F362204

General Info

Members Datasets Scaffolds Average Seq Length
251 177 502 155

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100143007|Ga0070659_1001430074
Length 180
Sequence MCASVVRPRDRRRGDPPCEADRLSSKATPATKALERAKVPVKTHAYAHDRRHESYGLEAAEALGLDPATVFKTLVADVDGGLTVAIVPVELQVDLKALAQAVDAKKAQLADVKQAERTTGYVAGGISPLGQRKALPTVLDASALEHPAIHVSGGRRGLEIELAPADLRRLTNATIAPIAR

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
173 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
174 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
175 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
176 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
177 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 9.56
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100143007 3300005366 Bacteria 1948
2 Ga0070658_10441612 3300005327 Bacteria 1120
3 Ga0070683_100026029 3300005329 Bacteria 5262
4 Ga0070682_100481794 3300005337 Bacteria 957
5 Ga0070692_10271049 3300005345 Bacteria 1025
6 Ga0070671_100491794 3300005355 Bacteria 1055
7 Ga0070674_100116422 3300005356 Bacteria 1972
8 Ga0070688_100033025 3300005365 Bacteria 3126
9 Ga0070659_101666186 3300005366 Bacteria 570
10 Ga0070714_100379231 3300005435 Bacteria 1333
11 Ga0070713_100040458 3300005436 Bacteria 3789
12 Ga0070710_10709052 3300005437 Bacteria 711
13 Ga0070701_10340877 3300005438 Bacteria 933
14 Ga0070711_100708268 3300005439 Bacteria 848
15 Ga0070700_100198483 3300005441 Bacteria 1408
16 Ga0070708_100249305 3300005445 Bacteria 1668
17 Ga0070678_100147323 3300005456 Bacteria 1892
18 Ga0070678_100465283 3300005456 Bacteria 1110
19 Ga0070678_101890081 3300005456 Bacteria 564
20 Ga0068867_100557304 3300005459 Bacteria 994
21 Ga0070685_10280396 3300005466 Bacteria 1115
22 Ga0070684_100047239 3300005535 Bacteria 3730
23 Ga0070696_100854463 3300005546 Bacteria 752
24 Ga0070665_100196199 3300005548 Bacteria 2020
25 Ga0070702_100012658 3300005615 Bacteria 4236
26 Ga0068859_101038161 3300005617 Unclassified 901
27 Ga0068851_10165079 3300005834 Bacteria 1219
28 Ga0068858_100545032 3300005842 Bacteria 1123
29 Ga0068862_100474511 3300005844 Bacteria 1183
30 Ga0081455_10174719 3300005937 Bacteria 1632
31 Ga0068865_100008889 3300006881 Bacteria 6216
32 Ga0068865_100145194 3300006881 Bacteria 1794
33 Ga0097620_101038284 3300006931 Unclassified 901
34 Ga0105240_10026332 3300009093 Bacteria 7630
35 Ga0105245_10374152 3300009098 Bacteria 1417
36 Ga0105243_10004975 3300009148 Bacteria 10419
37 Ga0105243_10197044 3300009148 Bacteria 1764
38 Ga0105243_10586217 3300009148 Bacteria 1071
39 Ga0105242_10555447 3300009176 Bacteria 1102
40 Ga0105248_10423889 3300009177 Bacteria 1499
41 Ga0105249_10167999 3300009553 Bacteria 2125
42 Ga0105246_10030366 3300011119 Bacteria 3568
43 Ga0163162_10360677 3300013306 Bacteria 1586
44 Ga0157372_10199540 3300013307 Bacteria 2317
45 Ga0163163_12077772 3300014325 Bacteria 628
46 Ga0157380_10009015 3300014326 Bacteria 7126
47 Ga0157380_10686290 3300014326 Bacteria 1027
48 Ga0182008_10006559 3300014497 Bacteria 6498
49 Ga0182008_10035156 3300014497 Bacteria 2511
50 Ga0157377_10289884 3300014745 Bacteria 1076
51 Ga0182006_1034046 3300015261 Bacteria 2040
52 Ga0182007_10004120 3300015262 Bacteria 6673
