F361762

General Info

Members Datasets Scaffolds Average Seq Length
250 184 498 131

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1065890|Ga0451853_1065890_298_708
Length 136
Sequence VAITVAEHPHAKLVREGYEAFQRGDMDTLRGLMTGDCTHHVPGSHPLSGDYKGIDSVLNDYYGRLSSETGGSFRVELLNLFVDGRGHVMSMHRFTADRGSKHIEENGGIVFRIVGDKISDLDECLEDMDRANDFWS

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
13 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
23 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
24 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
25 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
26 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
27 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
28 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
29 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
30 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
31 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
32 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
33 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
34 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
35 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
36 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
37 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
42 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
43 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
44 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
59 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
125 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
126 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
127 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
128 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
129 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
130 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
131 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
132 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
135 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
136 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
142 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
143 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
144 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
145 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
149 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
150 2643221647 Streptomyces sp. Root369 Isolate Unclassified
151 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
152 2643221714 Streptomyces sp. Root264 Isolate Unclassified
153 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
154 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
155 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
156 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
157 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
158 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
159 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
160 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
161 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
162 2867428634 Streptomyces sp. RP5T Isolate Unclassified
163 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
164 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
165 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
166 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
167 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
168 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
169 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
170 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
171 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
172 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
173 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
174 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
175 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
176 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
177 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
178 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
179 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
180 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
181 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
182 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
183 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
184 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.6
Metatranscriptomes 1.6
Isolates 14.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.4
Nodule 0.8
Rhizoplane 0.4
Rhizosphere 65.6
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1065890 3300041512 Bacteria 1201
2 rootH1_10033290 3300003316 Bacteria 2249
3 Ga0058863_11415498 3300004799 Bacteria 1593
4 Ga0058860_11457946 3300004801 Bacteria 591
5 Ga0068853_100212694 3300005539 Bacteria 1763
6 Ga0075365_10060186 3300006038 Bacteria 2533
7 Ga0075363_100035695 3300006048 Bacteria 2603
8 Ga0105243_10589971 3300009148 Bacteria 1068
9 Ga0105239_10208616 3300010375 Bacteria 2189
10 Ga0105246_10544126 3300011119 Bacteria 994
11 Ga0183367_1006 3300015688 Bacteria 648044
12 Ga0206351_10127483 3300020077 Bacteria 521
13 Ga0207709_10205731 3300025935 Bacteria 1409
14 Ga0207640_10145289 3300025981 Bacteria 1735
15 Ga0209371_1011368 3300027312 Bacteria 2648
16 Ga0307517_10022250 3300028786 Bacteria 7952
17 Ga0307515_10203971 3300028794 Bacteria 1844
18 Ga0307515_10310334 3300028794 Bacteria 1253
19 Ga0268256_1009259 3300030500 Bacteria 3293
20 Ga0307511_10000513 3300030521 Bacteria 41716
21 Ga0307511_10078426 3300030521 Bacteria 2343
22 Ga0307512_10167897 3300030522 Bacteria 1266
23 Ga0307513_10028093 3300031456 Bacteria 6441
24 Ga0307513_10046416 3300031456 Bacteria 4735
25 Ga0307513_10251807 3300031456 Bacteria 1562
26 Ga0307509_10003302 3300031507 Bacteria 24750
27 Ga0307509_10006541 3300031507 Bacteria 15619
28 Ga0307509_10074703 3300031507 Bacteria 3524
29 Ga0307509_10644194 3300031507 Bacteria 729
30 Ga0307508_10024402 3300031616 Bacteria 5487
31 Ga0307508_10049839 3300031616 Bacteria 3729
32 Ga0307514_10006108 3300031649 Bacteria 10574
33 Ga0307514_10018454 3300031649 Bacteria 5720
34 Ga0307514_10090445 3300031649 Bacteria 2233
35 Ga0307514_10233240 3300031649 Bacteria 1112
36 Ga0307516_10012082 3300031730 Bacteria 9331
37 Ga0307516_10038253 3300031730 Bacteria 4789
38 Ga0307516_10148942 3300031730 Bacteria 2103
39 Ga0307518_10020994 3300031838 Bacteria 4694
40 Ga0307518_10121107 3300031838 Bacteria 1851
41 Ga0307507_10066881 3300033179 Bacteria 3290
42 Ga0307510_10040068 3300033180 Bacteria 5149
43 Ga0307510_10067603 3300033180 Bacteria 3595
44 Ga0439436_0002623 3300041404 Bacteria 5416
45 Ga0439436_0073108 3300041404 Bacteria 955
46 Ga0439439_0005306 3300041406 Bacteria 2939
47 Ga0439439_0156082 3300041406 Bacteria 649
48 Ga0451787_386449 3300041441 Bacteria 519
49 Ga0451835_0095643 3300041492 Bacteria 727
50 Ga0451853_0370976 3300041512 Bacteria 3288
51 Ga0451853_2517170 3300041512 Bacteria 1530
52 Ga0439433_0018627 3300041999 Bacteria 1546
53 Ga0439442_007084 3300042002 Bacteria 2252
54 Ga0439448_0024844 3300042005 Bacteria 1876
55 Ga0439449_0000815 3300042007 Bacteria 12013
56 Ga0439449_0028912 3300042007 Bacteria 2065
57 Ga0439449_0051855 3300042007 Bacteria 1517
58 Ga0439449_0069616 3300042007 Bacteria 1297
59 Ga0439449_0092347 3300042007 Bacteria 1118
60 Ga0439449_0108255 3300042007 Bacteria 1029
61 Ga0439455_0002910 3300042012 Bacteria 3198
62 Ga0439457_000253 3300042014 Bacteria 14541
63 Ga0439457_003387 3300042014 Bacteria 4340
