F361910

General Info

Members Datasets Scaffolds Average Seq Length
250 183 190 157

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0234688|Ga0496119_0234688_17_508
Length 163
Sequence MLEKNMTEITRIGEEFERWQELLALIMSSFAYMDGVIDPPSSAHRLTLENLAEKARAETAFVALDGDEIVGCLFCRQEPPACLYVGKLCVSLRAQGKGIGKMLLERAEALARESALPALRLETRIELVGNHAKFAAWGFIKTAENAHPGYDRTTSIEMTKFLG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
7 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
11 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
12 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
13 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
14 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
15 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
16 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
17 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
18 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
19 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
20 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
21 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
22 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
23 2643221568 Rhizobium sp. Root564 Isolate Unclassified
24 2643221582 Rhizobium sp. Root651 Isolate Unclassified
25 2643221599 Rhizobium sp. Root708 Isolate Unclassified
26 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
27 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
28 2643221693 Rhizobium sp. Root491 Isolate Unclassified
29 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
30 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
31 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
32 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
33 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
34 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
35 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
36 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
37 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
38 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
39 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
40 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
41 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
42 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
43 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
44 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
45 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
46 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
47 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
48 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
49 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
50 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
51 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
52 2996887358 Rhizobium sp. R711 Isolate Nodule
53 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
54 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
55 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
56 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
86 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
87 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
179 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
180 8005258706 Rhizobium sp. R693 Isolate Nodule
181 8005321885 Rhizobium sp. R72 Isolate Nodule
182 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
183 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76
Metatranscriptomes 0
Isolates 24

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 24
Nodule 9.2