53 Ga0163161_10047334 3300017792 Bacteria 3106
54 Ga0207426_1058028 3300025302 Bacteria 1125
55 Ga0207692_10403482 3300025898 Bacteria 853
56 Ga0207642_10011450 3300025899 Bacteria 3165
57 Ga0207707_10091113 3300025912 Bacteria 2665
58 Ga0207693_10763692 3300025915 Bacteria 746
59 Ga0207646_10452794 3300025922 Bacteria 1158
60 Ga0207694_10677264 3300025924 Bacteria 869
61 Ga0207687_10248058 3300025927 Bacteria 1414
62 Ga0207700_10900522 3300025928 Bacteria 792
63 Ga0207664_10010350 3300025929 Bacteria 6586
64 Ga0207664_10208368 3300025929 Bacteria 1690
65 Ga0207644_10421924 3300025931 Bacteria 1093
66 Ga0207690_10084892 3300025932 Bacteria 2221
67 Ga0207709_10005525 3300025935 Bacteria 7171
68 Ga0207709_10452023 3300025935 Bacteria 993
69 Ga0207669_10367814 3300025937 Bacteria 1116
70 Ga0207704_10160675 3300025938 Bacteria 1598
71 Ga0207661_10067174 3300025944 Bacteria 2915
72 Ga0207661_10861336 3300025944 Bacteria 834
73 Ga0207679_10921702 3300025945 Bacteria 799
74 Ga0207658_10539358 3300025986 Bacteria 1043
75 Ga0207703_10514620 3300026035 Bacteria 1125
76 Ga0207678_10080776 3300026067 Bacteria 2783
77 Ga0207708_10035717 3300026075 Bacteria 3782
78 Ga0207708_10629254 3300026075 Unclassified 912
79 Ga0207648_10628867 3300026089 Bacteria 991
80 Ga0207648_10728387 3300026089 Bacteria 920
81 Ga0207648_11135958 3300026089 Bacteria 733
82 Ga0207675_100145905 3300026118 Bacteria 2250
83 Ga0207683_10064686 3300026121 Bacteria 3223
84 Ga0207698_10854536 3300026142 Bacteria 915
85 Ga0268265_11357417 3300028380 Bacteria 712
86 Ga0265319_1000592 3300028563 Bacteria 24262
87 Ga0265334_10084487 3300028573 Bacteria 1165
88 Ga0265318_10009436 3300028577 Bacteria 4291
89 Ga0265322_10014176 3300028654 Bacteria 2305
90 Ga0265338_10017781 3300028800 Bacteria 7643
91 Ga0265338_10050770 3300028800 Bacteria 3744
92 Ga0265330_10040729 3300031235 Bacteria 2062
93 Ga0265332_10174882 3300031238 Bacteria 895
94 Ga0265320_10064219 3300031240 Bacteria 1744
95 Ga0265329_10054811 3300031242 Bacteria 1266
96 Ga0265327_10029372 3300031251 Unclassified 3128
97 Ga0265327_10139817 3300031251 Bacteria 1132
98 Ga0265316_10024864 3300031344 Bacteria 5005
99 Ga0307408_100000090 3300031548 Bacteria 100442
100 Ga0307408_100769623 3300031548 Bacteria 871
101 Ga0307408_101502529 3300031548 Bacteria 637
102 Ga0307508_10428746 3300031616 Bacteria 914
103 Ga0265314_10028527 3300031711 Bacteria 4160
104 Ga0265342_10168790 3300031712 Bacteria 1205
105 Ga0307410_10818772 3300031852 Bacteria 793
106 Ga0307406_10167955 3300031901 Bacteria 1585
107 Ga0307406_11502432 3300031901 Bacteria 593
108 Ga0307409_100421968 3300031995 Bacteria 1280
109 Ga0307409_101257861 3300031995 Bacteria 764
110 Ga0307416_100564576 3300032002 Bacteria 1213
111 Ga0307411_10359050 3300032005 Bacteria 1191
112 Ga0307415_100022078 3300032126 Bacteria 3923
113 Ga0307415_100147075 3300032126 Bacteria 1808
114 Ga0307415_101072859 3300032126 Bacteria 753
115 Ga0395899_0217170 3300037312 Bacteria 1326
116 Ga0395900_0194953 3300037418 Bacteria 2053
117 Ga0395898_0187118 3300037466 Bacteria 1979
118 Ga0395898_0361157 3300037466 Bacteria 1385
119 Ga0395898_1176095 3300037466 Bacteria 699
120 Ga0395905_0898549 3300037471 Bacteria 789
