F361315
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 183 | 243 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100141282|Ga0070670_1001412823 |
| Length | 126 |
| Sequence | VTVKVLIVDDSKLARIVAAKALAELQPDWTKVEAGSAAHAHELLDSGEVVDLALVDFNMTVKDGLEFAGDLRAAHPTMPIAIITANIQDEVIARARAIDASFVPKPVTAEALQGFISGAALRLRKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 4 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 5 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 6 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 141 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 142 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 143 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 144 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 145 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 146 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 147 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 148 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 149 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 150 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 151 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 152 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 154 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 157 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 158 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 159 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 160 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 161 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 162 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 164 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 165 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 166 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 168 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 169 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 170 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 171 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 172 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 173 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 175 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 176 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 177 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 178 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 183 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0 |
| Isolates | 2.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.4 |
| Nodule | 0.4 |
| Rhizoplane | 5.2 |
| Rhizosphere | 56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10043101 | 3300003215 | Bacteria | 1370 |
| 2 | rootH2_10338698 | 3300003320 | Bacteria | 1126 |
| 3 | rootL2_10069773 | 3300003322 | Bacteria | 6790 |
| 4 | Ga0055537_1000763 | 3300003773 | Bacteria | 16362 |
| 5 | Ga0055524_1016817 | 3300003775 | Bacteria | 2605 |
| 6 | Ga0055528_1012739 | 3300003790 | Bacteria | 3244 |
| 7 | Ga0070658_11570647 | 3300005327 | Unclassified | 570 |
| 8 | Ga0070676_10000070 | 3300005328 | Bacteria | 34585 |
| 9 | Ga0070670_100141282 | 3300005331 | Bacteria | 2082 |
| 10 | Ga0068869_100002874 | 3300005334 | Bacteria | 10455 |
| 11 | Ga0070666_10061183 | 3300005335 | Bacteria | 2549 |
| 12 | Ga0070666_10492234 | 3300005335 | Unclassified | 888 |
| 13 | Ga0070682_100061807 | 3300005337 | Bacteria | 2371 |
| 14 | Ga0068868_100000067 | 3300005338 | Bacteria | 59782 |
| 15 | Ga0070671_100148333 | 3300005355 | Bacteria | 1980 |
| 16 | Ga0070673_100000007 | 3300005364 | Bacteria | 177157 |
| 17 | Ga0070667_100000760 | 3300005367 | Bacteria | 30664 |
| 18 | Ga0070667_100008914 | 3300005367 | Bacteria | 8303 |
| 19 | Ga0070667_100070044 | 3300005367 | Bacteria | 2985 |
| 20 | Ga0070678_102181111 | 3300005456 | Bacteria | 525 |
| 21 | Ga0070681_10045836 | 3300005458 | Bacteria | 4373 |
| 22 | Ga0070681_11128682 | 3300005458 | Bacteria | 705 |
| 23 | Ga0068867_100000010 | 3300005459 | Bacteria | 129593 |
| 24 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 25 | Ga0070679_100782340 | 3300005530 | Bacteria | 897 |
| 26 | Ga0070672_100180644 | 3300005543 | Bacteria | 1758 |
| 27 | Ga0070665_100004370 | 3300005548 | Bacteria | 14862 |
| 28 | Ga0070665_100939334 | 3300005548 | Bacteria | 877 |
| 29 | Ga0068855_100294616 | 3300005563 | Bacteria | 1798 |
| 30 | Ga0068854_100054022 | 3300005578 | Bacteria | 2887 |
| 31 | Ga0068856_100110322 | 3300005614 | Bacteria | 2748 |
| 32 | Ga0068852_102459416 | 3300005616 | Bacteria | 541 |
| 33 | Ga0068864_100001214 | 3300005618 | Bacteria | 21408 |
| 34 | Ga0068864_100485169 | 3300005618 | Unclassified | 1187 |