Rhizoplane 4.8
Rhizosphere 30.4
Stem 0
Stem Tuber 0
Unclassified 31.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000069 3300002704 Bacteria 64645
2 JGI25156J39149_1000095 3300002705 Bacteria 64645
3 JGI25154J39366_1001388 3300002738 Bacteria 8761
4 JGI25157J39369_1000216 3300002741 Bacteria 47231
5 JGI25153J46596_10051381 3300003215 Bacteria 1180
6 JGI25153J46596_10054515 3300003215 Bacteria 1125
7 JGI25160J50197_1018790 3300003354 Bacteria 2141
8 Ga0055524_1002068 3300003775 Bacteria 10650
9 Ga0055536_1007906 3300003781 Bacteria 4670
10 Ga0055528_1004890 3300003790 Bacteria 6334
11 Ga0055528_1051831 3300003790 Bacteria 824
12 Ga0055531_10027277 3300003794 Bacteria 2008
13 Ga0058692_1003687 3300003856 Bacteria 4678
14 Ga0065165_1003352 3300005262 Bacteria 11387
15 Ga0070660_101137518 3300005339 Bacteria 661
16 Ga0070668_100024237 3300005347 Bacteria 4595
17 Ga0070671_100020442 3300005355 Bacteria 5399
18 Ga0070662_100648013 3300005457 Bacteria 891
19 Ga0070665_100000937 3300005548 Bacteria 37328
20 Ga0068860_100496603 3300005843 Bacteria 1218
21 Ga0075365_10003247 3300006038 Bacteria 8332
22 Ga0075365_10026369 3300006038 Bacteria 3689
23 Ga0075363_100020902 3300006048 Bacteria 3288
24 Ga0075364_10107528 3300006051 Bacteria 1859
25 Ga0075362_10009795 3300006177 Bacteria 3718
26 Ga0075367_10002704 3300006178 Bacteria 8180
27 Ga0075367_10016557 3300006178 Bacteria 4026
28 Ga0075369_10060669 3300006186 Bacteria 1650
29 Ga0075366_10006147 3300006195 Bacteria 6550
30 Ga0075370_10144224 3300006353 Bacteria 1393
31 Ga0099826_10011894 3300006948 Bacteria 6555
32 Ga0105250_10040394 3300009092 Bacteria 1871
33 Ga0105243_10007941 3300009148 Bacteria 8149
34 Ga0105248_10006268 3300009177 Bacteria 13043
35 Ga0123340_1055036 3300009763 Bacteria 1315
36 Ga0123341_1080181 3300009765 Bacteria 1289
37 Ga0123341_1080204 3300009765 Bacteria 1288
38 Ga0123342_1062121 3300009766 Bacteria 971
39 Ga0105239_11021812 3300010375 Bacteria 951
40 Ga0105246_10164321 3300011119 Bacteria 1694
41 Ga0157373_10003148 3300013100 Bacteria 12468
42 Ga0157371_10000004 3300013102 Bacteria 512593
43 Ga0157370_10001986 3300013104 Bacteria 25145
44 Ga0157370_10711172 3300013104 Bacteria 917
45 Ga0157369_10295743 3300013105 Bacteria 1685
46 Ga0209435_100049 3300025206 Bacteria 92067
47 Ga0209646_1000159 3300025246 Bacteria 92067
48 Ga0209026_1000183 3300025250 Bacteria 92067
49 Ga0209759_1000206 3300025256 Bacteria 92067
50 Ga0209673_1011414 3300025273 Bacteria 3665
51 Ga0209673_1017084 3300025273 Bacteria 2685
52 Ga0209673_1025468 3300025273 Bacteria 1966
53 Ga0209130_1017762 3300025284 Bacteria 1686
54 Ga0209676_1006407 3300025292 Bacteria 5820
55 Ga0209025_1013602 3300025294 Bacteria 5095
56 Ga0209025_1032964 3300025294 Bacteria 2408
57 Ga0209564_1008220 3300025295 Bacteria 5202
58 Ga0209564_1008892 3300025295 Bacteria 4877
59 Ga0209758_1006823 3300025297 Bacteria 8001
60 Ga0209758_1033701 3300025297 Bacteria 2051
61 Ga0209050_1001979 3300025298 Bacteria 19259
62 Ga0209256_1006241 3300025299 Bacteria 6414
63 Ga0209256_1006497 3300025299 Bacteria 6153
64 Ga0207426_1000608 3300025302 Bacteria 46209
65 Ga0209051_1004553 3300025303 Bacteria 8497
66 Ga0209051_1007592 3300025303 Bacteria 5905
67 Ga0209257_1005926 3300025304 Bacteria 8222
68 Ga0207696_1038190 3300025711 Bacteria 1418
69 Ga0207681_11342491 3300025923 Bacteria 600
70 Ga0207650_10186843 3300025925 Bacteria 1654
71 Ga0207668_10026389 3300025972 Bacteria 3771
72 Ga0207678_11191356 3300026067 Bacteria 674
73 Ga0209281_1000043 3300027111 Bacteria 341543
74 Ga0209371_1000942 3300027312 Bacteria 22686