121 Ga0400483_120544 3300039062 Bacteria 13593
122 Ga0451793_1544923 3300041452 Bacteria 759
123 Ga0451853_1875314 3300041512 Bacteria 788
124 Ga0439448_0029428 3300042005 Bacteria 1739
125 Ga0466969_0010145 3300044656 Bacteria 4995
126 Ga0466966_0014450 3300044684 Bacteria 5227
127 Ga0466961_0120887 3300044693 Bacteria 1644
128 Ga0466963_0097968 3300044694 Bacteria 2004
129 Ga0466963_0243084 3300044694 Bacteria 1262
130 Ga0466970_0058527 3300044765 Bacteria 2063
131 Ga0466957_0148214 3300044842 Bacteria 1516
132 Ga0466960_0306684 3300044901 Bacteria 896
133 Ga0466959_0021760 3300045049 Bacteria 4733
134 Ga0451576_0538646 3300045051 Bacteria 1227
135 Ga0466958_0002810 3300045836 Bacteria 8861
136 Ga0466958_0304178 3300045836 Bacteria 1024
137 Ga0466958_0464591 3300045836 Bacteria 820
138 Ga0466967_0032700 3300045976 Bacteria 4396
139 Ga0466967_0108176 3300045976 Bacteria 2551
140 Ga0466967_0160054 3300045976 Bacteria 2112
141 Ga0466967_0237344 3300045976 Bacteria 1738
142 Ga0466967_0433949 3300045976 Bacteria 1282
143 Ga0466967_0747588 3300045976 Bacteria 970
144 Ga0466967_0983625 3300045976 Bacteria 840
145 Ga0466967_1133863 3300045976 Bacteria 779
146 Ga0495603_0027861 3300046455 Bacteria 3407
147 Ga0495603_0401086 3300046455 Bacteria 786
148 Ga0495641_0232200 3300046461 Bacteria 828
149 Ga0495585_0010261 3300046492 Bacteria 5587
150 Ga0495585_0363369 3300046492 Bacteria 702
151 Ga0495596_0142205 3300046500 Bacteria 932
152 Ga0495663_0138727 3300046525 Bacteria 824
153 Ga0495652_0077028 3300046529 Bacteria 2765
154 Ga0495640_0032169 3300046533 Bacteria 3738
155 Ga0495640_0856428 3300046533 Bacteria 540
156 Ga0495634_0369819 3300046642 Bacteria 856
157 Ga0495613_0405761 3300046689 Bacteria 929
158 Ga0495589_0186904 3300046794 Bacteria 981
159 Ga0495604_0021665 3300047317 Bacteria 5131
160 Ga0495604_0318817 3300047317 Bacteria 1039
161 Ga0495676_0683937 3300047321 Bacteria 664
162 Ga0495680_0349463 3300047322 Bacteria 1030
163 Ga0495677_0387482 3300047445 Bacteria 553
164 Ga0495602_1093212 3300048088 Bacteria 523
165 Ga0496101_0232713 3300048904 Bacteria 1432
166 Ga0496104_0374097 3300048907 Bacteria 1337
167 Ga0496104_0625932 3300048907 Bacteria 986
168 Ga0496104_1209446 3300048907 Bacteria 659
169 Ga0496105_0273104 3300048908 Bacteria 1364
170 Ga0496106_0596650 3300048909 Bacteria 885
171 Ga0496107_0388026 3300048910 Bacteria 1039
172 Ga0496108_0116468 3300048911 Bacteria 2289
173 Ga0496109_0050936 3300048912 Bacteria 3771
174 Ga0496109_0214250 3300048912 Bacteria 1811
175 Ga0496109_0697439 3300048912 Unclassified 953
176 Ga0496110_0069161 3300048913 Bacteria 3126
177 Ga0496110_0196034 3300048913 Bacteria 1834
178 Ga0496110_0544967 3300048913 Bacteria 1054
179 Ga0496111_0381532 3300048914 Bacteria 1042
180 Ga0496111_0471210 3300048914 Bacteria 926
181 Ga0496112_0004702 3300048915 Bacteria 11627
182 Ga0496112_0004906 3300048915 Bacteria 11445
183 Ga0496113_0603254 3300048916 Bacteria 879
184 Ga0496114_0171736 3300048917 Bacteria 1890
185 Ga0496114_0227093 3300048917 Bacteria 1640
186 Ga0501031_0034082 3300049568 Bacteria 3322
187 Ga0501031_0259496 3300049568 Bacteria 1129
188 Ga0501033_0094362 3300049570 Bacteria 2188
189 Ga0501034_0025937 3300049571 Bacteria 5970
