F361466

General Info

Members Datasets Scaffolds Average Seq Length
250 182 500 79

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10097002|Ga0075364_100970022
Length 83
Sequence MALDERLLAILACPEDKGPLYYLGDDAETGGLYNPRLHRRYAVRDGIPVMLIGEADTVGEDEHAAIMARIAADGIAPTFTPAS

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 12
Rhizosphere 77.2
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10097002 3300006051 Bacteria 1960
2 Ga0070658_10752681 3300005327 Bacteria 846
3 Ga0070676_11301615 3300005328 Bacteria 555
4 Ga0070676_11571618 3300005328 Bacteria 508
5 Ga0070683_101453697 3300005329 Bacteria 659
6 Ga0070690_100022987 3300005330 Bacteria 3819
7 Ga0068869_101366144 3300005334 Bacteria 626
8 Ga0070666_10876357 3300005335 Bacteria 663
9 Ga0070682_100788457 3300005337 Bacteria 771
10 Ga0068868_100131415 3300005338 Bacteria 2049
11 Ga0070689_100069337 3300005340 Bacteria 2751
12 Ga0070687_100290180 3300005343 Bacteria 1033
13 Ga0070692_10227596 3300005345 Bacteria 1105
14 Ga0070668_100032560 3300005347 Bacteria 3967
15 Ga0070668_101174464 3300005347 Bacteria 695
16 Ga0070669_100316314 3300005353 Bacteria 1259
17 Ga0070675_100537286 3300005354 Bacteria 1056
18 Ga0070674_100050453 3300005356 Bacteria 2865
19 Ga0070673_100903685 3300005364 Bacteria 819
20 Ga0070673_101638721 3300005364 Bacteria 608
21 Ga0070688_100060386 3300005365 Bacteria 2394
22 Ga0070659_100384962 3300005366 Bacteria 1182
23 Ga0070667_101465349 3300005367 Bacteria 641
24 Ga0070700_100217072 3300005441 Bacteria 1353
25 Ga0070708_100004259 3300005445 Bacteria 11242
26 Ga0070708_102102640 3300005445 Bacteria 522
27 Ga0070678_100277023 3300005456 Bacteria 1417
28 Ga0070678_102174872 3300005456 Bacteria 526
29 Ga0068867_100004470 3300005459 Bacteria 9829
30 Ga0068867_100824743 3300005459 Bacteria 829
31 Ga0070685_10411517 3300005466 Bacteria 939
32 Ga0068853_102181777 3300005539 Bacteria 537
33 Ga0070686_100038168 3300005544 Bacteria 2984
34 Ga0070695_100297261 3300005545 Bacteria 1192
35 Ga0070695_101503054 3300005545 Bacteria 560
36 Ga0070704_101704879 3300005549 Bacteria 582
37 Ga0068857_102410197 3300005577 Bacteria 517
38 Ga0068854_101390735 3300005578 Bacteria 634
39 Ga0068854_101915429 3300005578 Bacteria 545
40 Ga0068856_100394281 3300005614 Bacteria 1404
41 Ga0068852_101262791 3300005616 Bacteria 760
42 Ga0068852_101449034 3300005616 Bacteria 709
43 Ga0068859_100612477 3300005617 Bacteria 1182
44 Ga0068861_100042279 3300005719 Bacteria 3414
45 Ga0068861_100683996 3300005719 Bacteria 951
46 Ga0068870_10328743 3300005840 Bacteria 974
47 Ga0068858_101013409 3300005842 Bacteria 814
48 Ga0068860_100649128 3300005843 Bacteria 1063
49 Ga0068860_101421783 3300005843 Bacteria 715
50 Ga0068862_100106486 3300005844 Bacteria 2458
51 Ga0068862_100376852 3300005844 Bacteria 1322
52 Ga0075363_100686803 3300006048 Bacteria 617
53 Ga0075364_10015219 3300006051 Bacteria 4766
54 Ga0070715_10499657 3300006163 Bacteria 696
55 Ga0075367_10495754 3300006178 Bacteria 775
56 Ga0075366_10089486 3300006195 Bacteria 1844
57 Ga0097621_100601758 3300006237 Bacteria 1005
58 Ga0075370_10687645 3300006353 Bacteria 622
59 Ga0068871_100027368 3300006358 Bacteria 4459
60 Ga0068865_100137410 3300006881 Bacteria 1838