75 Ga0209282_1267687 3300027666 Bacteria 744
76 Ga0209813_10003182 3300027866 Bacteria 3824
77 Ga0268266_10012625 3300028379 Bacteria 7299
78 Ga0268264_10443915 3300028381 Bacteria 1256
79 Ga0268256_1002122 3300030500 Bacteria 10587
80 Ga0307406_10025104 3300031901 Bacteria 3565
81 Ga0307409_100481673 3300031995 Bacteria 1204
82 Ga0439436_0021919 3300041404 Bacteria 1895
83 Ga0439439_0068820 3300041406 Bacteria 946
84 Ga0439449_0017132 3300042007 Bacteria 2720
85 Ga0495627_056133 3300046453 Bacteria 1175
86 Ga0495585_0016688 3300046492 Bacteria 4254
87 Ga0495606_0002266 3300046507 Bacteria 22765
88 Ga0495606_0097567 3300046507 Bacteria 1795
89 Ga0495610_0001900 3300046512 Bacteria 18031
90 Ga0495620_0043566 3300046515 Bacteria 1954
91 Ga0495620_0044448 3300046515 Bacteria 1930
92 Ga0495632_0005489 3300046519 Bacteria 8377
93 Ga0495643_0014779 3300046522 Bacteria 4635
94 Ga0495643_0029728 3300046522 Bacteria 3056
95 Ga0495633_0027586 3300046558 Bacteria 2775
96 Ga0495633_0068998 3300046558 Bacteria 1650
97 Ga0495668_0076223 3300046616 Bacteria 1841
98 Ga0495625_0059988 3300046660 Bacteria 2697
99 Ga0495625_0212244 3300046660 Bacteria 1272
100 Ga0495588_0010671 3300046674 Bacteria 4282
101 Ga0495588_0398716 3300046674 Bacteria 722
102 Ga0495670_0058189 3300046691 Bacteria 1941
103 Ga0495671_0098633 3300046692 Bacteria 1428
104 Ga0495671_0161686 3300046692 Bacteria 1089
105 Ga0495671_0330181 3300046692 Bacteria 732
106 Ga0495687_038921 3300047443 Bacteria 2107
107 Ga0495673_0025720 3300047469 Bacteria 2822
108 Ga0495681_0011963 3300047470 Bacteria 5126
109 Ga0495681_0089029 3300047470 Bacteria 1366
110 Ga0495686_0041062 3300047472 Bacteria 2947
111 Ga0496100_0807351 3300048903 Bacteria 735
112 Ga0496102_0302917 3300048905 Bacteria 1506
113 Ga0496103_0194450 3300048906 Bacteria 1304
114 Ga0496104_0360338 3300048907 Bacteria 1366
115 Ga0496105_0775740 3300048908 Bacteria 730
116 Ga0496110_0064918 3300048913 Bacteria 3227
117 Ga0496111_0190351 3300048914 Bacteria 1525
118 Ga0496113_0080434 3300048916 Bacteria 2496
119 Ga0496113_0396231 3300048916 Bacteria 1108
120 Ga0496114_0556204 3300048917 Bacteria 1013
121 Ga0496116_0000817 3300048919 Bacteria 39421
122 Ga0496116_0012404 3300048919 Bacteria 6966
123 Ga0496116_0130040 3300048919 Bacteria 1437
124 Ga0496116_0153936 3300048919 Bacteria 1272
125 Ga0496116_0157994 3300048919 Bacteria 1248
126 Ga0496116_0345086 3300048919 Bacteria 684
127 Ga0496117_0000002 3300048920 Bacteria 2483758
128 Ga0496117_0173517 3300048920 Bacteria 1248
129 Ga0496118_0002959 3300048921 Bacteria 22001
130 Ga0496118_0341296 3300048921 Bacteria 802
131 Ga0496119_0063865 3300048922 Bacteria 2188
132 Ga0496119_0116243 3300048922 Bacteria 1476
133 Ga0496119_0151397 3300048922 Bacteria 1243
134 Ga0496119_0234688 3300048922 Bacteria 931
135 Ga0496119_0324257 3300048922 Bacteria 753
136 Ga0496120_0002040 3300048923 Bacteria 21866
137 Ga0496121_0018273 3300048924 Bacteria 7082
138 Ga0496121_0094774 3300048924 Bacteria 2321
139 Ga0496121_0106149 3300048924 Bacteria 2153
140 Ga0496121_0128405 3300048924 Bacteria 1902
141 Ga0496121_0524232 3300048924 Bacteria 747
142 Ga0496121_0774138 3300048924 Bacteria 567
143 Ga0496122_0000001 3300048925 Bacteria 1827766
144 Ga0496122_0000018 3300048925 Bacteria 426350
145 Ga0496122_0004983 3300048925 Bacteria 16067
146 Ga0496122_0119644 3300048925 Bacteria 1702
147 Ga0496122_0143432 3300048925 Bacteria 1489
148 Ga0496122_0151852 3300048925 Bacteria 1428
149 Ga0496122_0164523 3300048925 Bacteria 1347
150 Ga0496122_0413995 3300048925 Bacteria 680