190 Ga0501036_0006686 3300049572 Bacteria 9371
191 Ga0501037_0181532 3300049573 Bacteria 1493
192 Ga0501038_0045892 3300049574 Bacteria 3791
193 Ga0501038_1320932 3300049574 Bacteria 520
194 Ga0501040_0015564 3300049576 Bacteria 5026
195 Ga0501040_0022001 3300049576 Bacteria 4263
196 Ga0501041_0066279 3300049577 Bacteria 2212
197 Ga0501042_0013162 3300049578 Bacteria 5631
198 Ga0501047_0409582 3300049581 Bacteria 1188
199 Ga0501047_1026849 3300049581 Bacteria 638
200 Ga0501048_0005952 3300049582 Bacteria 9284
201 Ga0501048_0097297 3300049582 Bacteria 2076
202 Ga0501067_0023421 3300049583 Bacteria 3422
203 Ga0501067_0161862 3300049583 Bacteria 1246
204 Ga0501067_0237432 3300049583 Unclassified 1014
205 Ga0501067_0643340 3300049583 Bacteria 595
206 Ga0501068_0016612 3300049584 Bacteria 4244
207 Ga0501068_0078717 3300049584 Bacteria 2021
208 Ga0501068_0079256 3300049584 Bacteria 2014
209 Ga0501068_0457759 3300049584 Bacteria 826
210 Ga0501069_0002511 3300049585 Bacteria 9368
211 Ga0501069_0096961 3300049585 Bacteria 1671
212 Ga0501070_0241173 3300049586 Bacteria 1479
213 Ga0501071_0035153 3300049587 Bacteria 3569
214 Ga0501071_0072344 3300049587 Bacteria 2514
215 Ga0501072_0006101 3300049588 Bacteria 9192
216 Ga0501073_0012097 3300049589 Bacteria 6301
217 Ga0501074_0007570 3300049590 Bacteria 7856
218 Ga0501074_0031892 3300049590 Bacteria 3819
219 Ga0501074_0223897 3300049590 Bacteria 1339
220 Ga0501075_0050403 3300049591 Bacteria 3129
221 Ga0501075_0072126 3300049591 Bacteria 2610
222 Ga0501076_0019525 3300049592 Bacteria 5181
223 Ga0501076_0038356 3300049592 Bacteria 3761
224 Ga0501077_0024745 3300049593 Bacteria 3812
225 Ga0501077_0091386 3300049593 Bacteria 1929
226 Ga0501080_0020808 3300049742 Bacteria 6073
227 Ga0501080_0146876 3300049742 Bacteria 2180
228 Ga0501080_0467592 3300049742 Bacteria 1129
229 Ga0501081_0024542 3300049743 Bacteria 4048
230 Ga0501083_0272691 3300049744 Bacteria 1101
231 Ga0501035_0100727 3300049822 Bacteria 2536
232 Ga0501044_1574495 3300049823 Bacteria 522
233 Ga0501045_0009285 3300049824 Bacteria 6879
234 Ga0501045_0108618 3300049824 Bacteria 2056
235 Ga0495601_0199766 3300053077 Bacteria 1307
236 Ga0495612_0082102 3300053078 Bacteria 1355
237 Ga0501084_0036015 3300054114 Bacteria 4135
238 Ga0501084_0056706 3300054114 Bacteria 3277
239 Ga0501082_0026514 3300060353 Bacteria 4995
240 Ga0501082_0314484 3300060353 Bacteria 1364
241 Ga0501082_0411666 3300060353 Bacteria 1180
242 Ga0501082_1037834 3300060353 Bacteria 717
243 Ga0530510_0040704 3300061734 Bacteria 3354
244 Ga0530510_0133145 3300061734 Bacteria 1829
245 Ga0530510_0789772 3300061734 Bacteria 724
246 2600447005 2600254954 Bacteria 5100516
247 2602010107 2600255389 Bacteria 5275336
248 2919504959 2919501602 Bacteria 5286340
249 2926066636 2926063275 Bacteria 5285848
250 2984594481 2984592036 Bacteria 3670284
251 8034966231 8034962539 Bacteria 4884839
252 Ga0070659_100143007
253 Ga0070658_10441612
254 Ga0070683_100026029
255 Ga0070682_100481794
256 Ga0070692_10271049
257 Ga0070671_100491794
258 Ga0070674_100116422
259 Ga0070688_100033025
260 Ga0070659_101666186
261 Ga0070714_100379231
262 Ga0070713_100040458
263 Ga0070710_10709052
264 Ga0070701_10340877
265 Ga0070711_100708268