| 35 | Ga0068866_10091479 | 3300005718 | Bacteria | 1658 |
| 36 | Ga0068863_100000635 | 3300005841 | Bacteria | 35541 |
| 37 | Ga0068863_100003075 | 3300005841 | Bacteria | 16488 |
| 38 | Ga0068863_100024123 | 3300005841 | Bacteria | 5803 |
| 39 | Ga0068858_100557652 | 3300005842 | Bacteria | 1109 |
| 40 | Ga0068860_100000329 | 3300005843 | Bacteria | 64404 |
| 41 | Ga0068860_100049069 | 3300005843 | Bacteria | 4023 |
| 42 | Ga0068862_100016747 | 3300005844 | Bacteria | 6102 |
| 43 | Ga0075365_10010874 | 3300006038 | Bacteria | 5327 |
| 44 | Ga0075365_10042866 | 3300006038 | Unclassified | 2960 |
| 45 | Ga0075365_10540343 | 3300006038 | Unclassified | 824 |
| 46 | Ga0075368_10009722 | 3300006042 | Unclassified | 3464 |
| 47 | Ga0075368_10287691 | 3300006042 | Unclassified | 707 |
| 48 | Ga0075363_100032711 | 3300006048 | Bacteria | 2703 |
| 49 | Ga0075364_10008570 | 3300006051 | Bacteria | 6117 |
| 50 | Ga0075362_10214989 | 3300006177 | Bacteria | 938 |
| 51 | Ga0075367_10220332 | 3300006178 | Bacteria | 1187 |
| 52 | Ga0075369_10006856 | 3300006186 | Bacteria | 4323 |
| 53 | Ga0075366_10221966 | 3300006195 | Bacteria | 1151 |
| 54 | Ga0075366_10285982 | 3300006195 | Bacteria | 1008 |
| 55 | Ga0075370_10078721 | 3300006353 | Unclassified | 1893 |
| 56 | Ga0075370_10078987 | 3300006353 | Bacteria | 1890 |
| 57 | Ga0075370_10229144 | 3300006353 | Bacteria | 1099 |
| 58 | Ga0068871_101417923 | 3300006358 | Unclassified | 655 |
| 59 | Ga0068865_100000008 | 3300006881 | Bacteria | 177158 |
| 60 | Ga0068865_101016760 | 3300006881 | Bacteria | 726 |
| 61 | Ga0105240_10001551 | 3300009093 | Bacteria | 38976 |
| 62 | Ga0105240_10046146 | 3300009093 | Bacteria | 5522 |
| 63 | Ga0105245_10001358 | 3300009098 | Bacteria | 22138 |
| 64 | Ga0105243_10000080 | 3300009148 | Bacteria | 109765 |
| 65 | Ga0105241_10743059 | 3300009174 | Bacteria | 899 |
| 66 | Ga0105242_10001111 | 3300009176 | Bacteria | 21201 |
| 67 | Ga0105237_10077505 | 3300009545 | Bacteria | 3314 |
| 68 | Ga0105237_11697177 | 3300009545 | Bacteria | 639 |
| 69 | Ga0105238_10191035 | 3300009551 | Bacteria | 2024 |
| 70 | Ga0105238_12783010 | 3300009551 | Bacteria | 526 |
| 71 | Ga0105249_11047905 | 3300009553 | Bacteria | 885 |
| 72 | Ga0105239_10000157 | 3300010375 | Bacteria | 98327 |
| 73 | Ga0105246_10002730 | 3300011119 | Bacteria | 10678 |
| 74 | Ga0157374_10002183 | 3300013296 | Bacteria | 16487 |
| 75 | Ga0157378_10003897 | 3300013297 | Bacteria | 13216 |
| 76 | Ga0157375_10003407 | 3300013308 | Bacteria | 13777 |
| 77 | Ga0157377_10141795 | 3300014745 | Bacteria | 1477 |
| 78 | Ga0157376_10000839 | 3300014969 | Bacteria | 20143 |
| 79 | Ga0213876_10110484 | 3300021384 | Bacteria | 1459 |
| 80 | Ga0209646_1026005 | 3300025246 | Bacteria | 814 |
| 81 | Ga0209026_1001239 | 3300025250 | Bacteria | 11679 |
| 82 | Ga0209565_1000363 | 3300025263 | Bacteria | 38972 |
| 83 | Ga0209673_1000458 | 3300025273 | Bacteria | 68889 |
| 84 | Ga0209675_1012973 | 3300025291 | Bacteria | 2643 |
| 85 | Ga0209025_1057187 | 3300025294 | Bacteria | 1493 |
| 86 | Ga0209564_1009294 | 3300025295 | Bacteria | 4702 |
| 87 | Ga0209758_1003233 | 3300025297 | Bacteria | 15141 |
| 88 | Ga0209256_1001974 | 3300025299 | Bacteria | 18472 |
| 89 | Ga0209256_1041840 | 3300025299 | Bacteria | 1161 |
| 90 | Ga0207642_10160385 | 3300025899 | Bacteria | 1207 |
| 91 | Ga0207688_10085464 | 3300025901 | Bacteria | 1807 |
| 92 | Ga0207680_10367383 | 3300025903 | Unclassified | 1012 |
| 93 | Ga0207645_10002833 | 3300025907 | Bacteria | 13456 |
| 94 | Ga0207654_10747464 | 3300025911 | Bacteria | 704 |
| 95 | Ga0207707_10035298 | 3300025912 | Bacteria | 4373 |
| 96 | Ga0207695_10002132 | 3300025913 | Bacteria | 29982 |
| 97 | Ga0207695_10003149 | 3300025913 | Bacteria | 23550 |
| 98 | Ga0207695_10048034 | 3300025913 | Bacteria | 4510 |
| 99 | Ga0207671_10009701 | 3300025914 | Bacteria | 8019 |
| 100 | Ga0207660_10000237 | 3300025917 | Bacteria | 35635 |
| 101 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 102 | Ga0207652_10632540 | 3300025921 | Bacteria | 958 |
| 103 | Ga0207694_11755794 | 3300025924 | Bacteria | 522 |
| 104 | Ga0207650_10479002 | 3300025925 | Bacteria | 1038 |
| 105 | Ga0207687_10006894 | 3300025927 | Bacteria | 7485 |
| 106 | Ga0207644_10014992 | 3300025931 | Bacteria | 5198 |
| 107 | Ga0207644_10947162 | 3300025931 | Bacteria | 722 |
| 108 | Ga0207686_10001677 | 3300025934 | Bacteria | 12339 |
| 109 | Ga0207709_10001026 | 3300025935 | Bacteria | 20660 |
| 110 | Ga0207704_10000013 | 3300025938 | Bacteria | 170478 |
| 111 | Ga0207691_10195629 | 3300025940 | Bacteria | 1762 |