151 Ga0496123_0000001 3300048926 Bacteria 1831497
152 Ga0496123_0000015 3300048926 Bacteria 426088
153 Ga0496123_0027189 3300048926 Bacteria 4266
154 Ga0496123_0115548 3300048926 Bacteria 1522
155 Ga0496123_0172018 3300048926 Bacteria 1141
156 Ga0496124_0006759 3300048927 Bacteria 12398
157 Ga0496124_0024872 3300048927 Bacteria 5435
158 Ga0496124_0028881 3300048927 Bacteria 4952
159 Ga0496124_0037322 3300048927 Bacteria 4227
160 Ga0496124_0265691 3300048927 Bacteria 1260
161 Ga0496124_0283088 3300048927 Bacteria 1207
162 Ga0496125_0043891 3300048928 Bacteria 3788
163 Ga0496125_0072357 3300048928 Bacteria 2686
164 Ga0496125_0352973 3300048928 Bacteria 878
165 Ga0496126_0001398 3300048929 Bacteria 38223
166 Ga0496126_0025336 3300048929 Bacteria 5707
167 Ga0496126_0257061 3300048929 Bacteria 1454
168 Ga0496126_0268163 3300048929 Bacteria 1417
169 nmdc:mga03683_10305_c1 3300050489 Bacteria 3351
170 nmdc:mga00v17_102_c1 3300050491 Bacteria 50732
171 nmdc:mga00v17_693151_c1 3300050491 Bacteria 653
172 nmdc:mga0yw44_12239_c1 3300050492 Bacteria 1097
173 nmdc:mga0yw44_376969_c1 3300050492 Bacteria 958
174 nmdc:mga0yw44_551136_c1 3300050492 Bacteria 783
175 nmdc:mga0k408_63421_c1 3300050493 Bacteria 2150
176 nmdc:mga06z11_10855_c1 3300050494 Bacteria 3900
177 nmdc:mga06z11_634132_c1 3300050494 Bacteria 650
178 nmdc:mga06z11_93635_c1 3300050494 Bacteria 1636
179 nmdc:mga04h51_2504_c1 3300050495 Bacteria 4369
180 nmdc:mga0sz30_125978_c1 3300050516 Bacteria 1127
181 nmdc:mga0sz30_223_c1 3300050516 Bacteria 21634
182 Ga0500572_059482 3300053111 Bacteria 1158
183 Ga0500618_000722 3300053125 Bacteria 18922
184 Ga0500561_0000491 3300053137 Bacteria 6418
185 Ga0500568_0174896 3300053139 Bacteria 790
186 Ga0500616_0001964 3300053153 Bacteria 18305
187 Ga0500624_000799 3300053157 Bacteria 7356
188 Ga0500634_0055471 3300053161 Bacteria 2119
189 Ga0500636_0000918 3300053177 Bacteria 15861
190 Ga0500636_0002734 3300053177 Bacteria 9817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2979095461 2979099865 130
2 3300031995 Ga0307409_100481673 Ga0307409_1004816731 148
3 iso_pu_bacteria 2919679072 2919679286 148
4 iso_pu_bacteria 2510917028 2511185537 152
5 iso_pu_bacteria 2513237088 2513599545 152
6 iso_pu_bacteria 2513237138 2513868512 152
7 iso_pu_bacteria 2534681796 2535514451 152
8 iso_pu_bacteria 2582581294 2585201420 152
9 iso_pu_bacteria 2582581304 2585259585 152
10 iso_pu_bacteria 2582581867 2585405071 152
11 iso_pu_bacteria 2585427590 2585825122 152
12 iso_pu_bacteria 2585427594 2585843583 152
13 iso_pu_bacteria 2643221599 2644004217 152
14 iso_pu_bacteria 2643221634 2644191102 152
15 iso_pu_bacteria 2643221643 2644237848 152
16 iso_pu_bacteria 2923556063 2923561733 152
17 iso_pu_bacteria 2996887358 2996889755 152
18 iso_pu_bacteria 3003930520 3003931295 152
19 iso_pu_bacteria 3005452660 3005456216 152
20 iso_pu_bacteria 8005258706 8005261601 152
21 iso_pu_bacteria 8005321885 8005324282 152
22 iso_pu_bacteria 8005542996 8005543087 152
23 iso_pu_bacteria 2537561587 2537877222 153
24 iso_pu_bacteria 2554235003 2554246117 153
25 iso_pu_bacteria 2558860242 2559293340 153
26 iso_pu_bacteria 2599185210 2599604223 153
27 iso_pu_bacteria 2600254933 2600376799 153
28 iso_pu_bacteria 2643221568 2643857456 153
29 iso_pu_bacteria 2643221582 2643920496 153
30 iso_pu_bacteria 2643221693 2644519694 153
31 iso_pu_bacteria 2808606387 2808986891 153
32 iso_pu_bacteria 2821123053 2821123146 153
33 iso_pu_bacteria 2838736955 2838739830 153
34 iso_pu_bacteria 2841840854 2841844047 153
35 iso_pu_bacteria 2841846520 2841846535 153
36 iso_pu_bacteria 2841859092 2841860932 153