266 Ga0070700_100198483
267 Ga0070708_100249305
268 Ga0070678_100147323
269 Ga0070678_100465283
270 Ga0070678_101890081
271 Ga0068867_100557304
272 Ga0070685_10280396
273 Ga0070684_100047239
274 Ga0070696_100854463
275 Ga0070665_100196199
276 Ga0070702_100012658
277 Ga0068859_101038161
278 Ga0068851_10165079
279 Ga0068858_100545032
280 Ga0068862_100474511
281 Ga0081455_10174719
282 Ga0068865_100008889
283 Ga0068865_100145194
284 Ga0097620_101038284
285 Ga0105240_10026332
286 Ga0105245_10374152
287 Ga0105243_10004975
288 Ga0105243_10197044
289 Ga0105243_10586217
290 Ga0105242_10555447
291 Ga0105248_10423889
292 Ga0105249_10167999
293 Ga0105246_10030366
294 Ga0163162_10360677
295 Ga0157372_10199540
296 Ga0163163_12077772
297 Ga0157380_10009015
298 Ga0157380_10686290
299 Ga0182008_10006559
300 Ga0182008_10035156
301 Ga0157377_10289884
302 Ga0182006_1034046
303 Ga0182007_10004120
304 Ga0163161_10047334
305 Ga0207426_1058028
306 Ga0207692_10403482
307 Ga0207642_10011450
308 Ga0207707_10091113
309 Ga0207693_10763692
310 Ga0207646_10452794
311 Ga0207694_10677264
312 Ga0207687_10248058
313 Ga0207700_10900522
314 Ga0207664_10010350
315 Ga0207664_10208368
316 Ga0207644_10421924
317 Ga0207690_10084892
318 Ga0207709_10005525
319 Ga0207709_10452023
320 Ga0207669_10367814
321 Ga0207704_10160675
322 Ga0207661_10067174
323 Ga0207661_10861336
324 Ga0207679_10921702
325 Ga0207658_10539358
326 Ga0207703_10514620
327 Ga0207678_10080776
328 Ga0207708_10035717
329 Ga0207708_10629254
330 Ga0207648_10628867
331 Ga0207648_10728387
332 Ga0207648_11135958
333 Ga0207675_100145905
334 Ga0207683_10064686
335 Ga0207698_10854536
336 Ga0268265_11357417
337 Ga0265319_1000592
338 Ga0265334_10084487
339 Ga0265318_10009436
340 Ga0265322_10014176
341 Ga0265338_10017781
342 Ga0265338_10050770
343 Ga0265330_10040729
344 Ga0265332_10174882
345 Ga0265320_10064219
346 Ga0265329_10054811
347 Ga0265327_10029372
348 Ga0265327_10139817
349 Ga0265316_10024864
350 Ga0307408_100000090
351 Ga0307408_100769623
352 Ga0307408_101502529
353 Ga0307508_10428746
354 Ga0265314_10028527
355 Ga0265342_10168790
356 Ga0307410_10818772
357 Ga0307406_10167955
358 Ga0307406_11502432
359 Ga0307409_100421968
360 Ga0307409_101257861
361 Ga0307416_100564576
362 Ga0307411_10359050
363 Ga0307415_100022078
364 Ga0307415_100147075
365 Ga0307415_101072859
366 Ga0395899_0217170
367 Ga0395900_0194953
368 Ga0395898_0187118
369 Ga0395898_0361157
370 Ga0395898_1176095
371 Ga0395905_0898549
372 Ga0400483_120544
373 Ga0451793_1544923
374 Ga0451853_1875314
375 Ga0439448_0029428
376 Ga0466969_0010145
377 Ga0466966_0014450
378 Ga0466961_0120887
379 Ga0466963_0097968
380 Ga0466963_0243084
381 Ga0466970_0058527
382 Ga0466957_0148214
383 Ga0466960_0306684
384 Ga0466959_0021760
385 Ga0451576_0538646
386 Ga0466958_0002810
387 Ga0466958_0304178
388 Ga0466958_0464591
389 Ga0466967_0032700
390 Ga0466967_0108176
391 Ga0466967_0160054
392 Ga0466967_0237344
393 Ga0466967_0433949
394 Ga0466967_0747588
395 Ga0466967_0983625
396 Ga0466967_1133863
397 Ga0495603_0027861
398 Ga0495603_0401086
399 Ga0495641_0232200
400 Ga0495585_0010261
401 Ga0495585_0363369
402 Ga0495596_0142205
403 Ga0495663_0138727
404 Ga0495652_0077028
405 Ga0495640_0032169
406 Ga0495640_0856428