61 Ga0068865_101599357 3300006881 Bacteria 586
62 Ga0097620_100612516 3300006931 Bacteria 1182
63 Ga0111539_12697428 3300009094 Bacteria 576
64 Ga0105245_10083425 3300009098 Bacteria 2925
65 Ga0105245_10767800 3300009098 Bacteria 1000
66 Ga0105245_10948828 3300009098 Bacteria 903
67 Ga0105245_11592884 3300009098 Bacteria 705
68 Ga0105245_11679813 3300009098 Bacteria 687
69 Ga0105247_10938902 3300009101 Bacteria 671
70 Ga0105247_11666218 3300009101 Bacteria 526
71 Ga0114129_10145053 3300009147 Bacteria 3252
72 Ga0105243_10069548 3300009148 Bacteria 2840
73 Ga0105243_13107416 3300009148 Bacteria 503
74 Ga0105242_10023972 3300009176 Bacteria 4815
75 Ga0105242_13219122 3300009176 Bacteria 507
76 Ga0105248_10026255 3300009177 Bacteria 6480
77 Ga0105248_12373444 3300009177 Bacteria 604
78 Ga0105238_11039039 3300009551 Bacteria 841
79 Ga0105249_10038569 3300009553 Bacteria 4335
80 Ga0105249_10092188 3300009553 Bacteria 2836
81 Ga0105249_10186216 3300009553 Bacteria 2023
82 Ga0105249_10217574 3300009553 Bacteria 1878
83 Ga0105249_13430988 3300009553 Bacteria 510
84 Ga0105239_12480617 3300010375 Bacteria 604
85 Ga0105246_11174248 3300011119 Bacteria 705
86 Ga0105246_11680678 3300011119 Bacteria 603
87 Ga0157369_10940071 3300013105 Bacteria 886
88 Ga0157378_10022283 3300013297 Bacteria 5576
89 Ga0163162_11285858 3300013306 Bacteria 831
90 Ga0163162_12081409 3300013306 Bacteria 651
91 Ga0163162_12890587 3300013306 Bacteria 553
92 Ga0157372_11696437 3300013307 Bacteria 727
93 Ga0157375_10448163 3300013308 Bacteria 1456
94 Ga0157375_13744017 3300013308 Bacteria 505
95 Ga0157380_10647601 3300014326 Bacteria 1053
96 Ga0157380_13251390 3300014326 Bacteria 519
97 Ga0157377_10097237 3300014745 Bacteria 1748
98 Ga0157379_10072368 3300014968 Bacteria 3084
99 Ga0157376_10190891 3300014969 Bacteria 1878
100 Ga0157376_11120067 3300014969 Bacteria 813
101 Ga0163161_11542153 3300017792 Bacteria 584
102 Ga0163161_12088879 3300017792 Bacteria 504
103 Ga0207697_10259500 3300025315 Bacteria 769
104 Ga0207642_10757573 3300025899 Bacteria 615
105 Ga0207688_10061514 3300025901 Bacteria 2116
106 Ga0207662_10015089 3300025918 Bacteria 4342
107 Ga0207649_10915205 3300025920 Bacteria 688
108 Ga0207681_10366453 3300025923 Bacteria 1157
109 Ga0207650_10837086 3300025925 Bacteria 780
110 Ga0207659_10723530 3300025926 Bacteria 853
111 Ga0207659_10825366 3300025926 Bacteria 797
112 Ga0207687_10001768 3300025927 Bacteria 14854
113 Ga0207644_11856222 3300025931 Bacteria 504
114 Ga0207686_10606837 3300025934 Bacteria 862
115 Ga0207686_10615320 3300025934 Bacteria 856
116 Ga0207709_10269663 3300025935 Bacteria 1252
117 Ga0207670_10061528 3300025936 Bacteria 2562
118 Ga0207669_10162562 3300025937 Bacteria 1579
119 Ga0207704_10126738 3300025938 Bacteria 1759
120 Ga0207691_10438501 3300025940 Bacteria 1112
121 Ga0207691_10935937 3300025940 Bacteria 724
122 Ga0207711_10437041 3300025941 Bacteria 1218
123 Ga0207689_10246984 3300025942 Bacteria 1476
124 Ga0207661_10452515 3300025944 Bacteria 1170
125 Ga0207651_10898277 3300025960 Bacteria 789
126 Ga0207651_10932739 3300025960 Bacteria 774
127 Ga0207712_10038597 3300025961 Bacteria 3266
128 Ga0207712_10634827 3300025961 Bacteria 927
129 Ga0207668_10098554 3300025972 Bacteria 2166