37 iso_pu_bacteria 2842124991 2842127436 153
38 iso_pu_bacteria 2842140634 2842143768 153
39 iso_pu_bacteria 2842515876 2842517717 153
40 iso_pu_bacteria 2857531043 2857533901 153
41 iso_pu_bacteria 2899792073 2899794243 153
42 iso_pu_bacteria 2899845264 2899849007 153
43 iso_pu_bacteria 2919166419 2919166565 153
44 iso_pu_bacteria 2926760298 2926761987 153
45 iso_pu_bacteria 2933011516 2933015529 153
46 iso_pu_bacteria 2978969890 2978972956 153
47 iso_pu_bacteria 2979089926 2979092745 153
48 iso_pu_bacteria 2984587000 2984591204 153
49 iso_pu_bacteria 650716007 650738575 153
50 iso_pu_bacteria 8003570095 8003572115 153
51 iso_pu_bacteria 8054460903 8054463974 153
52 iso_pu_bacteria 2510917022 2511132119 155
53 iso_pu_bacteria 2582581307 2585276391 155
54 iso_pu_bacteria 2585427531 2585564191 155
55 iso_pu_bacteria 2585427609 2585902948 155
56 iso_pu_bacteria 2585428125 2587978477 155
57 3300003215 JGI25153J46596_10054515 JGI25153J46596_100545152 156
58 3300003354 JGI25160J50197_1018790 JGI25160J50197_10187902 156
59 3300003775 Ga0055524_1002068 Ga0055524_100206816 156
60 3300003790 Ga0055528_1004890 Ga0055528_10048904 156
61 3300003790 Ga0055528_1051831 Ga0055528_10518312 156
62 3300005347 Ga0070668_100024237 Ga0070668_1000242374 156
63 3300005355 Ga0070671_100020442 Ga0070671_1000204423 156
64 3300005457 Ga0070662_100648013 Ga0070662_1006480132 156
65 3300005843 Ga0068860_100496603 Ga0068860_1004966032 156
66 3300006038 Ga0075365_10003247 Ga0075365_100032473 156
67 3300006178 Ga0075367_10002704 Ga0075367_100027042 156
68 3300006186 Ga0075369_10060669 Ga0075369_100606692 156
69 3300009092 Ga0105250_10040394 Ga0105250_100403942 156
70 3300009177 Ga0105248_10006268 Ga0105248_100062689 156
71 3300009763 Ga0123340_1055036 Ga0123340_10550362 156
72 3300009765 Ga0123341_1080181 Ga0123341_10801812 156
73 3300009765 Ga0123341_1080204 Ga0123341_10802042 156
74 3300009766 Ga0123342_1062121 Ga0123342_10621212 156
75 3300010375 Ga0105239_11021812 Ga0105239_110218121 156
76 3300025273 Ga0209673_1011414 Ga0209673_10114142 156
77 3300025273 Ga0209673_1017084 Ga0209673_10170842 156
78 3300025273 Ga0209673_1025468 Ga0209673_10254683 156
79 3300025284 Ga0209130_1017762 Ga0209130_10177622 156
80 3300025294 Ga0209025_1013602 Ga0209025_10136023 156
81 3300025294 Ga0209025_1032964 Ga0209025_10329642 156
82 3300025295 Ga0209564_1008220 Ga0209564_10082202 156
83 3300025295 Ga0209564_1008892 Ga0209564_10088925 156
84 3300025297 Ga0209758_1033701 Ga0209758_10337012 156
85 3300025299 Ga0209256_1006241 Ga0209256_10062412 156
86 3300025299 Ga0209256_1006497 Ga0209256_10064974 156
87 3300025302 Ga0207426_1000608 Ga0207426_100060832 156
88 3300025303 Ga0209051_1007592 Ga0209051_10075924 156
89 3300025711 Ga0207696_1038190 Ga0207696_10381902 156
90 3300025925 Ga0207650_10186843 Ga0207650_101868432 156
91 3300025972 Ga0207668_10026389 Ga0207668_100263895 156
92 3300026067 Ga0207678_11191356 Ga0207678_111913562 156
93 3300028381 Ga0268264_10443915 Ga0268264_104439152 156
94 3300031901 Ga0307406_10025104 Ga0307406_100251041 156
95 3300041404 Ga0439436_0021919 Ga0439436_0021919_1257_1730 156
96 3300041406 Ga0439439_0068820 Ga0439439_0068820_128_601 156
97 3300042007 Ga0439449_0017132 Ga0439449_0017132_2032_2505 156
98 3300046492 Ga0495585_0016688 Ga0495585_0016688_3207_3680 156
99 3300046507 Ga0495606_0097567 Ga0495606_0097567_584_1057 156
100 3300046515 Ga0495620_0044448 Ga0495620_0044448_550_1023 156
101 3300046519 Ga0495632_0005489 Ga0495632_0005489_4987_5460 156
102 3300046616 Ga0495668_0076223 Ga0495668_0076223_1172_1645 156