64 Ga0439462_0010818 3300042015 Bacteria 2315
65 Ga0450894_000112 3300042131 Bacteria 13787
66 Ga0450898_018497 3300042134 Bacteria 1208
67 Ga0450899_000909 3300042135 Bacteria 3365
68 Ga0450900_030167 3300042136 Bacteria 786
69 Ga0450900_063725 3300042136 Bacteria 578
70 Ga0450902_067824 3300042137 Bacteria 620
71 Ga0450903_001057 3300042138 Bacteria 5250
72 Ga0450906_000794 3300042145 Bacteria 6908
73 Ga0450906_099017 3300042145 Bacteria 531
74 Ga0439458_0001875 3300042157 Bacteria 5208
75 Ga0439458_0041276 3300042157 Bacteria 1120
76 Ga0450901_041502 3300042533 Bacteria 519
77 Ga0466965_0238632 3300044683 Bacteria 973
78 Ga0466970_0082249 3300044765 Bacteria 1741
79 Ga0466960_0078537 3300044901 Bacteria 1657
80 Ga0495592_0015701 3300046454 Bacteria 5746
81 Ga0495603_0006659 3300046455 Bacteria 6931
82 Ga0495629_0003202 3300046459 Bacteria 12389
83 Ga0495629_0016627 3300046459 Bacteria 5280
84 Ga0495629_0244069 3300046459 Bacteria 1236
85 Ga0495638_0035662 3300046460 Bacteria 3170
86 Ga0495638_0058100 3300046460 Bacteria 2398
87 Ga0495651_0005562 3300046462 Bacteria 9609
88 Ga0495651_0231679 3300046462 Bacteria 1272
89 Ga0495653_0159286 3300046463 Bacteria 1568
90 Ga0495580_0041823 3300046472 Bacteria 3267
91 Ga0495639_0760826 3300046475 Bacteria 502
92 Ga0495662_0000113 3300046476 Bacteria 30181
93 Ga0495662_0019571 3300046476 Bacteria 3275
94 Ga0495664_0005475 3300046477 Bacteria 6971
95 Ga0495664_0073127 3300046477 Bacteria 2049
96 Ga0495594_0000403 3300046499 Bacteria 21807
97 Ga0495608_0014324 3300046511 Bacteria 5503
98 Ga0495610_0332541 3300046512 Bacteria 577
99 Ga0495618_0094215 3300046514 Bacteria 1915
100 Ga0495628_0016335 3300046516 Bacteria 6192
101 Ga0495628_0018705 3300046516 Bacteria 5734
102 Ga0495630_0017687 3300046517 Bacteria 5225
103 Ga0495630_0081197 3300046517 Bacteria 2447
104 Ga0495643_0002879 3300046522 Bacteria 13057
105 Ga0495666_0001459 3300046526 Bacteria 11527
106 Ga0495652_0041283 3300046529 Bacteria 3983
107 Ga0495665_0012893 3300046531 Bacteria 4525
108 Ga0495640_0003964 3300046533 Bacteria 11852
109 Ga0495640_0082687 3300046533 Bacteria 2132
110 Ga0495586_0064633 3300046535 Bacteria 1994
111 Ga0495586_0195074 3300046535 Bacteria 1147
112 Ga0495587_0014729 3300046536 Bacteria 4898
113 Ga0495587_0048511 3300046536 Bacteria 2514
114 Ga0495645_0005116 3300046543 Bacteria 8986
115 Ga0495645_0015437 3300046543 Bacteria 5431
116 Ga0495645_0027514 3300046543 Bacteria 4132
117 Ga0495667_0235618 3300046559 Bacteria 1166
118 Ga0495634_0002802 3300046642 Bacteria 14319
119 Ga0495634_0102571 3300046642 Bacteria 1847
120 Ga0495625_0019962 3300046660 Bacteria 5183
121 Ga0495635_0001287 3300046663 Bacteria 16746
122 Ga0495635_0013310 3300046663 Bacteria 5756
123 Ga0495588_0003700 3300046674 Bacteria 6698
124 Ga0495588_0156898 3300046674 Bacteria 1203
125 Ga0495657_0034002 3300046675 Bacteria 3544
126 Ga0495657_0044665 3300046675 Bacteria 3012
127 Ga0495599_0021635 3300046678 Bacteria 4012
128 Ga0495599_0806351 3300046678 Bacteria 536
129 Ga0495623_0168133 3300046679 Bacteria 1283
130 Ga0495623_0201297 3300046679 Bacteria 1144
131 Ga0495646_0000312 3300046680 Bacteria 24964
132 Ga0495646_0001428 3300046680 Bacteria 14204
133 Ga0495613_0000421 3300046689 Bacteria 36407
134 Ga0495613_0011480 3300046689 Bacteria 6588
135 Ga0495613_0168417 3300046689 Bacteria 1556
136 Ga0495670_0509204 3300046691 Bacteria 654
137 Ga0495671_0194374 3300046692 Bacteria 985
138 Ga0495589_0045420 3300046794 Bacteria 2182
139 Ga0495600_0040051 3300046809 Bacteria 3051
140 Ga0495600_0082074 3300046809 Bacteria 2103
141 Ga0495660_0010076 3300046810 Bacteria 5497
142 Ga0495581_0013329 3300047315 Bacteria 4766
143 Ga0495581_0236827 3300047315 Bacteria 1067
144 Ga0495604_0000185 3300047317 Bacteria 55651