| 112 | Ga0207711_11091257 | 3300025941 | Bacteria | 739 |
| 113 | Ga0207689_10000114 | 3300025942 | Bacteria | 66389 |
| 114 | Ga0207667_10059551 | 3300025949 | Bacteria | 3999 |
| 115 | Ga0207651_10000013 | 3300025960 | Bacteria | 177573 |
| 116 | Ga0207712_10135618 | 3300025961 | Bacteria | 1881 |
| 117 | Ga0207712_10735471 | 3300025961 | Unclassified | 863 |
| 118 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 119 | Ga0207640_10039932 | 3300025981 | Bacteria | 2974 |
| 120 | Ga0207658_10000324 | 3300025986 | Bacteria | 48133 |
| 121 | Ga0207658_10002704 | 3300025986 | Bacteria | 12793 |
| 122 | Ga0207658_10004212 | 3300025986 | Bacteria | 10020 |
| 123 | Ga0207677_10000563 | 3300026023 | Bacteria | 23428 |
| 124 | Ga0207703_10705947 | 3300026035 | Unclassified | 959 |
| 125 | Ga0207639_11541175 | 3300026041 | Bacteria | 624 |
| 126 | Ga0207702_10522300 | 3300026078 | Unclassified | 1159 |
| 127 | Ga0207641_10000242 | 3300026088 | Bacteria | 70950 |
| 128 | Ga0207641_10000728 | 3300026088 | Bacteria | 35344 |
| 129 | Ga0207641_10036704 | 3300026088 | Bacteria | 4091 |
| 130 | Ga0207648_10000025 | 3300026089 | Bacteria | 131593 |
| 131 | Ga0207676_10001031 | 3300026095 | Bacteria | 21326 |
| 132 | Ga0207674_10744226 | 3300026116 | Bacteria | 946 |
| 133 | Ga0207683_11792899 | 3300026121 | Bacteria | 563 |
| 134 | Ga0209813_10001162 | 3300027866 | Bacteria | 5882 |
| 135 | Ga0209813_10074446 | 3300027866 | Bacteria | 1110 |
| 136 | Ga0268266_10003713 | 3300028379 | Bacteria | 15025 |
| 137 | Ga0268266_11040271 | 3300028379 | Bacteria | 792 |
| 138 | Ga0268265_10004500 | 3300028380 | Bacteria | 9648 |
| 139 | Ga0268264_10000349 | 3300028381 | Bacteria | 70208 |
| 140 | Ga0268264_10046404 | 3300028381 | Bacteria | 3608 |
| 141 | Ga0265327_10004491 | 3300031251 | Bacteria | 12329 |
| 142 | Ga0307412_10003875 | 3300031911 | Bacteria | 8325 |
| 143 | Ga0436365_1412024 | 3300039437 | Bacteria | 4889 |
| 144 | Ga0466968_0002188 | 3300044735 | Bacteria | 7136 |
| 145 | Ga0466968_0113742 | 3300044735 | Bacteria | 1219 |
| 146 | Ga0466960_0126477 | 3300044901 | Bacteria | 1344 |
| 147 | Ga0495638_0000199 | 3300046460 | Bacteria | 85791 |
| 148 | Ga0495650_0032540 | 3300046471 | Bacteria | 2331 |
| 149 | Ga0495650_0090113 | 3300046471 | Bacteria | 1168 |
| 150 | Ga0495583_0000037 | 3300046506 | Bacteria | 244437 |
| 151 | Ga0495606_0000598 | 3300046507 | Bacteria | 57087 |
| 152 | Ga0495606_0043126 | 3300046507 | Bacteria | 3011 |
| 153 | Ga0495610_0133450 | 3300046512 | Bacteria | 1076 |
| 154 | Ga0495616_0000018 | 3300046513 | Bacteria | 167281 |
| 155 | Ga0495637_0005376 | 3300046520 | Bacteria | 6541 |
| 156 | Ga0495648_0000300 | 3300046524 | Bacteria | 54935 |
| 157 | Ga0495668_0000039 | 3300046616 | Bacteria | 231402 |
| 158 | Ga0495668_0051589 | 3300046616 | Bacteria | 2277 |
| 159 | Ga0495670_0634104 | 3300046691 | Bacteria | 582 |
| 160 | Ga0495679_005114 | 3300047446 | Bacteria | 5883 |
| 161 | Ga0495673_0000263 | 3300047469 | Bacteria | 73113 |
| 162 | Ga0495673_0002653 | 3300047469 | Bacteria | 12370 |
| 163 | Ga0495673_0039810 | 3300047469 | Bacteria | 2130 |
| 164 | Ga0495686_0000055 | 3300047472 | Bacteria | 255566 |
| 165 | Ga0495686_0000070 | 3300047472 | Bacteria | 216642 |
| 166 | Ga0495686_0006151 | 3300047472 | Bacteria | 9281 |
| 167 | Ga0495686_0081409 | 3300047472 | Bacteria | 1977 |
| 168 | Ga0496100_1371060 | 3300048903 | Bacteria | 558 |
| 169 | Ga0496101_0383279 | 3300048904 | Bacteria | 1106 |
| 170 | Ga0496102_0519831 | 3300048905 | Bacteria | 1113 |
| 171 | Ga0496104_0029100 | 3300048907 | Bacteria | 5123 |
| 172 | Ga0496105_0326628 | 3300048908 | Bacteria | 1228 |
| 173 | Ga0496107_0000019 | 3300048910 | Bacteria | 150224 |
| 174 | Ga0496107_0053799 | 3300048910 | Bacteria | 2904 |
| 175 | Ga0496111_0364332 | 3300048914 | Bacteria | 1070 |
| 176 | Ga0496113_1048772 | 3300048916 | Bacteria | 641 |
| 177 | Ga0496115_0000333 | 3300048918 | Bacteria | 40158 |
| 178 | Ga0496115_0018597 | 3300048918 | Bacteria | 5339 |
| 179 | Ga0496115_1122432 | 3300048918 | Bacteria | 595 |
| 180 | Ga0496116_0052601 | 3300048919 | Bacteria | 2697 |
| 181 | Ga0496117_0013229 | 3300048920 | Bacteria | 7212 |
| 182 | Ga0496117_0055315 | 3300048920 | Bacteria | 2773 |
| 183 | Ga0496118_0034626 | 3300048921 | Bacteria | 4116 |
| 184 | Ga0496118_0049982 | 3300048921 | Bacteria | 3214 |
| 185 | Ga0496119_0083767 | 3300048922 | Bacteria | 1830 |
| 186 | Ga0496121_0000085 | 3300048924 | Bacteria | 223810 |
| 187 | Ga0496121_0006189 | 3300048924 | Bacteria | 15004 |
| 188 | Ga0496121_0032805 | 3300048924 | Bacteria | 4712 |