103 3300046660 Ga0495625_0059988 Ga0495625_0059988_649_1122 156
104 3300046660 Ga0495625_0212244 Ga0495625_0212244_370_843 156
105 3300046674 Ga0495588_0398716 Ga0495588_0398716_114_647 156
106 3300046691 Ga0495670_0058189 Ga0495670_0058189_1146_1619 156
107 3300047443 Ga0495687_038921 Ga0495687_038921_1332_1805 156
108 3300047470 Ga0495681_0089029 Ga0495681_0089029_631_1104 156
109 3300048903 Ga0496100_0807351 Ga0496100_0807351_43_516 156
110 3300048905 Ga0496102_0302917 Ga0496102_0302917_333_806 156
111 3300048906 Ga0496103_0194450 Ga0496103_0194450_521_994 156
112 3300048907 Ga0496104_0360338 Ga0496104_0360338_541_1014 156
113 3300048908 Ga0496105_0775740 Ga0496105_0775740_61_534 156
114 3300048913 Ga0496110_0064918 Ga0496110_0064918_2022_2495 156
115 3300048914 Ga0496111_0190351 Ga0496111_0190351_22_495 156
116 3300048916 Ga0496113_0396231 Ga0496113_0396231_451_924 156
117 3300048917 Ga0496114_0556204 Ga0496114_0556204_321_794 156
118 3300048919 Ga0496116_0012404 Ga0496116_0012404_1969_2457 156
119 3300048919 Ga0496116_0130040 Ga0496116_0130040_311_784 156
120 3300048919 Ga0496116_0157994 Ga0496116_0157994_482_970 156
121 3300048919 Ga0496116_0345086 Ga0496116_0345086_93_566 156
122 3300048920 Ga0496117_0173517 Ga0496117_0173517_643_1116 156
123 3300048922 Ga0496119_0116243 Ga0496119_0116243_786_1259 156
124 3300048922 Ga0496119_0324257 Ga0496119_0324257_126_599 156
125 3300048924 Ga0496121_0094774 Ga0496121_0094774_818_1291 156
126 3300048924 Ga0496121_0128405 Ga0496121_0128405_875_1348 156
127 3300048924 Ga0496121_0774138 Ga0496121_0774138_80_553 156
128 3300048925 Ga0496122_0119644 Ga0496122_0119644_412_885 156
129 3300048925 Ga0496122_0143432 Ga0496122_0143432_542_1030 156
130 3300048925 Ga0496122_0151852 Ga0496122_0151852_606_1076 156
131 3300048925 Ga0496122_0164523 Ga0496122_0164523_511_984 156
132 3300048926 Ga0496123_0027189 Ga0496123_0027189_1591_2061 156
133 3300048926 Ga0496123_0115548 Ga0496123_0115548_236_709 156
134 3300048926 Ga0496123_0172018 Ga0496123_0172018_233_721 156
135 3300048927 Ga0496124_0024872 Ga0496124_0024872_4772_5245 156
136 3300048927 Ga0496124_0028881 Ga0496124_0028881_3540_4010 156
137 3300048927 Ga0496124_0283088 Ga0496124_0283088_308_796 156
138 3300048928 Ga0496125_0072357 Ga0496125_0072357_431_904 156
139 3300048929 Ga0496126_0268163 Ga0496126_0268163_683_1156 156
140 3300050492 nmdc:mga0yw44_551136_c1 nmdc:mga0yw44_551136_c1_42_515 156
141 3300050494 nmdc:mga06z11_634132_c1 nmdc:mga06z11_634132_c1_135_608 156
142 3300050494 nmdc:mga06z11_93635_c1 nmdc:mga06z11_93635_c1_636_1109 156
143 3300050516 nmdc:mga0sz30_125978_c1 nmdc:mga0sz30_125978_c1_274_747 156
144 3300003856 Ga0058692_1003687 Ga0058692_10036875 157
145 3300005262 Ga0065165_1003352 Ga0065165_100335210 157
146 3300005339 Ga0070660_101137518 Ga0070660_1011375181 157
147 3300005548 Ga0070665_100000937 Ga0070665_10000093716 157
148 3300006038 Ga0075365_10026369 Ga0075365_100263694 157
149 3300006048 Ga0075363_100020902 Ga0075363_1000209024 157
150 3300006051 Ga0075364_10107528 Ga0075364_101075283 157
151 3300006177 Ga0075362_10009795 Ga0075362_100097954 157
152 3300006178 Ga0075367_10016557 Ga0075367_100165575 157
153 3300006195 Ga0075366_10006147 Ga0075366_100061474 157
154 3300006948 Ga0099826_10011894 Ga0099826_100118943 157
155 3300009148 Ga0105243_10007941 Ga0105243_100079416 157
156 3300011119 Ga0105246_10164321 Ga0105246_101643212 157
157 3300013100 Ga0157373_10003148 Ga0157373_100031487 157
158 3300013102 Ga0157371_10000004 Ga0157371_1000000416 157
159 3300013104 Ga0157370_10001986 Ga0157370_1000198610 157