130 Ga0207668_10843967 3300025972 Bacteria 813
131 Ga0207640_10099075 3300025981 Bacteria 2039
132 Ga0207658_11232701 3300025986 Bacteria 684
133 Ga0207677_10297257 3300026023 Bacteria 1332
134 Ga0207703_10184397 3300026035 Bacteria 1844
135 Ga0207708_10285882 3300026075 Bacteria 1338
136 Ga0207708_10374414 3300026075 Bacteria 1173
137 Ga0207648_10009002 3300026089 Bacteria 9602
138 Ga0207675_100068337 3300026118 Bacteria 3321
139 Ga0207683_10097464 3300026121 Bacteria 2623
140 Ga0207698_10388287 3300026142 Bacteria 1330
141 Ga0207698_10419977 3300026142 Bacteria 1283
142 Ga0207698_12441284 3300026142 Bacteria 533
143 Ga0268265_10096989 3300028380 Bacteria 2371
144 Ga0268265_10255854 3300028380 Bacteria 1554
145 Ga0268264_10161984 3300028381 Bacteria 2016
146 Ga0268264_10293678 3300028381 Bacteria 1527
147 Ga0268264_10357663 3300028381 Bacteria 1392
148 Ga0268264_10830448 3300028381 Bacteria 925
149 Ga0265338_10476514 3300028800 Bacteria 881
150 Ga0265327_10501953 3300031251 Bacteria 523
151 Ga0316576_11046758 3300031727 Bacteria 580
152 Ga0316578_10110478 3300031728 Bacteria 1651
153 Ga0307405_10218309 3300031731 Bacteria 1397
154 Ga0307413_10049283 3300031824 Bacteria 2523
155 Ga0307410_10306288 3300031852 Bacteria 1255
156 Ga0307407_10514226 3300031903 Bacteria 880
157 Ga0307412_11580672 3300031911 Bacteria 598
158 Ga0307409_100032435 3300031995 Bacteria 3787
159 Ga0307416_102003807 3300032002 Bacteria 682
160 Ga0307414_11747720 3300032004 Bacteria 580
161 Ga0307411_10079208 3300032005 Bacteria 2255
162 Ga0307415_100252745 3300032126 Bacteria 1433
163 Ga0373941_0307763 3300035115 Bacteria 634
164 Ga0316574_0145443 3300035398 Bacteria 1528
165 Ga0316574_0187712 3300035398 Bacteria 1329
166 Ga0316584_0375338 3300036712 Bacteria 1017
167 Ga0436365_0470404 3300039437 Bacteria 3770
168 Ga0451791_0791265 3300041451 Bacteria 709
169 Ga0451793_0665889 3300041452 Bacteria 1214
170 Ga0451797_0771903 3300041453 Bacteria 746
171 Ga0451800_0881958 3300041459 Bacteria 615
172 Ga0451802_2167044 3300041460 Bacteria 512
173 Ga0451804_0266320 3300041463 Bacteria 722
174 Ga0451807_0354678 3300041486 Bacteria 587
175 Ga0451833_0154031 3300041491 Bacteria 693
176 Ga0451841_0671010 3300041498 Bacteria 532
177 Ga0451851_0155188 3300041507 Bacteria 602
178 Ga0451851_0414019 3300041507 Bacteria 574
179 Ga0451843_0816051 3300041509 Bacteria 502
180 Ga0451855_1247791 3300041511 Bacteria 660
181 Ga0451853_2622584 3300041512 Bacteria 558
182 Ga0451853_3057963 3300041512 Bacteria 1147
183 Ga0451853_3290850 3300041512 Bacteria 816
184 Ga0451577_0308596 3300042876 Bacteria 1434
185 Ga0451576_0040242 3300045051 Bacteria 4949
186 Ga0495592_0517338 3300046454 Bacteria 738
187 Ga0495629_0336822 3300046459 Bacteria 1030
188 Ga0495653_0323647 3300046463 Bacteria 999
189 Ga0495639_0377103 3300046475 Bacteria 715
190 Ga0495664_0639226 3300046477 Unclassified 631
191 Ga0495618_0120135 3300046514 Bacteria 1683
192 Ga0495630_0079215 3300046517 Bacteria 2478
193 Ga0495640_0771308 3300046533 Bacteria 574
194 Ga0495586_0027637 3300046535 Bacteria 3035
195 Ga0495622_0260758 3300046557 Bacteria 761
196 Ga0495634_0181034 3300046642 Bacteria 1319
197 Ga0495646_0223519 3300046680 Bacteria 1017
198 Ga0495658_0055386 3300046683 Bacteria 2259