145 Ga0495604_0001005 3300047317 Bacteria 23492
146 Ga0495636_0153511 3300047318 Bacteria 1034
147 Ga0495674_0007087 3300047319 Bacteria 10725
148 Ga0495676_0005259 3300047321 Bacteria 11847
149 Ga0495676_0077289 3300047321 Bacteria 2538
150 Ga0495680_0486963 3300047322 Bacteria 839
151 Ga0495683_0016625 3300047323 Bacteria 3819
152 Ga0495687_000771 3300047443 Bacteria 34685
153 Ga0495687_025120 3300047443 Bacteria 2822
154 Ga0495675_0010429 3300047444 Bacteria 5808
155 Ga0495675_0221546 3300047444 Bacteria 1144
156 Ga0495675_0270108 3300047444 Bacteria 1016
157 Ga0495679_041694 3300047446 Bacteria 1420
158 Ga0495685_000842 3300047447 Bacteria 9351
159 Ga0495681_0000194 3300047470 Bacteria 51439
160 Ga0495681_0150937 3300047470 Bacteria 975
161 Ga0495684_0051766 3300047471 Bacteria 3133
162 Ga0495593_0000923 3300047673 Bacteria 17078
163 Ga0495593_0111418 3300047673 Bacteria 1397
164 Ga0495602_0004837 3300048088 Bacteria 14092
165 Ga0495602_0053656 3300048088 Bacteria 3568
166 Ga0495614_0009118 3300048089 Bacteria 4397
167 Ga0501031_0445764 3300049568 Bacteria 836
168 Ga0501034_0301704 3300049571 Bacteria 1538
169 Ga0501038_0005139 3300049574 Bacteria 12157
170 Ga0501043_0443638 3300049579 Bacteria 976
171 Ga0501047_0841739 3300049581 Bacteria 731
172 Ga0501067_0140917 3300049583 Bacteria 1343
173 Ga0501044_0090521 3300049823 Bacteria 3086
174 nmdc:mga03n38_10879_c1 3300050490 Bacteria 3368
175 nmdc:mga0yw44_191124_c1 3300050492 Bacteria 1350
176 nmdc:mga07m45_98428_c1 3300050496 Bacteria 1679
177 Ga0495601_0008667 3300053077 Bacteria 6003
178 Ga0495601_0485437 3300053077 Bacteria 798
179 Ga0495655_0084871 3300053083 Bacteria 912
180 Ga0495619_0654164 3300053085 Bacteria 717
181 Ga0500578_0073654 3300053086 Bacteria 2175
182 Ga0500644_0024749 3300053088 Bacteria 1839
183 Ga0500646_0324986 3300053090 Bacteria 556
184 Ga0500583_0085891 3300053092 Bacteria 1526
185 Ga0500640_013022 3300053095 Bacteria 3431
186 Ga0500641_0165368 3300053096 Bacteria 953
187 Ga0500650_0084179 3300053098 Bacteria 1488
188 Ga0500654_041378 3300053099 Bacteria 2612
189 Ga0500660_065523 3300053100 Bacteria 1728
190 Ga0500553_053671 3300053101 Bacteria 1923
191 Ga0500553_146896 3300053101 Bacteria 917
192 Ga0500553_225554 3300053101 Unclassified 604
193 Ga0500560_000674 3300053107 Bacteria 5061
194 Ga0500572_121903 3300053111 Bacteria 844
195 Ga0500580_079650 3300053113 Bacteria 1331
196 Ga0500608_188789 3300053122 Bacteria 864
197 Ga0500614_046062 3300053123 Bacteria 1128
198 Ga0500628_004071 3300053129 Bacteria 2414
199 Ga0500652_001549 3300053131 Bacteria 7033
200 Ga0500658_0015225 3300053134 Bacteria 2853
201 Ga0500559_0305007 3300053136 Bacteria 747
202 Ga0500561_0001819 3300053137 Bacteria 3511
203 Ga0500573_0186998 3300053140 Bacteria 1109
204 Ga0500573_0279681 3300053140 Bacteria 845
205 Ga0500579_030389 3300053143 Bacteria 3469
206 Ga0500600_0007047 3300053149 Bacteria 6742
207 Ga0500600_0363172 3300053149 Bacteria 590
208 Ga0500624_012550 3300053157 Bacteria 1254
209 Ga0500633_0013228 3300053160 Bacteria 2305
210 Ga0500634_0040383 3300053161 Bacteria 2535
211 Ga0500636_0387475 3300053177 Bacteria 653
212 Ga0587128_152957 3300059630 Bacteria 527
213 2585304888 2582581313 Bacteria 10042643
214 2585313246 2582581314 Bacteria 11452267
215 2644269205 2643221647 Bacteria 10741251
216 2644436324 2643221678 Bacteria 9540101
217 2644625813 2643221714 Bacteria 9015452
218 2785342448 2784746763 Bacteria 9783172
219 2785368531 2784746768 Bacteria 10036182
220 2786669552 2786546132 Bacteria 10419719
221 2808841221 2808606359 Bacteria 9866990
222 2808915440 2808606375 Bacteria 9466072
223 2812359033 2811994879 Bacteria 9313447
224 2852641224 2852635781 Bacteria 8251373
225 2862383166 2862382967 Bacteria 10317375