407 Ga0495634_0369819
408 Ga0495613_0405761
409 Ga0495589_0186904
410 Ga0495604_0021665
411 Ga0495604_0318817
412 Ga0495676_0683937
413 Ga0495680_0349463
414 Ga0495677_0387482
415 Ga0495602_1093212
416 Ga0496101_0232713
417 Ga0496104_0374097
418 Ga0496104_0625932
419 Ga0496104_1209446
420 Ga0496105_0273104
421 Ga0496106_0596650
422 Ga0496107_0388026
423 Ga0496108_0116468
424 Ga0496109_0050936
425 Ga0496109_0214250
426 Ga0496109_0697439
427 Ga0496110_0069161
428 Ga0496110_0196034
429 Ga0496110_0544967
430 Ga0496111_0381532
431 Ga0496111_0471210
432 Ga0496112_0004702
433 Ga0496112_0004906
434 Ga0496113_0603254
435 Ga0496114_0171736
436 Ga0496114_0227093
437 Ga0501031_0034082
438 Ga0501031_0259496
439 Ga0501033_0094362
440 Ga0501034_0025937
441 Ga0501036_0006686
442 Ga0501037_0181532
443 Ga0501038_0045892
444 Ga0501038_1320932
445 Ga0501040_0015564
446 Ga0501040_0022001
447 Ga0501041_0066279
448 Ga0501042_0013162
449 Ga0501047_0409582
450 Ga0501047_1026849
451 Ga0501048_0005952
452 Ga0501048_0097297
453 Ga0501067_0023421
454 Ga0501067_0161862
455 Ga0501067_0237432
456 Ga0501067_0643340
457 Ga0501068_0016612
458 Ga0501068_0078717
459 Ga0501068_0079256
460 Ga0501068_0457759
461 Ga0501069_0002511
462 Ga0501069_0096961
463 Ga0501070_0241173
464 Ga0501071_0035153
465 Ga0501071_0072344
466 Ga0501072_0006101
467 Ga0501073_0012097
468 Ga0501074_0007570
469 Ga0501074_0031892
470 Ga0501074_0223897
471 Ga0501075_0050403
472 Ga0501075_0072126
473 Ga0501076_0019525
474 Ga0501076_0038356
475 Ga0501077_0024745
476 Ga0501077_0091386
477 Ga0501080_0020808
478 Ga0501080_0146876
479 Ga0501080_0467592
480 Ga0501081_0024542
481 Ga0501083_0272691
482 Ga0501035_0100727
483 Ga0501044_1574495
484 Ga0501045_0009285
485 Ga0501045_0108618
486 Ga0495601_0199766
487 Ga0495612_0082102
488 Ga0501084_0036015
489 Ga0501084_0056706
490 Ga0501082_0026514
491 Ga0501082_0314484
492 Ga0501082_0411666
493 Ga0501082_1037834
494 Ga0530510_0040704
495 Ga0530510_0133145
496 Ga0530510_0789772
497 2600447005
498 2602010107
499 2919504959
500 2926066636
501 2984594481
502 8034966231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

54

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9516 4 152
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9334 4 152
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9274 4 152
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.926 4 152
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8852 5 152
ID Description Score Start End Superfamily
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9339 2 149 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9134 4 152 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9045 2 149 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9016 4 152 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8742 10 151 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A4R7H707-F1-model_v4 deleted 0.9967 3 151
AF-A0A840IFR0-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.996 4 151 GO:0002161
GO:0006412
GO:0016829
AF-A0A7K2QN57-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.995 2 152 GO:0002161
GO:0006412
GO:0016829
AF-A0A6B1PCT4-F1-model_v4 deleted 0.9947 1 150
AF-A0A8A6HF33-F1-model_v4 deleted 0.9944 1 151

Map