199 Ga0495613_0000250 3300046689 Bacteria 50733
200 Ga0495670_0316883 3300046691 Bacteria 837
201 Ga0495676_0269323 3300047321 Bacteria 1156
202 Ga0495680_0095534 3300047322 Bacteria 2222
203 Ga0495614_0238274 3300048089 Bacteria 830
204 Ga0496100_0058650 3300048903 Bacteria 2527
205 Ga0496101_0079920 3300048904 Bacteria 2415
206 Ga0496101_0935645 3300048904 Bacteria 682
207 Ga0496102_0056114 3300048905 Bacteria 3593
208 Ga0496103_0850463 3300048906 Bacteria 574
209 Ga0496104_0005356 3300048907 Bacteria 11230
210 Ga0496105_0039335 3300048908 Bacteria 3898
211 Ga0496106_0039859 3300048909 Bacteria 3517
212 Ga0496106_1322820 3300048909 Bacteria 559
213 Ga0496107_0017958 3300048910 Bacteria 4978
214 Ga0496108_0023269 3300048911 Bacteria 5097
215 Ga0496109_0017813 3300048912 Bacteria 6231
216 Ga0496109_0127008 3300048912 Bacteria 2378
217 Ga0496110_0063020 3300048913 Bacteria 3276
218 Ga0496110_0153146 3300048913 Bacteria 2088
219 Ga0496110_0830825 3300048913 Bacteria 829
220 Ga0496111_0311189 3300048914 Bacteria 1167
221 Ga0496113_1494076 3300048916 Bacteria 522
222 Ga0496114_0007837 3300048917 Bacteria 8450
223 Ga0496114_0475797 3300048917 Bacteria 1105
224 Ga0496114_0828555 3300048917 Bacteria 805
225 Ga0496114_0916822 3300048917 Bacteria 758
226 Ga0496114_1301502 3300048917 Bacteria 614
227 Ga0501034_0000918 3300049571 Bacteria 43043
228 Ga0501034_0004840 3300049571 Bacteria 14876
229 Ga0501034_0015214 3300049571 Bacteria 7908
230 Ga0501034_0041193 3300049571 Bacteria 4673
231 Ga0501039_0707427 3300049575 Bacteria 788
232 Ga0501071_0825577 3300049587 Bacteria 715
233 Ga0501071_1347357 3300049587 Bacteria 551
234 Ga0501073_1122213 3300049589 Bacteria 540
235 Ga0501076_0360990 3300049592 Bacteria 1193
236 Ga0501076_1629543 3300049592 Bacteria 529
237 Ga0501080_1742211 3300049742 Bacteria 525
238 Ga0501045_0400267 3300049824 Bacteria 1022
239 nmdc:mga03683_423271_c1 3300050489 Bacteria 638
240 nmdc:mga03n38_345412_c1 3300050490 Bacteria 809
241 nmdc:mga00v17_476999_c1 3300050491 Bacteria 809
242 nmdc:mga00v17_584476_c1 3300050491 Bacteria 721
243 nmdc:mga00v17_646098_c1 3300050491 Bacteria 680
244 nmdc:mga00v17_797706_c1 3300050491 Bacteria 602
245 nmdc:mga00v17_94405_c1 3300050491 Bacteria 1882
246 nmdc:mga0k408_179344_c1 3300050493 Bacteria 1263
247 nmdc:mga06z11_202314_c1 3300050494 Bacteria 1154
248 Ga0500566_0044656 3300053094 Bacteria 2552
249 Ga0500568_0076860 3300053139 Bacteria 1271
250 Ga0501082_0263727 3300060353 Bacteria 1499
251 Ga0075364_10097002
252 Ga0070658_10752681
253 Ga0070676_11301615
254 Ga0070676_11571618
255 Ga0070683_101453697
256 Ga0070690_100022987
257 Ga0068869_101366144
258 Ga0070666_10876357
259 Ga0070682_100788457
260 Ga0068868_100131415
261 Ga0070689_100069337
262 Ga0070687_100290180
263 Ga0070692_10227596
264 Ga0070668_100032560
265 Ga0070668_101174464
266 Ga0070669_100316314
267 Ga0070675_100537286
268 Ga0070674_100050453
269 Ga0070673_100903685
270 Ga0070673_101638721
271 Ga0070688_100060386
272 Ga0070659_100384962
273 Ga0070667_101465349
274 Ga0070700_100217072
275 Ga0070708_100004259
276 Ga0070708_102102640
277 Ga0070678_100277023
278 Ga0070678_102174872
279 Ga0068867_100004470
280 Ga0068867_100824743
281 Ga0070685_10411517