| 189 | Ga0496121_0165999 | 3300048924 | Bacteria | 1609 |
| 190 | Ga0496122_0000083 | 3300048925 | Bacteria | 208744 |
| 191 | Ga0496122_0042631 | 3300048925 | Bacteria | 3567 |
| 192 | Ga0496122_0408361 | 3300048925 | Bacteria | 687 |
| 193 | Ga0496122_0428247 | 3300048925 | Bacteria | 663 |
| 194 | Ga0496123_0000097 | 3300048926 | Bacteria | 173894 |
| 195 | Ga0496124_0005657 | 3300048927 | Bacteria | 13957 |
| 196 | Ga0496124_0304470 | 3300048927 | Bacteria | 1149 |
| 197 | Ga0496125_0142933 | 3300048928 | Bacteria | 1660 |
| 198 | Ga0496125_0310907 | 3300048928 | Bacteria | 960 |
| 199 | Ga0496126_0001829 | 3300048929 | Bacteria | 31042 |
| 200 | Ga0496126_0041773 | 3300048929 | Bacteria | 4241 |
| 201 | Ga0501300_003486 | 3300049523 | Bacteria | 2351 |
| 202 | Ga0501238_000393 | 3300049671 | Bacteria | 5389 |
| 203 | Ga0501249_000075 | 3300049679 | Bacteria | 34091 |
| 204 | Ga0501259_063199 | 3300049688 | Bacteria | 778 |
| 205 | Ga0501044_0170271 | 3300049823 | Bacteria | 2150 |
| 206 | Ga0501220_07903 | 3300049852 | Bacteria | 552 |
| 207 | nmdc:mga00v17_26250_c1 | 3300050491 | Bacteria | 3393 |
| 208 | nmdc:mga0yw44_111172_c1 | 3300050492 | Unclassified | 1756 |
| 209 | nmdc:mga0yw44_500933_c1 | 3300050492 | Unclassified | 824 |
| 210 | nmdc:mga0k408_144149_c1 | 3300050493 | Unclassified | 1418 |
| 211 | nmdc:mga0k408_235323_c1 | 3300050493 | Bacteria | 1093 |
| 212 | nmdc:mga06z11_52141_c1 | 3300050494 | Unclassified | 2098 |
| 213 | nmdc:mga04h51_4489_c1 | 3300050495 | Unclassified | 3478 |
| 214 | nmdc:mga07m45_211573_c1 | 3300050496 | Bacteria | 1128 |
| 215 | nmdc:mga07m45_266582_c1 | 3300050496 | Bacteria | 996 |
| 216 | nmdc:mga07m45_46281_c1 | 3300050496 | Unclassified | 2444 |
| 217 | nmdc:mga07m45_787912_c1 | 3300050496 | Unclassified | 545 |
| 218 | nmdc:mga07m45_81534_c1 | 3300050496 | Bacteria | 1847 |
| 219 | nmdc:mga0sz30_4451_c1 | 3300050516 | Bacteria | 5064 |
| 220 | Ga0500578_0032076 | 3300053086 | Bacteria | 3378 |
| 221 | Ga0500643_000220 | 3300053087 | Bacteria | 53142 |
| 222 | Ga0500643_031675 | 3300053087 | Bacteria | 1610 |
| 223 | Ga0500644_0000031 | 3300053088 | Bacteria | 86737 |
| 224 | Ga0500644_0009532 | 3300053088 | Bacteria | 2601 |
| 225 | Ga0500641_0014283 | 3300053096 | Bacteria | 2929 |
| 226 | Ga0500554_000580 | 3300053102 | Bacteria | 7465 |
| 227 | Ga0500556_0000186 | 3300053104 | Bacteria | 50723 |
| 228 | Ga0500562_002001 | 3300053108 | Bacteria | 5108 |
| 229 | Ga0500592_024167 | 3300053116 | Bacteria | 979 |
| 230 | Ga0500608_000155 | 3300053122 | Bacteria | 28458 |
| 231 | Ga0500608_079654 | 3300053122 | Bacteria | 1547 |
| 232 | Ga0500618_000024 | 3300053125 | Bacteria | 152149 |
| 233 | Ga0500559_0172464 | 3300053136 | Unclassified | 1017 |
| 234 | Ga0500564_000141 | 3300053138 | Bacteria | 18461 |
| 235 | Ga0500568_0044235 | 3300053139 | Bacteria | 1777 |
| 236 | Ga0500577_0026741 | 3300053142 | Bacteria | 1968 |
| 237 | Ga0500604_0157828 | 3300053151 | Bacteria | 772 |
| 238 | Ga0500616_0014866 | 3300053153 | Bacteria | 4461 |
| 239 | Ga0500616_0265402 | 3300053153 | Bacteria | 727 |
| 240 | Ga0500622_0005847 | 3300053156 | Bacteria | 7280 |
| 241 | Ga0500622_0031798 | 3300053156 | Bacteria | 2769 |
| 242 | Ga0500627_0063916 | 3300053158 | Bacteria | 1622 |
| 243 | Ga0500645_000149 | 3300053730 | Bacteria | 54622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050493 | nmdc:mga0k408_235323_c1 | nmdc:mga0k408_235323_c1_398_766 | 122 |
| 2 | iso_pu_bacteria | 2857504554 | 2857509187 | 122 |
| 3 | iso_pu_bacteria | 2582581279 | 2585148387 | 123 |
| 4 | iso_pu_bacteria | 2599185359 | 2600225267 | 123 |
| 5 | iso_pu_bacteria | 2751185897 | 2753767276 | 123 |
| 6 | iso_pu_bacteria | 2928526807 | 2928529270 | 123 |
| 7 | iso_pu_bacteria | 2929199973 | 2929206522 | 123 |
| 8 | iso_pu_bacteria | 643348564 | 643598539 | 123 |
| 9 | 3300005331 | Ga0070670_100141282 | Ga0070670_1001412823 | 125 |
| 10 | 3300005337 | Ga0070682_100061807 | Ga0070682_1000618073 | 125 |
| 11 | 3300005548 | Ga0070665_100939334 | Ga0070665_1009393342 | 125 |
| 12 | 3300005618 | Ga0068864_100001214 | Ga0068864_10000121419 | 125 |
| 13 | 3300005841 | Ga0068863_100000635 | Ga0068863_10000063515 | 125 |
| 14 | 3300025925 | Ga0207650_10479002 | Ga0207650_104790022 | 125 |
| 15 | 3300026088 | Ga0207641_10000242 | Ga0207641_1000024238 | 125 |
| 16 | 3300026095 | Ga0207676_10001031 | Ga0207676_1000103118 | 125 |
| 17 | 3300028379 | Ga0268266_11040271 | Ga0268266_110402712 | 125 |
| 18 | 3300049823 | Ga0501044_0170271 | Ga0501044_0170271_132_509 | 125 |
| 19 | 3300003320 | rootH2_10338698 | rootH2_103386982 | 126 |