226 2863412214 2863404153 Bacteria 9672205
227 2867432409 2867428634 Bacteria 9590268
228 2877682002 2877676314 Bacteria 9512378
229 2912720966 2912715099 Bacteria 9460473
230 2919468622 2919468124 Bacteria 9133025
231 2946066844 2946064051 Bacteria 8957905
232 2946075169 2946072368 Bacteria 8999607
233 2947230385 2947224130 Bacteria 9938529
234 2954003384 2954002825 Bacteria 9173742
235 2954387120 2954380949 Bacteria 10050426
236 2954676043 2954673503 Bacteria 9685905
237 2954688123 2954682443 Bacteria 9862841
238 2954697950 2954691527 Bacteria 10720516
239 2954704266 2954701450 Bacteria 10834262
240 2954717070 2954711539 Bacteria 10867210
241 2954727040 2954721474 Bacteria 10456478
242 2954734763 2954731030 Bacteria 10243860
243 2954745942 2954740390 Bacteria 10229294
244 2954753649 2954749733 Bacteria 10366972
245 2954764913 2954759201 Bacteria 9358192
246 2990060441 2990059506 Bacteria 9321252
247 3006500997 3006493962 Bacteria 8825450
248 8008565961 8008558824 Bacteria 10610750
249 8048412585 8048406513 Bacteria 8936924
250 Ga0451853_1065890
251 rootH1_10033290
252 Ga0058863_11415498
253 Ga0058860_11457946
254 Ga0068853_100212694
255 Ga0075365_10060186
256 Ga0075363_100035695
257 Ga0105243_10589971
258 Ga0105239_10208616
259 Ga0105246_10544126
260 Ga0183367_1006
261 Ga0206351_10127483
262 Ga0207709_10205731
263 Ga0207640_10145289
264 Ga0209371_1011368
265 Ga0307517_10022250
266 Ga0307515_10203971
267 Ga0307515_10310334
268 Ga0268256_1009259
269 Ga0307511_10000513
270 Ga0307511_10078426
271 Ga0307512_10167897
272 Ga0307513_10028093
273 Ga0307513_10046416
274 Ga0307513_10251807
275 Ga0307509_10003302
276 Ga0307509_10006541
277 Ga0307509_10074703
278 Ga0307509_10644194
279 Ga0307508_10024402
280 Ga0307508_10049839
281 Ga0307514_10006108
282 Ga0307514_10018454
283 Ga0307514_10090445
284 Ga0307514_10233240
285 Ga0307516_10012082
286 Ga0307516_10038253
287 Ga0307516_10148942
288 Ga0307518_10020994
289 Ga0307518_10121107
290 Ga0307507_10066881
291 Ga0307510_10040068
292 Ga0307510_10067603
293 Ga0439436_0002623
294 Ga0439436_0073108
295 Ga0439439_0005306
296 Ga0439439_0156082
297 Ga0451787_386449
298 Ga0451835_0095643
299 Ga0451853_0370976
300 Ga0451853_2517170
301 Ga0439433_0018627
302 Ga0439442_007084
303 Ga0439448_0024844
304 Ga0439449_0000815
305 Ga0439449_0028912
306 Ga0439449_0051855
307 Ga0439449_0069616
308 Ga0439449_0092347
309 Ga0439449_0108255
310 Ga0439455_0002910
311 Ga0439457_000253
312 Ga0439457_003387
313 Ga0439462_0010818
314 Ga0450894_000112
315 Ga0450898_018497
316 Ga0450899_000909
317 Ga0450900_030167
318 Ga0450900_063725
319 Ga0450902_067824
320 Ga0450903_001057
321 Ga0450906_000794
322 Ga0450906_099017
323 Ga0439458_0001875
324 Ga0439458_0041276
325 Ga0450901_041502
326 Ga0466965_0238632
327 Ga0466970_0082249
328 Ga0466960_0078537
329 Ga0495592_0015701
330 Ga0495603_0006659
331 Ga0495629_0003202
332 Ga0495629_0016627
333 Ga0495629_0244069
334 Ga0495638_0035662
335 Ga0495638_0058100
336 Ga0495651_0005562
337 Ga0495651_0231679
338 Ga0495653_0159286
339 Ga0495580_0041823
340 Ga0495639_0760826
341 Ga0495662_0000113
342 Ga0495662_0019571
343 Ga0495664_0005475
344 Ga0495664_0073127
345 Ga0495594_0000403
346 Ga0495608_0014324
347 Ga0495610_0332541
348 Ga0495618_0094215
349 Ga0495628_0016335
350 Ga0495628_0018705
351 Ga0495630_0017687
352 Ga0495630_0081197
353 Ga0495643_0002879
354 Ga0495666_0001459
355 Ga0495652_0041283
356 Ga0495665_0012893
357 Ga0495640_0003964
358 Ga0495640_0082687
359 Ga0495586_0064633
360 Ga0495586_0195074
361 Ga0495587_0014729
362 Ga0495587_0048511
363 Ga0495645_0005116
364 Ga0495645_0015437
365 Ga0495645_0027514
366 Ga0495667_0235618
367 Ga0495634_0002802
368 Ga0495634_0102571
369 Ga0495625_0019962
370 Ga0495635_0001287
371 Ga0495635_0013310
372 Ga0495588_0003700