282 Ga0068853_102181777
283 Ga0070686_100038168
284 Ga0070695_100297261
285 Ga0070695_101503054
286 Ga0070704_101704879
287 Ga0068857_102410197
288 Ga0068854_101390735
289 Ga0068854_101915429
290 Ga0068856_100394281
291 Ga0068852_101262791
292 Ga0068852_101449034
293 Ga0068859_100612477
294 Ga0068861_100042279
295 Ga0068861_100683996
296 Ga0068870_10328743
297 Ga0068858_101013409
298 Ga0068860_100649128
299 Ga0068860_101421783
300 Ga0068862_100106486
301 Ga0068862_100376852
302 Ga0075363_100686803
303 Ga0075364_10015219
304 Ga0070715_10499657
305 Ga0075367_10495754
306 Ga0075366_10089486
307 Ga0097621_100601758
308 Ga0075370_10687645
309 Ga0068871_100027368
310 Ga0068865_100137410
311 Ga0068865_101599357
312 Ga0097620_100612516
313 Ga0111539_12697428
314 Ga0105245_10083425
315 Ga0105245_10767800
316 Ga0105245_10948828
317 Ga0105245_11592884
318 Ga0105245_11679813
319 Ga0105247_10938902
320 Ga0105247_11666218
321 Ga0114129_10145053
322 Ga0105243_10069548
323 Ga0105243_13107416
324 Ga0105242_10023972
325 Ga0105242_13219122
326 Ga0105248_10026255
327 Ga0105248_12373444
328 Ga0105238_11039039
329 Ga0105249_10038569
330 Ga0105249_10092188
331 Ga0105249_10186216
332 Ga0105249_10217574
333 Ga0105249_13430988
334 Ga0105239_12480617
335 Ga0105246_11174248
336 Ga0105246_11680678
337 Ga0157369_10940071
338 Ga0157378_10022283
339 Ga0163162_11285858
340 Ga0163162_12081409
341 Ga0163162_12890587
342 Ga0157372_11696437
343 Ga0157375_10448163
344 Ga0157375_13744017
345 Ga0157380_10647601
346 Ga0157380_13251390
347 Ga0157377_10097237
348 Ga0157379_10072368
349 Ga0157376_10190891
350 Ga0157376_11120067
351 Ga0163161_11542153
352 Ga0163161_12088879
353 Ga0207697_10259500
354 Ga0207642_10757573
355 Ga0207688_10061514
356 Ga0207662_10015089
357 Ga0207649_10915205
358 Ga0207681_10366453
359 Ga0207650_10837086
360 Ga0207659_10723530
361 Ga0207659_10825366
362 Ga0207687_10001768
363 Ga0207644_11856222
364 Ga0207686_10606837
365 Ga0207686_10615320
366 Ga0207709_10269663
367 Ga0207670_10061528
368 Ga0207669_10162562
369 Ga0207704_10126738
370 Ga0207691_10438501
371 Ga0207691_10935937
372 Ga0207711_10437041
373 Ga0207689_10246984
374 Ga0207661_10452515
375 Ga0207651_10898277
376 Ga0207651_10932739
377 Ga0207712_10038597
378 Ga0207712_10634827
379 Ga0207668_10098554
380 Ga0207668_10843967
381 Ga0207640_10099075
382 Ga0207658_11232701
383 Ga0207677_10297257
384 Ga0207703_10184397
385 Ga0207708_10285882
386 Ga0207708_10374414
387 Ga0207648_10009002
388 Ga0207675_100068337
389 Ga0207683_10097464
390 Ga0207698_10388287
391 Ga0207698_10419977
392 Ga0207698_12441284
393 Ga0268265_10096989
394 Ga0268265_10255854
395 Ga0268264_10161984
396 Ga0268264_10293678
397 Ga0268264_10357663
398 Ga0268264_10830448
399 Ga0265338_10476514
400 Ga0265327_10501953
401 Ga0316576_11046758
402 Ga0316578_10110478
403 Ga0307405_10218309
404 Ga0307413_10049283
405 Ga0307410_10306288
406 Ga0307407_10514226
407 Ga0307412_11580672
408 Ga0307409_100032435
409 Ga0307416_102003807
410 Ga0307414_11747720
411 Ga0307411_10079208
412 Ga0307415_100252745
413 Ga0373941_0307763
414 Ga0316574_0145443
415 Ga0316574_0187712
416 Ga0316584_0375338
417 Ga0436365_0470404
418 Ga0451791_0791265
419 Ga0451793_0665889
420 Ga0451797_0771903