| 20 | 3300005335 | Ga0070666_10492234 | Ga0070666_104922342 | 126 |
| 21 | 3300005367 | Ga0070667_100000760 | Ga0070667_10000076023 | 126 |
| 22 | 3300005456 | Ga0070678_102181111 | Ga0070678_1021811111 | 126 |
| 23 | 3300005458 | Ga0070681_11128682 | Ga0070681_111286821 | 126 |
| 24 | 3300005530 | Ga0070679_100782340 | Ga0070679_1007823401 | 126 |
| 25 | 3300005616 | Ga0068852_102459416 | Ga0068852_1024594161 | 126 |
| 26 | 3300005841 | Ga0068863_100003075 | Ga0068863_1000030753 | 126 |
| 27 | 3300005842 | Ga0068858_100557652 | Ga0068858_1005576522 | 126 |
| 28 | 3300005843 | Ga0068860_100000329 | Ga0068860_10000032912 | 126 |
| 29 | 3300006038 | Ga0075365_10540343 | Ga0075365_105403432 | 126 |
| 30 | 3300006195 | Ga0075366_10285982 | Ga0075366_102859822 | 126 |
| 31 | 3300006353 | Ga0075370_10229144 | Ga0075370_102291442 | 126 |
| 32 | 3300006358 | Ga0068871_101417923 | Ga0068871_1014179232 | 126 |
| 33 | 3300006881 | Ga0068865_101016760 | Ga0068865_1010167602 | 126 |
| 34 | 3300009174 | Ga0105241_10743059 | Ga0105241_107430591 | 126 |
| 35 | 3300009551 | Ga0105238_10191035 | Ga0105238_101910353 | 126 |
| 36 | 3300009551 | Ga0105238_12783010 | Ga0105238_127830101 | 126 |
| 37 | 3300010375 | Ga0105239_10000157 | Ga0105239_1000015746 | 126 |
| 38 | 3300021384 | Ga0213876_10110484 | Ga0213876_101104842 | 126 |
| 39 | 3300025250 | Ga0209026_1001239 | Ga0209026_10012395 | 126 |
| 40 | 3300025903 | Ga0207680_10367383 | Ga0207680_103673832 | 126 |
| 41 | 3300025911 | Ga0207654_10747464 | Ga0207654_107474642 | 126 |
| 42 | 3300025913 | Ga0207695_10002132 | Ga0207695_1000213231 | 126 |
| 43 | 3300025921 | Ga0207652_10632540 | Ga0207652_106325402 | 126 |
| 44 | 3300025924 | Ga0207694_11755794 | Ga0207694_117557941 | 126 |
| 45 | 3300025961 | Ga0207712_10735471 | Ga0207712_107354712 | 126 |
| 46 | 3300025986 | Ga0207658_10000324 | Ga0207658_1000032449 | 126 |
| 47 | 3300026041 | Ga0207639_11541175 | Ga0207639_115411752 | 126 |
| 48 | 3300026088 | Ga0207641_10000728 | Ga0207641_1000072818 | 126 |
| 49 | 3300026121 | Ga0207683_11792899 | Ga0207683_117928991 | 126 |
| 50 | 3300028381 | Ga0268264_10000349 | Ga0268264_1000034913 | 126 |
| 51 | 3300031251 | Ga0265327_10004491 | Ga0265327_1000449112 | 126 |
| 52 | 3300039437 | Ga0436365_1412024 | Ga0436365_1412024_3050_3430 | 126 |
| 53 | 3300046616 | Ga0495668_0051589 | Ga0495668_0051589_445_843 | 126 |
| 54 | 3300049523 | Ga0501300_003486 | Ga0501300_003486_389_769 | 126 |
| 55 | 3300049679 | Ga0501249_000075 | Ga0501249_000075_9452_9832 | 126 |
| 56 | 3300049688 | Ga0501259_063199 | Ga0501259_063199_145_525 | 126 |
| 57 | 3300049852 | Ga0501220_07903 | Ga0501220_07903_33_413 | 126 |
| 58 | 3300050492 | nmdc:mga0yw44_500933_c1 | nmdc:mga0yw44_500933_c1_235_615 | 126 |
| 59 | 3300050496 | nmdc:mga07m45_266582_c1 | nmdc:mga07m45_266582_c1_237_617 | 126 |
| 60 | 3300053087 | Ga0500643_000220 | Ga0500643_000220_10513_10893 | 126 |
| 61 | 3300053087 | Ga0500643_031675 | Ga0500643_031675_260_640 | 126 |
| 62 | 3300053088 | Ga0500644_0009532 | Ga0500644_0009532_1220_1600 | 126 |
| 63 | 3300053108 | Ga0500562_002001 | Ga0500562_002001_3224_3604 | 126 |
| 64 | 3300053116 | Ga0500592_024167 | Ga0500592_024167_420_818 | 126 |
| 65 | 3300053136 | Ga0500559_0172464 | Ga0500559_0172464_411_791 | 126 |
| 66 | 3300053142 | Ga0500577_0026741 | Ga0500577_0026741_609_989 | 126 |
| 67 | 3300053153 | Ga0500616_0265402 | Ga0500616_0265402_62_442 | 126 |
| 68 | 3300003215 | JGI25153J46596_10043101 | JGI25153J46596_100431011 | 127 |
| 69 | 3300003322 | rootL2_10069773 | rootL2_100697738 | 127 |
| 70 | 3300003773 | Ga0055537_1000763 | Ga0055537_10007637 | 127 |
| 71 | 3300003775 | Ga0055524_1016817 | Ga0055524_10168173 | 127 |
| 72 | 3300003790 | Ga0055528_1012739 | Ga0055528_10127392 | 127 |
| 73 | 3300005327 | Ga0070658_11570647 | Ga0070658_115706471 | 127 |
| 74 | 3300005328 | Ga0070676_10000070 | Ga0070676_100000708 | 127 |
| 75 | 3300005334 | Ga0068869_100002874 | Ga0068869_1000028748 | 127 |
| 76 | 3300005335 | Ga0070666_10061183 | Ga0070666_100611833 | 127 |
| 77 | 3300005338 | Ga0068868_100000067 | Ga0068868_10000006721 | 127 |
| 78 | 3300005355 | Ga0070671_100148333 | Ga0070671_1001483333 | 127 |
| 79 | 3300005364 | Ga0070673_100000007 | Ga0070673_10000000734 | 127 |
| 80 | 3300005367 | Ga0070667_100008914 | Ga0070667_1000089147 | 127 |
| 81 | 3300005367 | Ga0070667_100070044 | Ga0070667_1000700444 | 127 |
| 82 | 3300005458 | Ga0070681_10045836 | Ga0070681_100458363 | 127 |
| 83 | 3300005459 | Ga0068867_100000010 | Ga0068867_10000001034 | 127 |
| 84 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003111 | 127 |
