394
425 Ga0207683_10054678
426 Ga0207428_10003986
427 Ga0207428_10009852
428 Ga0207428_10052845
429 Ga0207428_10141661
430 Ga0268266_10160868
431 Ga0268265_10000714
432 Ga0268264_10001966
433 Ga0268264_10017911
434 Ga0268264_10075117
435 Ga0307416_100028235
436 Ga0373930_0004264
437 Ga0373938_0006760
438 Ga0373929_0000093
439 Ga0373934_0035110
440 Ga0373940_0000166
441 Ga0373951_0000399
442 Ga0373932_0001244
443 Ga0373939_0000289
444 Ga0373941_0005025
445 Ga0373941_0009755
446 Ga0373960_0001238
447 Ga0373942_0000215
448 Ga0373961_0000432
449 Ga0373931_0010224
450 Ga0373937_0008238
451 Ga0439433_0003770
452 Ga0451576_0004321
453 Ga0495584_0027838
454 Ga0495642_0044317
455 Ga0495598_0000816
456 Ga0495621_0105207
457 Ga0495645_0012313
458 Ga0495656_0132381
459 Ga0495669_0016144
460 Ga0495636_0053300
461 Ga0495674_0270833
462 Ga0496104_0228717
463 Ga0496108_0138403
464 Ga0496109_0147926
465 Ga0496109_0355160
466 Ga0496114_0211327
467 Ga0501076_0207399
468 Ga0501081_0046769
469 nmdc:mga05p37_10350_c1
470 nmdc:mga05p37_124986_c1
471 nmdc:mga05p37_140480_c1
472 nmdc:mga05p37_1551_c1
473 nmdc:mga05p37_176915_c1
474 nmdc:mga05p37_2888_c1
475 nmdc:mga05p37_29202_c1
476 nmdc:mga05p37_30035_c1
477 nmdc:mga05p37_331104_c1
478 nmdc:mga05p37_483158_c1
479 nmdc:mga05p37_94571_c1
480 nmdc:mga09592_338718_c1
481 nmdc:mga09592_77269_c1
482 nmdc:mga0qj67_158135_c1
483 nmdc:mga0qj67_6296_c1
484 nmdc:mga06r32_160297_c1
485 nmdc:mga08y16_19023_c1
486 nmdc:mga08y16_235660_c1
487 nmdc:mga0n895_202109_c1
488 nmdc:mga0n895_45030_c1
489 nmdc:mga0n895_52203_c1
490 nmdc:mga0n895_57105_c1
491 nmdc:mga0n895_85143_c1
492 nmdc:mga0rr50_244170_c1
493 nmdc:mga0rr50_36319_c1
494 nmdc:mga0rr50_87_c1
495 nmdc:mga08x19_58693_c1
496 nmdc:mga0a205_105655_c1
497 nmdc:mga0a205_134604_c1
498 nmdc:mga0a205_33928_c1
499 Ga0495619_0164051
500 Ga0590071_011819
501 Ga0590075_006317
502 Ga0530510_0029754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

18

331

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g1a-assembly1.cif.gz_B bordetella alcaligenes hdah bound to pfsaha 0.8794 3 293
5g1a-assembly1.cif.gz_A-2 bordetella alcaligenes hdah bound to pfsaha 0.8789 3 293
5g17-assembly1.cif.gz_B bordetella alcaligenes hdah (t101a) bound to 9,9,9-trifluoro-8,8- dihydroxy-n-phenylnonanamide. 0.8685 3 298
6z2k-assembly1.cif.gz_E the structure of the tetrameric hdac1/mideas/dnttip1 midac deacetylase complex 0.8682 2 274
5g11-assembly1.cif.gz_B pseudomonas aeruginosa hdah bound to pfsaha. 0.8644 2 293
ID Description Score Start End Superfamily
af_X1WCM6_55_351_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9643 5 298 3.40.800.20
af_X1WCM6_55_351_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9516 5 298 3.40.800.20
af_Q5Z608_39_349_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9121 4 291 3.40.800.20
af_Q18477_16_331_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9007 3 291 3.40.800.20
af_Q2G292_6_379_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8847 2 298 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A7V1MLJ8-F1-model_v4 Histone deacetylase 0.9787 2 134 GO:0004407
GO:0040029
AF-A0A838GU35-F1-model_v4 deleted 0.9761 1 292
AF-A0A353C7D9-F1-model_v4 Histone deacetylase 0.9751 2 295 GO:0004407
GO:0040029
AF-G2LGQ8-F1-model_v4 Deacetylase, including histone deacetylase and acetoin utilization protein 0.9741 1 292 GO:0004407
GO:0040029
AF-A0A7C2ERX8-F1-model_v4 Histone deacetylase 0.9726 2 296 GO:0004407
GO:0040029

Map