421 Ga0451800_0881958
422 Ga0451802_2167044
423 Ga0451804_0266320
424 Ga0451807_0354678
425 Ga0451833_0154031
426 Ga0451841_0671010
427 Ga0451851_0155188
428 Ga0451851_0414019
429 Ga0451843_0816051
430 Ga0451855_1247791
431 Ga0451853_2622584
432 Ga0451853_3057963
433 Ga0451853_3290850
434 Ga0451577_0308596
435 Ga0451576_0040242
436 Ga0495592_0517338
437 Ga0495629_0336822
438 Ga0495653_0323647
439 Ga0495639_0377103
440 Ga0495664_0639226
441 Ga0495618_0120135
442 Ga0495630_0079215
443 Ga0495640_0771308
444 Ga0495586_0027637
445 Ga0495622_0260758
446 Ga0495634_0181034
447 Ga0495646_0223519
448 Ga0495658_0055386
449 Ga0495613_0000250
450 Ga0495670_0316883
451 Ga0495676_0269323
452 Ga0495680_0095534
453 Ga0495614_0238274
454 Ga0496100_0058650
455 Ga0496101_0079920
456 Ga0496101_0935645
457 Ga0496102_0056114
458 Ga0496103_0850463
459 Ga0496104_0005356
460 Ga0496105_0039335
461 Ga0496106_0039859
462 Ga0496106_1322820
463 Ga0496107_0017958
464 Ga0496108_0023269
465 Ga0496109_0017813
466 Ga0496109_0127008
467 Ga0496110_0063020
468 Ga0496110_0153146
469 Ga0496110_0830825
470 Ga0496111_0311189
471 Ga0496113_1494076
472 Ga0496114_0007837
473 Ga0496114_0475797
474 Ga0496114_0828555
475 Ga0496114_0916822
476 Ga0496114_1301502
477 Ga0501034_0000918
478 Ga0501034_0004840
479 Ga0501034_0015214
480 Ga0501034_0041193
481 Ga0501039_0707427
482 Ga0501071_0825577
483 Ga0501071_1347357
484 Ga0501073_1122213
485 Ga0501076_0360990
486 Ga0501076_1629543
487 Ga0501080_1742211
488 Ga0501045_0400267
489 nmdc:mga03683_423271_c1
490 nmdc:mga03n38_345412_c1
491 nmdc:mga00v17_476999_c1
492 nmdc:mga00v17_584476_c1
493 nmdc:mga00v17_646098_c1
494 nmdc:mga00v17_797706_c1
495 nmdc:mga00v17_94405_c1
496 nmdc:mga0k408_179344_c1
497 nmdc:mga06z11_202314_c1
498 Ga0500566_0044656
499 Ga0500568_0076860
500 Ga0501082_0263727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

4

46

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hf1-assembly1.cif.gz_A crystal structure of the putative tetraacyldisaccharide-1-p 4-kinase from chromobacterium violaceum. nesg target cvr39. 0.8083 11 63
8b4b-assembly1.cif.gz_X toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.8015 20 69
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.7982 18 39
5ju7-assembly1.cif.gz_A dna binding domain of e.coli cadc 0.7744 19 69
8b4b-assembly1.cif.gz_Y toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.7713 26 69
ID Description Score Start End Superfamily
af_O74497_117_297_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 1.017 28 38 2.60.120.920
af_I1K817_187_396_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.8778 28 38 2.60.120.920
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8258 12 57 2.20.25.10
af_Q2FUY9_123_221_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8107 20 65 1.10.10.10
2hf1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8105 11 63 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A1B6NRG7-F1-model_v4 Cytosolic protein 0.9919 27 63
AF-A0A6A4TAK7-F1-model_v4 Protein preY, mitochondrial 0.9564 18 57
AF-A0A2V7PVY5-F1-model_v4 Tetraacyldisaccharide 4'-kinase 0.9522 18 55 GO:0016301
AF-A0A6N7G197-F1-model_v4 Trm112 family protein 0.951 19 78
AF-X8FFN3-F1-model_v4 deleted 0.9398 26 66

Map