| 85 | 3300005543 | Ga0070672_100180644 | Ga0070672_1001806443 | 127 |
| 86 | 3300005548 | Ga0070665_100004370 | Ga0070665_1000043705 | 127 |
| 87 | 3300005563 | Ga0068855_100294616 | Ga0068855_1002946162 | 127 |
| 88 | 3300005578 | Ga0068854_100054022 | Ga0068854_1000540223 | 127 |
| 89 | 3300005614 | Ga0068856_100110322 | Ga0068856_1001103222 | 127 |
| 90 | 3300005618 | Ga0068864_100485169 | Ga0068864_1004851692 | 127 |
| 91 | 3300005718 | Ga0068866_10091479 | Ga0068866_100914792 | 127 |
| 92 | 3300005841 | Ga0068863_100024123 | Ga0068863_1000241233 | 127 |
| 93 | 3300005843 | Ga0068860_100049069 | Ga0068860_1000490693 | 127 |
| 94 | 3300005844 | Ga0068862_100016747 | Ga0068862_1000167477 | 127 |
| 95 | 3300006038 | Ga0075365_10010874 | Ga0075365_100108743 | 127 |
| 96 | 3300006038 | Ga0075365_10042866 | Ga0075365_100428663 | 127 |
| 97 | 3300006042 | Ga0075368_10009722 | Ga0075368_100097223 | 127 |
| 98 | 3300006042 | Ga0075368_10287691 | Ga0075368_102876911 | 127 |
| 99 | 3300006048 | Ga0075363_100032711 | Ga0075363_1000327113 | 127 |
| 100 | 3300006051 | Ga0075364_10008570 | Ga0075364_100085705 | 127 |
| 101 | 3300006177 | Ga0075362_10214989 | Ga0075362_102149892 | 127 |
| 102 | 3300006178 | Ga0075367_10220332 | Ga0075367_102203323 | 127 |
| 103 | 3300006186 | Ga0075369_10006856 | Ga0075369_100068564 | 127 |
| 104 | 3300006195 | Ga0075366_10221966 | Ga0075366_102219661 | 127 |
| 105 | 3300006353 | Ga0075370_10078721 | Ga0075370_100787213 | 127 |
| 106 | 3300006353 | Ga0075370_10078987 | Ga0075370_100789873 | 127 |
| 107 | 3300006881 | Ga0068865_100000008 | Ga0068865_100000008127 | 127 |
| 108 | 3300009093 | Ga0105240_10001551 | Ga0105240_100015519 | 127 |
| 109 | 3300009093 | Ga0105240_10046146 | Ga0105240_100461463 | 127 |
| 110 | 3300009098 | Ga0105245_10001358 | Ga0105245_1000135811 | 127 |
| 111 | 3300009148 | Ga0105243_10000080 | Ga0105243_1000008022 | 127 |
| 112 | 3300009176 | Ga0105242_10001111 | Ga0105242_100011113 | 127 |
| 113 | 3300009545 | Ga0105237_10077505 | Ga0105237_100775053 | 127 |
| 114 | 3300009545 | Ga0105237_11697177 | Ga0105237_116971772 | 127 |
| 115 | 3300009553 | Ga0105249_11047905 | Ga0105249_110479052 | 127 |
| 116 | 3300011119 | Ga0105246_10002730 | Ga0105246_100027303 | 127 |
| 117 | 3300013296 | Ga0157374_10002183 | Ga0157374_100021834 | 127 |
| 118 | 3300013297 | Ga0157378_10003897 | Ga0157378_100038978 | 127 |
| 119 | 3300013308 | Ga0157375_10003407 | Ga0157375_100034074 | 127 |
| 120 | 3300014745 | Ga0157377_10141795 | Ga0157377_101417953 | 127 |
| 121 | 3300014969 | Ga0157376_10000839 | Ga0157376_100008398 | 127 |
| 122 | 3300025246 | Ga0209646_1026005 | Ga0209646_10260052 | 127 |
| 123 | 3300025263 | Ga0209565_1000363 | Ga0209565_100036323 | 127 |
| 124 | 3300025273 | Ga0209673_1000458 | Ga0209673_10004589 | 127 |
| 125 | 3300025291 | Ga0209675_1012973 | Ga0209675_10129732 | 127 |
| 126 | 3300025294 | Ga0209025_1057187 | Ga0209025_10571872 | 127 |
| 127 | 3300025295 | Ga0209564_1009294 | Ga0209564_10092943 | 127 |
| 128 | 3300025297 | Ga0209758_1003233 | Ga0209758_10032334 | 127 |
| 129 | 3300025299 | Ga0209256_1001974 | Ga0209256_10019743 | 127 |
| 130 | 3300025299 | Ga0209256_1041840 | Ga0209256_10418402 | 127 |
| 131 | 3300025899 | Ga0207642_10160385 | Ga0207642_101603853 | 127 |
| 132 | 3300025901 | Ga0207688_10085464 | Ga0207688_100854643 | 127 |
| 133 | 3300025907 | Ga0207645_10002833 | Ga0207645_100028336 | 127 |
| 134 | 3300025912 | Ga0207707_10035298 | Ga0207707_100352983 | 127 |
| 135 | 3300025913 | Ga0207695_10003149 | Ga0207695_1000314918 | 127 |
| 136 | 3300025913 | Ga0207695_10048034 | Ga0207695_100480342 | 127 |
| 137 | 3300025914 | Ga0207671_10009701 | Ga0207671_100097012 | 127 |
| 138 | 3300025917 | Ga0207660_10000237 | Ga0207660_100002372 | 127 |
| 139 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004111 | 127 |
| 140 | 3300025927 | Ga0207687_10006894 | Ga0207687_100068945 | 127 |
| 141 | 3300025931 | Ga0207644_10014992 | Ga0207644_100149924 | 127 |
| 142 | 3300025931 | Ga0207644_10947162 | Ga0207644_109471622 | 127 |
| 143 | 3300025934 | Ga0207686_10001677 | Ga0207686_100016774 | 127 |
| 144 | 3300025935 | Ga0207709_10001026 | Ga0207709_1000102614 | 127 |
| 145 | 3300025938 | Ga0207704_10000013 | Ga0207704_10000013122 | 127 |
| 146 | 3300025940 | Ga0207691_10195629 | Ga0207691_101956293 | 127 |
| 147 | 3300025941 | Ga0207711_11091257 | Ga0207711_110912572 | 127 |
| 148 | 3300025942 | Ga0207689_10000114 | Ga0207689_1000011450 | 127 |
| 149 | 3300025949 | Ga0207667_10059551 | Ga0207667_100595512 | 127 |
| 150 | 3300025960 | Ga0207651_10000013 | Ga0207651_1000001334 | 127 |