373 Ga0495588_0156898
374 Ga0495657_0034002
375 Ga0495657_0044665
376 Ga0495599_0021635
377 Ga0495599_0806351
378 Ga0495623_0168133
379 Ga0495623_0201297
380 Ga0495646_0000312
381 Ga0495646_0001428
382 Ga0495613_0000421
383 Ga0495613_0011480
384 Ga0495613_0168417
385 Ga0495670_0509204
386 Ga0495671_0194374
387 Ga0495589_0045420
388 Ga0495600_0040051
389 Ga0495600_0082074
390 Ga0495660_0010076
391 Ga0495581_0013329
392 Ga0495581_0236827
393 Ga0495604_0000185
394 Ga0495604_0001005
395 Ga0495636_0153511
396 Ga0495674_0007087
397 Ga0495676_0005259
398 Ga0495676_0077289
399 Ga0495680_0486963
400 Ga0495683_0016625
401 Ga0495687_000771
402 Ga0495687_025120
403 Ga0495675_0010429
404 Ga0495675_0221546
405 Ga0495675_0270108
406 Ga0495679_041694
407 Ga0495685_000842
408 Ga0495681_0000194
409 Ga0495681_0150937
410 Ga0495684_0051766
411 Ga0495593_0000923
412 Ga0495593_0111418
413 Ga0495602_0004837
414 Ga0495602_0053656
415 Ga0495614_0009118
416 Ga0501031_0445764
417 Ga0501034_0301704
418 Ga0501038_0005139
419 Ga0501043_0443638
420 Ga0501047_0841739
421 Ga0501067_0140917
422 Ga0501044_0090521
423 nmdc:mga03n38_10879_c1
424 nmdc:mga0yw44_191124_c1
425 nmdc:mga07m45_98428_c1
426 Ga0495601_0008667
427 Ga0495601_0485437
428 Ga0495655_0084871
429 Ga0495619_0654164
430 Ga0500578_0073654
431 Ga0500644_0024749
432 Ga0500646_0324986
433 Ga0500583_0085891
434 Ga0500640_013022
435 Ga0500641_0165368
436 Ga0500650_0084179
437 Ga0500654_041378
438 Ga0500660_065523
439 Ga0500553_053671
440 Ga0500553_146896
441 Ga0500553_225554
442 Ga0500560_000674
443 Ga0500572_121903
444 Ga0500580_079650
445 Ga0500608_188789
446 Ga0500614_046062
447 Ga0500628_004071
448 Ga0500652_001549
449 Ga0500658_0015225
450 Ga0500559_0305007
451 Ga0500561_0001819
452 Ga0500573_0186998
453 Ga0500573_0279681
454 Ga0500579_030389
455 Ga0500600_0007047
456 Ga0500600_0363172
457 Ga0500624_012550
458 Ga0500633_0013228
459 Ga0500634_0040383
460 Ga0500636_0387475
461 Ga0587128_152957
462 2585304888
463 2585313246
464 2644269205
465 2644436324
466 2644625813
467 2785342448
468 2785368531
469 2786669552
470 2808841221
471 2808915440
472 2812359033
473 2852641224
474 2862383166
475 2863412214
476 2867432409
477 2877682002
478 2912720966
479 2919468622
480 2946066844
481 2946075169
482 2947230385
483 2954003384
484 2954387120
485 2954676043
486 2954688123
487 2954697950
488 2954704266
489 2954717070
490 2954727040
491 2954734763
492 2954745942
493 2954753649
494 2954764913
495 2990060441
496 3006500997
497 8008565961
498 8048412585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

14

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.9865 5 130
3g8z-assembly1.cif.gz_A-2 crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution 0.9442 6 132
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.9421 5 130
3g8z-assembly1.cif.gz_A-2 crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution 0.9232 6 132
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9052 8 118
ID Description Score Start End Superfamily
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9865 5 130 3.10.450.50
af_P9WM93_4_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9798 4 131 3.10.450.50
af_P9WM93_4_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9723 4 131 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9421 5 130 3.10.450.50
3g8zA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9126 6 132 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3R8SXN1-F1-model_v4 Nuclear transport factor 2 family protein 0.9992 1 132
AF-A0A6B3BJX1-F1-model_v4 Nuclear transport factor 2 family protein 0.9941 1 131
AF-A0A7Z1TYA9-F1-model_v4 deleted 0.9941 1 131
AF-A0A2N3UXI5-F1-model_v4 deleted 0.9941 25 131
AF-A0A1H9S2T9-F1-model_v4 SnoaL-like domain-containing protein 0.9938 1 131

Map