160 3300013104 Ga0157370_10711172 Ga0157370_107111722 157
161 3300013105 Ga0157369_10295743 Ga0157369_102957433 157
162 3300025923 Ga0207681_11342491 Ga0207681_113424912 157
163 3300027111 Ga0209281_1000043 Ga0209281_10000439 157
164 3300027312 Ga0209371_1000942 Ga0209371_10009427 157
165 3300027666 Ga0209282_1267687 Ga0209282_12676872 157
166 3300027866 Ga0209813_10003182 Ga0209813_100031824 157
167 3300028379 Ga0268266_10012625 Ga0268266_100126253 157
168 3300030500 Ga0268256_1002122 Ga0268256_10021226 157
169 3300046453 Ga0495627_056133 Ga0495627_056133_407_883 157
170 3300046512 Ga0495610_0001900 Ga0495610_0001900_15635_16111 157
171 3300046515 Ga0495620_0043566 Ga0495620_0043566_1445_1921 157
172 3300046522 Ga0495643_0014779 Ga0495643_0014779_2118_2594 157
173 3300046522 Ga0495643_0029728 Ga0495643_0029728_725_1201 157
174 3300046558 Ga0495633_0027586 Ga0495633_0027586_2222_2698 157
175 3300046558 Ga0495633_0068998 Ga0495633_0068998_1116_1592 157
176 3300046674 Ga0495588_0010671 Ga0495588_0010671_386_862 157
177 3300046692 Ga0495671_0098633 Ga0495671_0098633_358_834 157
178 3300046692 Ga0495671_0161686 Ga0495671_0161686_231_707 157
179 3300046692 Ga0495671_0330181 Ga0495671_0330181_217_690 157
180 3300047469 Ga0495673_0025720 Ga0495673_0025720_2036_2512 157
181 3300047470 Ga0495681_0011963 Ga0495681_0011963_4296_4772 157
182 3300047472 Ga0495686_0041062 Ga0495686_0041062_2370_2846 157
183 3300048916 Ga0496113_0080434 Ga0496113_0080434_1064_1540 157
184 3300048919 Ga0496116_0000817 Ga0496116_0000817_31688_32164 157
185 3300048919 Ga0496116_0153936 Ga0496116_0153936_168_644 157
186 3300048920 Ga0496117_0000002 Ga0496117_0000002_2468292_2468768 157
187 3300048921 Ga0496118_0002959 Ga0496118_0002959_6203_6679 157
188 3300048921 Ga0496118_0341296 Ga0496118_0341296_158_631 157
189 3300048922 Ga0496119_0063865 Ga0496119_0063865_423_899 157
190 3300048923 Ga0496120_0002040 Ga0496120_0002040_6346_6822 157
191 3300048924 Ga0496121_0106149 Ga0496121_0106149_1194_1679 157
192 3300048924 Ga0496121_0524232 Ga0496121_0524232_63_536 157
193 3300048925 Ga0496122_0000001 Ga0496122_0000001_1812300_1812776 157
194 3300048925 Ga0496122_0000018 Ga0496122_0000018_333884_334366 157
195 3300048925 Ga0496122_0004983 Ga0496122_0004983_9502_9975 157
196 3300048925 Ga0496122_0413995 Ga0496122_0413995_128_601 157
197 3300048926 Ga0496123_0000001 Ga0496123_0000001_1816031_1816507 157
198 3300048926 Ga0496123_0000015 Ga0496123_0000015_333884_334366 157
199 3300048927 Ga0496124_0006759 Ga0496124_0006759_9302_9778 157
200 3300048927 Ga0496124_0037322 Ga0496124_0037322_3535_4017 157
201 3300048927 Ga0496124_0265691 Ga0496124_0265691_151_624 157
202 3300048928 Ga0496125_0043891 Ga0496125_0043891_2619_3095 157
203 3300048928 Ga0496125_0352973 Ga0496125_0352973_34_510 157
204 3300048929 Ga0496126_0001398 Ga0496126_0001398_31583_32059 157
205 3300048929 Ga0496126_0025336 Ga0496126_0025336_3119_3595 157
206 3300048929 Ga0496126_0257061 Ga0496126_0257061_140_613 157
207 3300050489 nmdc:mga03683_10305_c1 nmdc:mga03683_10305_c1_1370_1846 157
208 3300050491 nmdc:mga00v17_102_c1 nmdc:mga00v17_102_c1_15044_15520 157
209 3300050491 nmdc:mga00v17_693151_c1 nmdc:mga00v17_693151_c1_16_489 157
210 3300050492 nmdc:mga0yw44_12239_c1 nmdc:mga0yw44_12239_c1_435_908 157
211 3300050492 nmdc:mga0yw44_376969_c1 nmdc:mga0yw44_376969_c1_385_861 157
212 3300050493 nmdc:mga0k408_63421_c1 nmdc:mga0k408_63421_c1_385_861 157
213 3300050494 nmdc:mga06z11_10855_c1 nmdc:mga06z11_10855_c1_385_861 157
214 3300050495 nmdc:mga04h51_2504_c1 nmdc:mga04h51_2504_c1_1834_2310 157
215 3300050516 nmdc:mga0sz30_223_c1 nmdc:mga0sz30_223_c1_8540_9016 157
216 3300053125 Ga0500618_000722 Ga0500618_000722_12734_13207 157
217 3300053137 Ga0500561_0000491 Ga0500561_0000491_1634_2110 157
218 3300053157 Ga0500624_000799 Ga0500624_000799_4473_4949 157
219 3300053161 Ga0500634_0055471 Ga0500634_0055471_712_1188 157
220 3300053177 Ga0500636_0000918 Ga0500636_0000918_10651_11124 157
221 3300053177 Ga0500636_0002734 Ga0500636_0002734_6254_6727 157
222 iso_pu_bacteria 2840878972 2840883758 157
223 iso_pu_bacteria 2585427633 2585998350 158
224 iso_pu_bacteria 2585427634 2586002913 158
225 iso_pu_bacteria 2919171160 2919172561 158
226 3300002704 JGI25155J39150_1000069 JGI25155J39150_100006951 159
227 3300002705 JGI25156J39149_1000095 JGI25156J39149_100009551 159
228 3300002738 JGI25154J39366_1001388 JGI25154J39366_10013885 159
229 3300002741 JGI25157J39369_1000216 JGI25157J39369_100021618 159
230 3300003215 JGI25153J46596_10051381 JGI25153J46596_100513811 159
231 3300003781 Ga0055536_1007906 Ga0055536_10079063 159
232 3300003794 Ga0055531_10027277 Ga0055531_100272771 159
233 3300006353 Ga0075370_10144224 Ga0075370_101442242 159
234 3300025206 Ga0209435_100049 Ga0209435_10004918 159
235 3300025246 Ga0209646_1000159 Ga0209646_100015918 159
236 3300025250 Ga0209026_1000183 Ga0209026_100018318 159
237 3300025256 Ga0209759_1000206 Ga0209759_100020618 159
238 3300025292 Ga0209676_1006407 Ga0209676_10064075 159
239 3300025297 Ga0209758_1006823 Ga0209758_10068238 159
240 3300025298 Ga0209050_1001979 Ga0209050_10019796 159
241 3300025303 Ga0209051_1004553 Ga0209051_10045533 159
242 3300025304 Ga0209257_1005926 Ga0209257_10059268 159
243 3300046507 Ga0495606_0002266 Ga0495606_0002266_10155_10640 159
244 3300048922 Ga0496119_0151397 Ga0496119_0151397_387_887 159
245 3300048922 Ga0496119_0234688 Ga0496119_0234688_17_508 159
246 3300048924 Ga0496121_0018273 Ga0496121_0018273_3731_4216 159
247 3300053111 Ga0500572_059482 Ga0500572_059482_613_1143 159
248 3300053139 Ga0500568_0174896 Ga0500568_0174896_201_689 159
249 3300053153 Ga0500616_0001964 Ga0500616_0001964_7205_7693 159
250 iso_pu_bacteria 2510461069 2510838925 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

139

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

56

141

0.76

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

40

159

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.928 54 159
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9184 114 158
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9182 114 158
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.9176 55 157
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.9166 54 157
ID Description Score Start End Superfamily
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9289 66 110 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9147 114 158 3.30.572.10
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.909 54 159 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9008 54 143 3.40.630.30
af_E0CYC6_80_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8916 54 148 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1C0SUZ3-F1-model_v4 Acetyltransferase 0.9979 5 158 GO:0016747
AF-A0A0Q6S0K3-F1-model_v4 Acetyltransferase 0.9966 5 159 GO:0016747
AF-A0A5D4GP24-F1-model_v4 GNAT family N-acetyltransferase 0.9955 17 159 GO:0016747
AF-A0A1L5NYJ9-F1-model_v4 GCN5-related N-acetyltransferase protein 0.9948 5 159 GO:0016747
AF-A0A7W6RMD7-F1-model_v4 GNAT superfamily N-acetyltransferase 0.9934 5 159 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map