| 151 | 3300025961 | Ga0207712_10135618 | Ga0207712_101356182 | 127 |
| 152 | 3300025972 | Ga0207668_10000010 | Ga0207668_10000010141 | 127 |
| 153 | 3300025981 | Ga0207640_10039932 | Ga0207640_100399323 | 127 |
| 154 | 3300025986 | Ga0207658_10002704 | Ga0207658_100027046 | 127 |
| 155 | 3300025986 | Ga0207658_10004212 | Ga0207658_100042124 | 127 |
| 156 | 3300026023 | Ga0207677_10000563 | Ga0207677_1000056310 | 127 |
| 157 | 3300026035 | Ga0207703_10705947 | Ga0207703_107059473 | 127 |
| 158 | 3300026078 | Ga0207702_10522300 | Ga0207702_105223002 | 127 |
| 159 | 3300026088 | Ga0207641_10036704 | Ga0207641_100367043 | 127 |
| 160 | 3300026089 | Ga0207648_10000025 | Ga0207648_1000002584 | 127 |
| 161 | 3300026116 | Ga0207674_10744226 | Ga0207674_107442262 | 127 |
| 162 | 3300027866 | Ga0209813_10001162 | Ga0209813_100011623 | 127 |
| 163 | 3300027866 | Ga0209813_10074446 | Ga0209813_100744461 | 127 |
| 164 | 3300028379 | Ga0268266_10003713 | Ga0268266_1000371311 | 127 |
| 165 | 3300028380 | Ga0268265_10004500 | Ga0268265_100045008 | 127 |
| 166 | 3300028381 | Ga0268264_10046404 | Ga0268264_100464043 | 127 |
| 167 | 3300031911 | Ga0307412_10003875 | Ga0307412_100038754 | 127 |
| 168 | 3300044735 | Ga0466968_0002188 | Ga0466968_0002188_1752_2135 | 127 |
| 169 | 3300044735 | Ga0466968_0113742 | Ga0466968_0113742_825_1208 | 127 |
| 170 | 3300044901 | Ga0466960_0126477 | Ga0466960_0126477_456_839 | 127 |
| 171 | 3300046460 | Ga0495638_0000199 | Ga0495638_0000199_29544_29927 | 127 |
| 172 | 3300046471 | Ga0495650_0032540 | Ga0495650_0032540_291_674 | 127 |
| 173 | 3300046471 | Ga0495650_0090113 | Ga0495650_0090113_561_944 | 127 |
| 174 | 3300046506 | Ga0495583_0000037 | Ga0495583_0000037_217273_217656 | 127 |
| 175 | 3300046507 | Ga0495606_0000598 | Ga0495606_0000598_12483_12866 | 127 |
| 176 | 3300046507 | Ga0495606_0043126 | Ga0495606_0043126_1560_1943 | 127 |
| 177 | 3300046512 | Ga0495610_0133450 | Ga0495610_0133450_33_416 | 127 |
| 178 | 3300046513 | Ga0495616_0000018 | Ga0495616_0000018_111903_112286 | 127 |
| 179 | 3300046520 | Ga0495637_0005376 | Ga0495637_0005376_5847_6266 | 127 |
| 180 | 3300046524 | Ga0495648_0000300 | Ga0495648_0000300_45502_45885 | 127 |
| 181 | 3300046616 | Ga0495668_0000039 | Ga0495668_0000039_114597_114980 | 127 |
| 182 | 3300046691 | Ga0495670_0634104 | Ga0495670_0634104_57_476 | 127 |
| 183 | 3300047446 | Ga0495679_005114 | Ga0495679_005114_102_485 | 127 |
| 184 | 3300047469 | Ga0495673_0000263 | Ga0495673_0000263_45653_46036 | 127 |
| 185 | 3300047469 | Ga0495673_0002653 | Ga0495673_0002653_321_704 | 127 |
| 186 | 3300047469 | Ga0495673_0039810 | Ga0495673_0039810_1354_1782 | 127 |
| 187 | 3300047472 | Ga0495686_0000055 | Ga0495686_0000055_79402_79830 | 127 |
| 188 | 3300047472 | Ga0495686_0000070 | Ga0495686_0000070_49177_49560 | 127 |
| 189 | 3300047472 | Ga0495686_0006151 | Ga0495686_0006151_2031_2414 | 127 |
| 190 | 3300047472 | Ga0495686_0081409 | Ga0495686_0081409_405_788 | 127 |
| 191 | 3300048903 | Ga0496100_1371060 | Ga0496100_1371060_60_443 | 127 |
| 192 | 3300048904 | Ga0496101_0383279 | Ga0496101_0383279_464_847 | 127 |
| 193 | 3300048905 | Ga0496102_0519831 | Ga0496102_0519831_47_430 | 127 |
| 194 | 3300048907 | Ga0496104_0029100 | Ga0496104_0029100_3910_4293 | 127 |
| 195 | 3300048908 | Ga0496105_0326628 | Ga0496105_0326628_439_822 | 127 |
| 196 | 3300048910 | Ga0496107_0000019 | Ga0496107_0000019_51908_52351 | 127 |
| 197 | 3300048910 | Ga0496107_0053799 | Ga0496107_0053799_336_719 | 127 |
| 198 | 3300048914 | Ga0496111_0364332 | Ga0496111_0364332_384_767 | 127 |
| 199 | 3300048916 | Ga0496113_1048772 | Ga0496113_1048772_198_626 | 127 |
| 200 | 3300048918 | Ga0496115_0000333 | Ga0496115_0000333_29611_29994 | 127 |
| 201 | 3300048918 | Ga0496115_0018597 | Ga0496115_0018597_4341_4724 | 127 |
| 202 | 3300048918 | Ga0496115_1122432 | Ga0496115_1122432_114_557 | 127 |
| 203 | 3300048919 | Ga0496116_0052601 | Ga0496116_0052601_255_638 | 127 |
| 204 | 3300048920 | Ga0496117_0013229 | Ga0496117_0013229_2046_2429 | 127 |
| 205 | 3300048920 | Ga0496117_0055315 | Ga0496117_0055315_884_1267 | 127 |
| 206 | 3300048921 | Ga0496118_0034626 | Ga0496118_0034626_316_699 | 127 |
| 207 | 3300048921 | Ga0496118_0049982 | Ga0496118_0049982_142_525 | 127 |
| 208 | 3300048922 | Ga0496119_0083767 | Ga0496119_0083767_1094_1477 | 127 |
| 209 | 3300048924 | Ga0496121_0000085 | Ga0496121_0000085_83715_84098 | 127 |
| 210 | 3300048924 | Ga0496121_0006189 | Ga0496121_0006189_6669_7112 | 127 |
| 211 | 3300048924 | Ga0496121_0032805 | Ga0496121_0032805_2574_2957 | 127 |
| 212 | 3300048924 | Ga0496121_0165999 | Ga0496121_0165999_342_725 | 127 |
| 213 | 3300048925 | Ga0496122_0000083 | Ga0496122_0000083_91213_91665 | 127 |
| 214 | 3300048925 | Ga0496122_0042631 | Ga0496122_0042631_1179_1562 | 127 |
| 215 | 3300048925 | Ga0496122_0408361 | Ga0496122_0408361_253_636 | 127 |
| 216 | 3300048925 | Ga0496122_0428247 | Ga0496122_0428247_17_400 | 127 |
| 217 | 3300048926 | Ga0496123_0000097 | Ga0496123_0000097_5406_5858 | 127 |
| 218 | 3300048927 | Ga0496124_0005657 | Ga0496124_0005657_10411_10794 | 127 |
| 219 | 3300048927 | Ga0496124_0304470 | Ga0496124_0304470_434_817 | 127 |
| 220 | 3300048928 | Ga0496125_0142933 | Ga0496125_0142933_302_685 | 127 |
| 221 | 3300048928 | Ga0496125_0310907 | Ga0496125_0310907_216_644 | 127 |
| 222 | 3300048929 | Ga0496126_0001829 | Ga0496126_0001829_19980_20363 | 127 |
| 223 | 3300048929 | Ga0496126_0041773 | Ga0496126_0041773_2168_2620 | 127 |
| 224 | 3300049671 | Ga0501238_000393 | Ga0501238_000393_4262_4645 | 127 |
| 225 | 3300050491 | nmdc:mga00v17_26250_c1 | nmdc:mga00v17_26250_c1_222_605 | 127 |
| 226 | 3300050492 | nmdc:mga0yw44_111172_c1 | nmdc:mga0yw44_111172_c1_843_1226 | 127 |
| 227 | 3300050493 | nmdc:mga0k408_144149_c1 | nmdc:mga0k408_144149_c1_531_914 | 127 |
| 228 | 3300050494 | nmdc:mga06z11_52141_c1 | nmdc:mga06z11_52141_c1_843_1226 | 127 |
| 229 | 3300050495 | nmdc:mga04h51_4489_c1 | nmdc:mga04h51_4489_c1_983_1366 | 127 |
| 230 | 3300050496 | nmdc:mga07m45_211573_c1 | nmdc:mga07m45_211573_c1_604_990 | 127 |
| 231 | 3300050496 | nmdc:mga07m45_46281_c1 | nmdc:mga07m45_46281_c1_843_1226 | 127 |
| 232 | 3300050496 | nmdc:mga07m45_787912_c1 | nmdc:mga07m45_787912_c1_117_500 | 127 |
| 233 | 3300050496 | nmdc:mga07m45_81534_c1 | nmdc:mga07m45_81534_c1_689_1072 | 127 |
| 234 | 3300050516 | nmdc:mga0sz30_4451_c1 | nmdc:mga0sz30_4451_c1_4321_4704 | 127 |
| 235 | 3300053086 | Ga0500578_0032076 | Ga0500578_0032076_2057_2440 | 127 |
| 236 | 3300053088 | Ga0500644_0000031 | Ga0500644_0000031_57501_57884 | 127 |
| 237 | 3300053096 | Ga0500641_0014283 | Ga0500641_0014283_274_657 | 127 |
| 238 | 3300053102 | Ga0500554_000580 | Ga0500554_000580_6790_7173 | 127 |
| 239 | 3300053104 | Ga0500556_0000186 | Ga0500556_0000186_34584_35003 | 127 |
| 240 | 3300053122 | Ga0500608_000155 | Ga0500608_000155_20691_21074 | 127 |
| 241 | 3300053122 | Ga0500608_079654 | Ga0500608_079654_745_1128 | 127 |
| 242 | 3300053125 | Ga0500618_000024 | Ga0500618_000024_99439_99822 | 127 |
| 243 | 3300053138 | Ga0500564_000141 | Ga0500564_000141_13530_13913 | 127 |
| 244 | 3300053139 | Ga0500568_0044235 | Ga0500568_0044235_1251_1634 | 127 |
| 245 | 3300053151 | Ga0500604_0157828 | Ga0500604_0157828_139_522 | 127 |
| 246 | 3300053153 | Ga0500616_0014866 | Ga0500616_0014866_1314_1697 | 127 |
| 247 | 3300053156 | Ga0500622_0005847 | Ga0500622_0005847_6481_6864 | 127 |
| 248 | 3300053156 | Ga0500622_0031798 | Ga0500622_0031798_1207_1590 | 127 |
| 249 | 3300053158 | Ga0500627_0063916 | Ga0500627_0063916_664_1047 | 127 |
| 250 | 3300053730 | Ga0500645_000149 | Ga0500645_000149_11857_12276 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m8o-assembly1.cif.gz_A | crystal structure of the receiver domain of lytr from staphylococcus aureus | 0.9263 | 3 | 118 |
| 3hv2-assembly1.cif.gz_B | crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 | 0.9204 | 1 | 124 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9177 | 3 | 118 |
| 2qzj-assembly5.cif.gz_E | crystal structure of a two-component response regulator from clostridium difficile | 0.914 | 3 | 122 |
| 1udr-assembly1.cif.gz_C | chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4) | 0.9111 | 3 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9Q1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9381 | 5 | 81 | 3.40.50.2300 |
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9347 | 3 | 84 | 3.40.50.2300 |
| 6m8oA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9263 | 3 | 118 | 3.40.50.2300 |
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9236 | 3 | 84 | 3.40.50.2300 |
| 3hv2B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9204 | 1 | 124 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U8WP21-F1-model_v4 | Response regulator | 0.9864 | 1 | 127 |
GO:0000160
|
| AF-A0A2V4W669-F1-model_v4 | deleted | 0.9846 | 1 | 127 |
|
| AF-A0A2P7R055-F1-model_v4 | Response regulator | 0.9806 | 1 | 127 |
GO:0000160
|
| AF-A0A1Y5EDY5-F1-model_v4 | Response regulatory domain-containing protein | 0.9795 | 1 | 121 |
GO:0000160
|
| AF-A0A1Y5EHQ1-F1-model_v4 | Response regulatory domain-containing protein | 0.9794 | 1 | 115 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar