F361315

General Info

Members Datasets Scaffolds Average Seq Length
250 183 243 128

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100141282|Ga0070670_1001412823
Length 126
Sequence VTVKVLIVDDSKLARIVAAKALAELQPDWTKVEAGSAAHAHELLDSGEVVDLALVDFNMTVKDGLEFAGDLRAAHPTMPIAIITANIQDEVIARARAIDASFVPKPVTAEALQGFISGAALRLRKS

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
5 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
6 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
152 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
183 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.4
Nodule 0.4
Rhizoplane 5.2
Rhizosphere 56
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10043101 3300003215 Bacteria 1370
2 rootH2_10338698 3300003320 Bacteria 1126
3 rootL2_10069773 3300003322 Bacteria 6790
4 Ga0055537_1000763 3300003773 Bacteria 16362
5 Ga0055524_1016817 3300003775 Bacteria 2605
6 Ga0055528_1012739 3300003790 Bacteria 3244
7 Ga0070658_11570647 3300005327 Unclassified 570
8 Ga0070676_10000070 3300005328 Bacteria 34585
9 Ga0070670_100141282 3300005331 Bacteria 2082
10 Ga0068869_100002874 3300005334 Bacteria 10455
11 Ga0070666_10061183 3300005335 Bacteria 2549
12 Ga0070666_10492234 3300005335 Unclassified 888
13 Ga0070682_100061807 3300005337 Bacteria 2371
14 Ga0068868_100000067 3300005338 Bacteria 59782
15 Ga0070671_100148333 3300005355 Bacteria 1980
16 Ga0070673_100000007 3300005364 Bacteria 177157
17 Ga0070667_100000760 3300005367 Bacteria 30664
18 Ga0070667_100008914 3300005367 Bacteria 8303
19 Ga0070667_100070044 3300005367 Bacteria 2985
20 Ga0070678_102181111 3300005456 Bacteria 525
21 Ga0070681_10045836 3300005458 Bacteria 4373
22 Ga0070681_11128682 3300005458 Bacteria 705
23 Ga0068867_100000010 3300005459 Bacteria 129593
24 Ga0070679_100000003 3300005530 Bacteria 307836
25 Ga0070679_100782340 3300005530 Bacteria 897
26 Ga0070672_100180644 3300005543 Bacteria 1758
27 Ga0070665_100004370 3300005548 Bacteria 14862
28 Ga0070665_100939334 3300005548 Bacteria 877
29 Ga0068855_100294616 3300005563 Bacteria 1798
30 Ga0068854_100054022 3300005578 Bacteria 2887
31 Ga0068856_100110322 3300005614 Bacteria 2748
32 Ga0068852_102459416 3300005616 Bacteria 541
33 Ga0068864_100001214 3300005618 Bacteria 21408
34 Ga0068864_100485169 3300005618 Unclassified 1187
35 Ga0068866_10091479 3300005718 Bacteria 1658
36 Ga0068863_100000635 3300005841 Bacteria 35541
37 Ga0068863_100003075 3300005841 Bacteria 16488
38 Ga0068863_100024123 3300005841 Bacteria 5803
39 Ga0068858_100557652 3300005842 Bacteria 1109
40 Ga0068860_100000329 3300005843 Bacteria 64404
41 Ga0068860_100049069 3300005843 Bacteria 4023
42 Ga0068862_100016747 3300005844 Bacteria 6102
43 Ga0075365_10010874 3300006038 Bacteria 5327
44 Ga0075365_10042866 3300006038 Unclassified 2960
45 Ga0075365_10540343 3300006038 Unclassified 824
46 Ga0075368_10009722 3300006042 Unclassified 3464
47 Ga0075368_10287691 3300006042 Unclassified 707
48 Ga0075363_100032711 3300006048 Bacteria 2703
49 Ga0075364_10008570 3300006051 Bacteria 6117
50 Ga0075362_10214989 3300006177 Bacteria 938
51 Ga0075367_10220332 3300006178 Bacteria 1187
52 Ga0075369_10006856 3300006186 Bacteria 4323
53 Ga0075366_10221966 3300006195 Bacteria 1151
54 Ga0075366_10285982 3300006195 Bacteria 1008
55 Ga0075370_10078721 3300006353 Unclassified 1893
56 Ga0075370_10078987 3300006353 Bacteria 1890
57 Ga0075370_10229144 3300006353 Bacteria 1099
58 Ga0068871_101417923 3300006358 Unclassified 655
59 Ga0068865_100000008 3300006881 Bacteria 177158
60 Ga0068865_101016760 3300006881 Bacteria 726
61 Ga0105240_10001551 3300009093 Bacteria 38976
62 Ga0105240_10046146 3300009093 Bacteria 5522
63 Ga0105245_10001358 3300009098 Bacteria 22138
64 Ga0105243_10000080 3300009148 Bacteria 109765
65 Ga0105241_10743059 3300009174 Bacteria 899
66 Ga0105242_10001111 3300009176 Bacteria 21201
67 Ga0105237_10077505 3300009545 Bacteria 3314
68 Ga0105237_11697177 3300009545 Bacteria 639
69 Ga0105238_10191035 3300009551 Bacteria 2024
70 Ga0105238_12783010 3300009551 Bacteria 526
71 Ga0105249_11047905 3300009553 Bacteria 885
72 Ga0105239_10000157 3300010375 Bacteria 98327
73 Ga0105246_10002730 3300011119 Bacteria 10678
74 Ga0157374_10002183 3300013296 Bacteria 16487
75 Ga0157378_10003897 3300013297 Bacteria 13216
76 Ga0157375_10003407 3300013308 Bacteria 13777
77 Ga0157377_10141795 3300014745 Bacteria 1477
78 Ga0157376_10000839 3300014969 Bacteria 20143
79 Ga0213876_10110484 3300021384 Bacteria 1459
80 Ga0209646_1026005 3300025246 Bacteria 814
81 Ga0209026_1001239 3300025250 Bacteria 11679
82 Ga0209565_1000363 3300025263 Bacteria 38972
83 Ga0209673_1000458 3300025273 Bacteria 68889
84 Ga0209675_1012973 3300025291 Bacteria 2643
85 Ga0209025_1057187 3300025294 Bacteria 1493
86 Ga0209564_1009294 3300025295 Bacteria 4702
87 Ga0209758_1003233 3300025297 Bacteria 15141
88 Ga0209256_1001974 3300025299 Bacteria 18472
89 Ga0209256_1041840 3300025299 Bacteria 1161
90 Ga0207642_10160385 3300025899 Bacteria 1207
91 Ga0207688_10085464 3300025901 Bacteria 1807
92 Ga0207680_10367383 3300025903 Unclassified 1012
93 Ga0207645_10002833 3300025907 Bacteria 13456
94 Ga0207654_10747464 3300025911 Bacteria 704
95 Ga0207707_10035298 3300025912 Bacteria 4373
96 Ga0207695_10002132 3300025913 Bacteria 29982
97 Ga0207695_10003149 3300025913 Bacteria 23550
98 Ga0207695_10048034 3300025913 Bacteria 4510
99 Ga0207671_10009701 3300025914 Bacteria 8019
100 Ga0207660_10000237 3300025917 Bacteria 35635
101 Ga0207652_10000004 3300025921 Bacteria 436303
102 Ga0207652_10632540 3300025921 Bacteria 958
103 Ga0207694_11755794 3300025924 Bacteria 522
104 Ga0207650_10479002 3300025925 Bacteria 1038
105 Ga0207687_10006894 3300025927 Bacteria 7485
106 Ga0207644_10014992 3300025931 Bacteria 5198
107 Ga0207644_10947162 3300025931 Bacteria 722
108 Ga0207686_10001677 3300025934 Bacteria 12339
109 Ga0207709_10001026 3300025935 Bacteria 20660
110 Ga0207704_10000013 3300025938 Bacteria 170478
111 Ga0207691_10195629 3300025940 Bacteria 1762
112 Ga0207711_11091257 3300025941 Bacteria 739
113 Ga0207689_10000114 3300025942 Bacteria 66389
114 Ga0207667_10059551 3300025949 Bacteria 3999
115 Ga0207651_10000013 3300025960 Bacteria 177573
116 Ga0207712_10135618 3300025961 Bacteria 1881
117 Ga0207712_10735471 3300025961 Unclassified 863
118 Ga0207668_10000010 3300025972 Bacteria 185249
119 Ga0207640_10039932 3300025981 Bacteria 2974
120 Ga0207658_10000324 3300025986 Bacteria 48133
121 Ga0207658_10002704 3300025986 Bacteria 12793
122 Ga0207658_10004212 3300025986 Bacteria 10020
123 Ga0207677_10000563 3300026023 Bacteria 23428
124 Ga0207703_10705947 3300026035 Unclassified 959
125 Ga0207639_11541175 3300026041 Bacteria 624
126 Ga0207702_10522300 3300026078 Unclassified 1159
127 Ga0207641_10000242 3300026088 Bacteria 70950
128 Ga0207641_10000728 3300026088 Bacteria 35344
129 Ga0207641_10036704 3300026088 Bacteria 4091
130 Ga0207648_10000025 3300026089 Bacteria 131593
131 Ga0207676_10001031 3300026095 Bacteria 21326
132 Ga0207674_10744226 3300026116 Bacteria 946
133 Ga0207683_11792899 3300026121 Bacteria 563
134 Ga0209813_10001162 3300027866 Bacteria 5882
135 Ga0209813_10074446 3300027866 Bacteria 1110
136 Ga0268266_10003713 3300028379 Bacteria 15025
137 Ga0268266_11040271 3300028379 Bacteria 792
138 Ga0268265_10004500 3300028380 Bacteria 9648
139 Ga0268264_10000349 3300028381 Bacteria 70208
140 Ga0268264_10046404 3300028381 Bacteria 3608
141 Ga0265327_10004491 3300031251 Bacteria 12329
142 Ga0307412_10003875 3300031911 Bacteria 8325
143 Ga0436365_1412024 3300039437 Bacteria 4889
144 Ga0466968_0002188 3300044735 Bacteria 7136
145 Ga0466968_0113742 3300044735 Bacteria 1219
146 Ga0466960_0126477 3300044901 Bacteria 1344
147 Ga0495638_0000199 3300046460 Bacteria 85791
148 Ga0495650_0032540 3300046471 Bacteria 2331
149 Ga0495650_0090113 3300046471 Bacteria 1168
150 Ga0495583_0000037 3300046506 Bacteria 244437
151 Ga0495606_0000598 3300046507 Bacteria 57087
152 Ga0495606_0043126 3300046507 Bacteria 3011
153 Ga0495610_0133450 3300046512 Bacteria 1076
154 Ga0495616_0000018 3300046513 Bacteria 167281
155 Ga0495637_0005376 3300046520 Bacteria 6541
156 Ga0495648_0000300 3300046524 Bacteria 54935
157 Ga0495668_0000039 3300046616 Bacteria 231402
158 Ga0495668_0051589 3300046616 Bacteria 2277
159 Ga0495670_0634104 3300046691 Bacteria 582
160 Ga0495679_005114 3300047446 Bacteria 5883
161 Ga0495673_0000263 3300047469 Bacteria 73113
162 Ga0495673_0002653 3300047469 Bacteria 12370
163 Ga0495673_0039810 3300047469 Bacteria 2130
164 Ga0495686_0000055 3300047472 Bacteria 255566
165 Ga0495686_0000070 3300047472 Bacteria 216642
166 Ga0495686_0006151 3300047472 Bacteria 9281
167 Ga0495686_0081409 3300047472 Bacteria 1977
168 Ga0496100_1371060 3300048903 Bacteria 558
169 Ga0496101_0383279 3300048904 Bacteria 1106
170 Ga0496102_0519831 3300048905 Bacteria 1113
171 Ga0496104_0029100 3300048907 Bacteria 5123
172 Ga0496105_0326628 3300048908 Bacteria 1228
173 Ga0496107_0000019 3300048910 Bacteria 150224
174 Ga0496107_0053799 3300048910 Bacteria 2904
175 Ga0496111_0364332 3300048914 Bacteria 1070
176 Ga0496113_1048772 3300048916 Bacteria 641
177 Ga0496115_0000333 3300048918 Bacteria 40158
178 Ga0496115_0018597 3300048918 Bacteria 5339
179 Ga0496115_1122432 3300048918 Bacteria 595
180 Ga0496116_0052601 3300048919 Bacteria 2697
181 Ga0496117_0013229 3300048920 Bacteria 7212
182 Ga0496117_0055315 3300048920 Bacteria 2773
183 Ga0496118_0034626 3300048921 Bacteria 4116
184 Ga0496118_0049982 3300048921 Bacteria 3214
185 Ga0496119_0083767 3300048922 Bacteria 1830
186 Ga0496121_0000085 3300048924 Bacteria 223810
187 Ga0496121_0006189 3300048924 Bacteria 15004
188 Ga0496121_0032805 3300048924 Bacteria 4712
189 Ga0496121_0165999 3300048924 Bacteria 1609
190 Ga0496122_0000083 3300048925 Bacteria 208744
191 Ga0496122_0042631 3300048925 Bacteria 3567
192 Ga0496122_0408361 3300048925 Bacteria 687
193 Ga0496122_0428247 3300048925 Bacteria 663
194 Ga0496123_0000097 3300048926 Bacteria 173894
195 Ga0496124_0005657 3300048927 Bacteria 13957
196 Ga0496124_0304470 3300048927 Bacteria 1149
197 Ga0496125_0142933 3300048928 Bacteria 1660
198 Ga0496125_0310907 3300048928 Bacteria 960
199 Ga0496126_0001829 3300048929 Bacteria 31042
200 Ga0496126_0041773 3300048929 Bacteria 4241
201 Ga0501300_003486 3300049523 Bacteria 2351
202 Ga0501238_000393 3300049671 Bacteria 5389
203 Ga0501249_000075 3300049679 Bacteria 34091
204 Ga0501259_063199 3300049688 Bacteria 778
205 Ga0501044_0170271 3300049823 Bacteria 2150
206 Ga0501220_07903 3300049852 Bacteria 552
207 nmdc:mga00v17_26250_c1 3300050491 Bacteria 3393
208 nmdc:mga0yw44_111172_c1 3300050492 Unclassified 1756
209 nmdc:mga0yw44_500933_c1 3300050492 Unclassified 824
210 nmdc:mga0k408_144149_c1 3300050493 Unclassified 1418
211 nmdc:mga0k408_235323_c1 3300050493 Bacteria 1093
212 nmdc:mga06z11_52141_c1 3300050494 Unclassified 2098
213 nmdc:mga04h51_4489_c1 3300050495 Unclassified 3478
214 nmdc:mga07m45_211573_c1 3300050496 Bacteria 1128
215 nmdc:mga07m45_266582_c1 3300050496 Bacteria 996
216 nmdc:mga07m45_46281_c1 3300050496 Unclassified 2444
217 nmdc:mga07m45_787912_c1 3300050496 Unclassified 545
218 nmdc:mga07m45_81534_c1 3300050496 Bacteria 1847
219 nmdc:mga0sz30_4451_c1 3300050516 Bacteria 5064
220 Ga0500578_0032076 3300053086 Bacteria 3378
221 Ga0500643_000220 3300053087 Bacteria 53142
222 Ga0500643_031675 3300053087 Bacteria 1610
223 Ga0500644_0000031 3300053088 Bacteria 86737
224 Ga0500644_0009532 3300053088 Bacteria 2601
225 Ga0500641_0014283 3300053096 Bacteria 2929
226 Ga0500554_000580 3300053102 Bacteria 7465
227 Ga0500556_0000186 3300053104 Bacteria 50723
228 Ga0500562_002001 3300053108 Bacteria 5108
229 Ga0500592_024167 3300053116 Bacteria 979
230 Ga0500608_000155 3300053122 Bacteria 28458
231 Ga0500608_079654 3300053122 Bacteria 1547
232 Ga0500618_000024 3300053125 Bacteria 152149
233 Ga0500559_0172464 3300053136 Unclassified 1017
234 Ga0500564_000141 3300053138 Bacteria 18461
235 Ga0500568_0044235 3300053139 Bacteria 1777
236 Ga0500577_0026741 3300053142 Bacteria 1968
237 Ga0500604_0157828 3300053151 Bacteria 772
238 Ga0500616_0014866 3300053153 Bacteria 4461
239 Ga0500616_0265402 3300053153 Bacteria 727
240 Ga0500622_0005847 3300053156 Bacteria 7280
241 Ga0500622_0031798 3300053156 Bacteria 2769
242 Ga0500627_0063916 3300053158 Bacteria 1622
243 Ga0500645_000149 3300053730 Bacteria 54622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_235323_c1 nmdc:mga0k408_235323_c1_398_766 122
2 iso_pu_bacteria 2857504554 2857509187 122
3 iso_pu_bacteria 2582581279 2585148387 123
4 iso_pu_bacteria 2599185359 2600225267 123
5 iso_pu_bacteria 2751185897 2753767276 123
6 iso_pu_bacteria 2928526807 2928529270 123
7 iso_pu_bacteria 2929199973 2929206522 123
8 iso_pu_bacteria 643348564 643598539 123
9 3300005331 Ga0070670_100141282 Ga0070670_1001412823 125
10 3300005337 Ga0070682_100061807 Ga0070682_1000618073 125
11 3300005548 Ga0070665_100939334 Ga0070665_1009393342 125
12 3300005618 Ga0068864_100001214 Ga0068864_10000121419 125
13 3300005841 Ga0068863_100000635 Ga0068863_10000063515 125
14 3300025925 Ga0207650_10479002 Ga0207650_104790022 125
15 3300026088 Ga0207641_10000242 Ga0207641_1000024238 125
16 3300026095 Ga0207676_10001031 Ga0207676_1000103118 125
17 3300028379 Ga0268266_11040271 Ga0268266_110402712 125
18 3300049823 Ga0501044_0170271 Ga0501044_0170271_132_509 125
19 3300003320 rootH2_10338698 rootH2_103386982 126
20 3300005335 Ga0070666_10492234 Ga0070666_104922342 126
21 3300005367 Ga0070667_100000760 Ga0070667_10000076023 126
22 3300005456 Ga0070678_102181111 Ga0070678_1021811111 126
23 3300005458 Ga0070681_11128682 Ga0070681_111286821 126
24 3300005530 Ga0070679_100782340 Ga0070679_1007823401 126
25 3300005616 Ga0068852_102459416 Ga0068852_1024594161 126
26 3300005841 Ga0068863_100003075 Ga0068863_1000030753 126
27 3300005842 Ga0068858_100557652 Ga0068858_1005576522 126
28 3300005843 Ga0068860_100000329 Ga0068860_10000032912 126
29 3300006038 Ga0075365_10540343 Ga0075365_105403432 126
30 3300006195 Ga0075366_10285982 Ga0075366_102859822 126
31 3300006353 Ga0075370_10229144 Ga0075370_102291442 126
32 3300006358 Ga0068871_101417923 Ga0068871_1014179232 126
33 3300006881 Ga0068865_101016760 Ga0068865_1010167602 126
34 3300009174 Ga0105241_10743059 Ga0105241_107430591 126
35 3300009551 Ga0105238_10191035 Ga0105238_101910353 126
36 3300009551 Ga0105238_12783010 Ga0105238_127830101 126
37 3300010375 Ga0105239_10000157 Ga0105239_1000015746 126
38 3300021384 Ga0213876_10110484 Ga0213876_101104842 126
39 3300025250 Ga0209026_1001239 Ga0209026_10012395 126
40 3300025903 Ga0207680_10367383 Ga0207680_103673832 126
41 3300025911 Ga0207654_10747464 Ga0207654_107474642 126
42 3300025913 Ga0207695_10002132 Ga0207695_1000213231 126
43 3300025921 Ga0207652_10632540 Ga0207652_106325402 126
44 3300025924 Ga0207694_11755794 Ga0207694_117557941 126
45 3300025961 Ga0207712_10735471 Ga0207712_107354712 126
46 3300025986 Ga0207658_10000324 Ga0207658_1000032449 126
47 3300026041 Ga0207639_11541175 Ga0207639_115411752 126
48 3300026088 Ga0207641_10000728 Ga0207641_1000072818 126
49 3300026121 Ga0207683_11792899 Ga0207683_117928991 126
50 3300028381 Ga0268264_10000349 Ga0268264_1000034913 126
51 3300031251 Ga0265327_10004491 Ga0265327_1000449112 126
52 3300039437 Ga0436365_1412024 Ga0436365_1412024_3050_3430 126
53 3300046616 Ga0495668_0051589 Ga0495668_0051589_445_843 126
54 3300049523 Ga0501300_003486 Ga0501300_003486_389_769 126
55 3300049679 Ga0501249_000075 Ga0501249_000075_9452_9832 126
56 3300049688 Ga0501259_063199 Ga0501259_063199_145_525 126
57 3300049852 Ga0501220_07903 Ga0501220_07903_33_413 126
58 3300050492 nmdc:mga0yw44_500933_c1 nmdc:mga0yw44_500933_c1_235_615 126
59 3300050496 nmdc:mga07m45_266582_c1 nmdc:mga07m45_266582_c1_237_617 126
60 3300053087 Ga0500643_000220 Ga0500643_000220_10513_10893 126
61 3300053087 Ga0500643_031675 Ga0500643_031675_260_640 126
62 3300053088 Ga0500644_0009532 Ga0500644_0009532_1220_1600 126
63 3300053108 Ga0500562_002001 Ga0500562_002001_3224_3604 126
64 3300053116 Ga0500592_024167 Ga0500592_024167_420_818 126
65 3300053136 Ga0500559_0172464 Ga0500559_0172464_411_791 126
66 3300053142 Ga0500577_0026741 Ga0500577_0026741_609_989 126
67 3300053153 Ga0500616_0265402 Ga0500616_0265402_62_442 126
68 3300003215 JGI25153J46596_10043101 JGI25153J46596_100431011 127
69 3300003322 rootL2_10069773 rootL2_100697738 127
70 3300003773 Ga0055537_1000763 Ga0055537_10007637 127
71 3300003775 Ga0055524_1016817 Ga0055524_10168173 127
72 3300003790 Ga0055528_1012739 Ga0055528_10127392 127
73 3300005327 Ga0070658_11570647 Ga0070658_115706471 127
74 3300005328 Ga0070676_10000070 Ga0070676_100000708 127
75 3300005334 Ga0068869_100002874 Ga0068869_1000028748 127
76 3300005335 Ga0070666_10061183 Ga0070666_100611833 127
77 3300005338 Ga0068868_100000067 Ga0068868_10000006721 127
78 3300005355 Ga0070671_100148333 Ga0070671_1001483333 127
79 3300005364 Ga0070673_100000007 Ga0070673_10000000734 127
80 3300005367 Ga0070667_100008914 Ga0070667_1000089147 127
81 3300005367 Ga0070667_100070044 Ga0070667_1000700444 127
82 3300005458 Ga0070681_10045836 Ga0070681_100458363 127
83 3300005459 Ga0068867_100000010 Ga0068867_10000001034 127
84 3300005530 Ga0070679_100000003 Ga0070679_100000003111 127
85 3300005543 Ga0070672_100180644 Ga0070672_1001806443 127
86 3300005548 Ga0070665_100004370 Ga0070665_1000043705 127
87 3300005563 Ga0068855_100294616 Ga0068855_1002946162 127
88 3300005578 Ga0068854_100054022 Ga0068854_1000540223 127
89 3300005614 Ga0068856_100110322 Ga0068856_1001103222 127
90 3300005618 Ga0068864_100485169 Ga0068864_1004851692 127
91 3300005718 Ga0068866_10091479 Ga0068866_100914792 127
92 3300005841 Ga0068863_100024123 Ga0068863_1000241233 127
93 3300005843 Ga0068860_100049069 Ga0068860_1000490693 127
94 3300005844 Ga0068862_100016747 Ga0068862_1000167477 127
95 3300006038 Ga0075365_10010874 Ga0075365_100108743 127
96 3300006038 Ga0075365_10042866 Ga0075365_100428663 127
97 3300006042 Ga0075368_10009722 Ga0075368_100097223 127
98 3300006042 Ga0075368_10287691 Ga0075368_102876911 127
99 3300006048 Ga0075363_100032711 Ga0075363_1000327113 127
100 3300006051 Ga0075364_10008570 Ga0075364_100085705 127
101 3300006177 Ga0075362_10214989 Ga0075362_102149892 127
102 3300006178 Ga0075367_10220332 Ga0075367_102203323 127
103 3300006186 Ga0075369_10006856 Ga0075369_100068564 127
104 3300006195 Ga0075366_10221966 Ga0075366_102219661 127
105 3300006353 Ga0075370_10078721 Ga0075370_100787213 127
106 3300006353 Ga0075370_10078987 Ga0075370_100789873 127
107 3300006881 Ga0068865_100000008 Ga0068865_100000008127 127
108 3300009093 Ga0105240_10001551 Ga0105240_100015519 127
109 3300009093 Ga0105240_10046146 Ga0105240_100461463 127
110 3300009098 Ga0105245_10001358 Ga0105245_1000135811 127
111 3300009148 Ga0105243_10000080 Ga0105243_1000008022 127
112 3300009176 Ga0105242_10001111 Ga0105242_100011113 127
113 3300009545 Ga0105237_10077505 Ga0105237_100775053 127
114 3300009545 Ga0105237_11697177 Ga0105237_116971772 127
115 3300009553 Ga0105249_11047905 Ga0105249_110479052 127
116 3300011119 Ga0105246_10002730 Ga0105246_100027303 127
117 3300013296 Ga0157374_10002183 Ga0157374_100021834 127
118 3300013297 Ga0157378_10003897 Ga0157378_100038978 127
119 3300013308 Ga0157375_10003407 Ga0157375_100034074 127
120 3300014745 Ga0157377_10141795 Ga0157377_101417953 127
121 3300014969 Ga0157376_10000839 Ga0157376_100008398 127
122 3300025246 Ga0209646_1026005 Ga0209646_10260052 127
123 3300025263 Ga0209565_1000363 Ga0209565_100036323 127
124 3300025273 Ga0209673_1000458 Ga0209673_10004589 127
125 3300025291 Ga0209675_1012973 Ga0209675_10129732 127
126 3300025294 Ga0209025_1057187 Ga0209025_10571872 127
127 3300025295 Ga0209564_1009294 Ga0209564_10092943 127
128 3300025297 Ga0209758_1003233 Ga0209758_10032334 127
129 3300025299 Ga0209256_1001974 Ga0209256_10019743 127
130 3300025299 Ga0209256_1041840 Ga0209256_10418402 127
131 3300025899 Ga0207642_10160385 Ga0207642_101603853 127
132 3300025901 Ga0207688_10085464 Ga0207688_100854643 127
133 3300025907 Ga0207645_10002833 Ga0207645_100028336 127
134 3300025912 Ga0207707_10035298 Ga0207707_100352983 127
135 3300025913 Ga0207695_10003149 Ga0207695_1000314918 127
136 3300025913 Ga0207695_10048034 Ga0207695_100480342 127
137 3300025914 Ga0207671_10009701 Ga0207671_100097012 127
138 3300025917 Ga0207660_10000237 Ga0207660_100002372 127
139 3300025921 Ga0207652_10000004 Ga0207652_10000004111 127
140 3300025927 Ga0207687_10006894 Ga0207687_100068945 127
141 3300025931 Ga0207644_10014992 Ga0207644_100149924 127
142 3300025931 Ga0207644_10947162 Ga0207644_109471622 127
143 3300025934 Ga0207686_10001677 Ga0207686_100016774 127
144 3300025935 Ga0207709_10001026 Ga0207709_1000102614 127
145 3300025938 Ga0207704_10000013 Ga0207704_10000013122 127
146 3300025940 Ga0207691_10195629 Ga0207691_101956293 127
147 3300025941 Ga0207711_11091257 Ga0207711_110912572 127
148 3300025942 Ga0207689_10000114 Ga0207689_1000011450 127
149 3300025949 Ga0207667_10059551 Ga0207667_100595512 127
150 3300025960 Ga0207651_10000013 Ga0207651_1000001334 127
151 3300025961 Ga0207712_10135618 Ga0207712_101356182 127
152 3300025972 Ga0207668_10000010 Ga0207668_10000010141 127
153 3300025981 Ga0207640_10039932 Ga0207640_100399323 127
154 3300025986 Ga0207658_10002704 Ga0207658_100027046 127
155 3300025986 Ga0207658_10004212 Ga0207658_100042124 127
156 3300026023 Ga0207677_10000563 Ga0207677_1000056310 127
157 3300026035 Ga0207703_10705947 Ga0207703_107059473 127
158 3300026078 Ga0207702_10522300 Ga0207702_105223002 127
159 3300026088 Ga0207641_10036704 Ga0207641_100367043 127
160 3300026089 Ga0207648_10000025 Ga0207648_1000002584 127
161 3300026116 Ga0207674_10744226 Ga0207674_107442262 127
162 3300027866 Ga0209813_10001162 Ga0209813_100011623 127
163 3300027866 Ga0209813_10074446 Ga0209813_100744461 127
164 3300028379 Ga0268266_10003713 Ga0268266_1000371311 127
165 3300028380 Ga0268265_10004500 Ga0268265_100045008 127
166 3300028381 Ga0268264_10046404 Ga0268264_100464043 127
167 3300031911 Ga0307412_10003875 Ga0307412_100038754 127
168 3300044735 Ga0466968_0002188 Ga0466968_0002188_1752_2135 127
169 3300044735 Ga0466968_0113742 Ga0466968_0113742_825_1208 127
170 3300044901 Ga0466960_0126477 Ga0466960_0126477_456_839 127
171 3300046460 Ga0495638_0000199 Ga0495638_0000199_29544_29927 127
172 3300046471 Ga0495650_0032540 Ga0495650_0032540_291_674 127
173 3300046471 Ga0495650_0090113 Ga0495650_0090113_561_944 127
174 3300046506 Ga0495583_0000037 Ga0495583_0000037_217273_217656 127
175 3300046507 Ga0495606_0000598 Ga0495606_0000598_12483_12866 127
176 3300046507 Ga0495606_0043126 Ga0495606_0043126_1560_1943 127
177 3300046512 Ga0495610_0133450 Ga0495610_0133450_33_416 127
178 3300046513 Ga0495616_0000018 Ga0495616_0000018_111903_112286 127
179 3300046520 Ga0495637_0005376 Ga0495637_0005376_5847_6266 127
180 3300046524 Ga0495648_0000300 Ga0495648_0000300_45502_45885 127
181 3300046616 Ga0495668_0000039 Ga0495668_0000039_114597_114980 127
182 3300046691 Ga0495670_0634104 Ga0495670_0634104_57_476 127
183 3300047446 Ga0495679_005114 Ga0495679_005114_102_485 127
184 3300047469 Ga0495673_0000263 Ga0495673_0000263_45653_46036 127
185 3300047469 Ga0495673_0002653 Ga0495673_0002653_321_704 127
186 3300047469 Ga0495673_0039810 Ga0495673_0039810_1354_1782 127
187 3300047472 Ga0495686_0000055 Ga0495686_0000055_79402_79830 127
188 3300047472 Ga0495686_0000070 Ga0495686_0000070_49177_49560 127
189 3300047472 Ga0495686_0006151 Ga0495686_0006151_2031_2414 127
190 3300047472 Ga0495686_0081409 Ga0495686_0081409_405_788 127
191 3300048903 Ga0496100_1371060 Ga0496100_1371060_60_443 127
192 3300048904 Ga0496101_0383279 Ga0496101_0383279_464_847 127
193 3300048905 Ga0496102_0519831 Ga0496102_0519831_47_430 127
194 3300048907 Ga0496104_0029100 Ga0496104_0029100_3910_4293 127
195 3300048908 Ga0496105_0326628 Ga0496105_0326628_439_822 127
196 3300048910 Ga0496107_0000019 Ga0496107_0000019_51908_52351 127
197 3300048910 Ga0496107_0053799 Ga0496107_0053799_336_719 127
198 3300048914 Ga0496111_0364332 Ga0496111_0364332_384_767 127
199 3300048916 Ga0496113_1048772 Ga0496113_1048772_198_626 127
200 3300048918 Ga0496115_0000333 Ga0496115_0000333_29611_29994 127
201 3300048918 Ga0496115_0018597 Ga0496115_0018597_4341_4724 127
202 3300048918 Ga0496115_1122432 Ga0496115_1122432_114_557 127
203 3300048919 Ga0496116_0052601 Ga0496116_0052601_255_638 127
204 3300048920 Ga0496117_0013229 Ga0496117_0013229_2046_2429 127
205 3300048920 Ga0496117_0055315 Ga0496117_0055315_884_1267 127
206 3300048921 Ga0496118_0034626 Ga0496118_0034626_316_699 127
207 3300048921 Ga0496118_0049982 Ga0496118_0049982_142_525 127
208 3300048922 Ga0496119_0083767 Ga0496119_0083767_1094_1477 127
209 3300048924 Ga0496121_0000085 Ga0496121_0000085_83715_84098 127
210 3300048924 Ga0496121_0006189 Ga0496121_0006189_6669_7112 127
211 3300048924 Ga0496121_0032805 Ga0496121_0032805_2574_2957 127
212 3300048924 Ga0496121_0165999 Ga0496121_0165999_342_725 127
213 3300048925 Ga0496122_0000083 Ga0496122_0000083_91213_91665 127
214 3300048925 Ga0496122_0042631 Ga0496122_0042631_1179_1562 127
215 3300048925 Ga0496122_0408361 Ga0496122_0408361_253_636 127
216 3300048925 Ga0496122_0428247 Ga0496122_0428247_17_400 127
217 3300048926 Ga0496123_0000097 Ga0496123_0000097_5406_5858 127
218 3300048927 Ga0496124_0005657 Ga0496124_0005657_10411_10794 127
219 3300048927 Ga0496124_0304470 Ga0496124_0304470_434_817 127
220 3300048928 Ga0496125_0142933 Ga0496125_0142933_302_685 127
221 3300048928 Ga0496125_0310907 Ga0496125_0310907_216_644 127
222 3300048929 Ga0496126_0001829 Ga0496126_0001829_19980_20363 127
223 3300048929 Ga0496126_0041773 Ga0496126_0041773_2168_2620 127
224 3300049671 Ga0501238_000393 Ga0501238_000393_4262_4645 127
225 3300050491 nmdc:mga00v17_26250_c1 nmdc:mga00v17_26250_c1_222_605 127
226 3300050492 nmdc:mga0yw44_111172_c1 nmdc:mga0yw44_111172_c1_843_1226 127
227 3300050493 nmdc:mga0k408_144149_c1 nmdc:mga0k408_144149_c1_531_914 127
228 3300050494 nmdc:mga06z11_52141_c1 nmdc:mga06z11_52141_c1_843_1226 127
229 3300050495 nmdc:mga04h51_4489_c1 nmdc:mga04h51_4489_c1_983_1366 127
230 3300050496 nmdc:mga07m45_211573_c1 nmdc:mga07m45_211573_c1_604_990 127
231 3300050496 nmdc:mga07m45_46281_c1 nmdc:mga07m45_46281_c1_843_1226 127
232 3300050496 nmdc:mga07m45_787912_c1 nmdc:mga07m45_787912_c1_117_500 127
233 3300050496 nmdc:mga07m45_81534_c1 nmdc:mga07m45_81534_c1_689_1072 127
234 3300050516 nmdc:mga0sz30_4451_c1 nmdc:mga0sz30_4451_c1_4321_4704 127
235 3300053086 Ga0500578_0032076 Ga0500578_0032076_2057_2440 127
236 3300053088 Ga0500644_0000031 Ga0500644_0000031_57501_57884 127
237 3300053096 Ga0500641_0014283 Ga0500641_0014283_274_657 127
238 3300053102 Ga0500554_000580 Ga0500554_000580_6790_7173 127
239 3300053104 Ga0500556_0000186 Ga0500556_0000186_34584_35003 127
240 3300053122 Ga0500608_000155 Ga0500608_000155_20691_21074 127
241 3300053122 Ga0500608_079654 Ga0500608_079654_745_1128 127
242 3300053125 Ga0500618_000024 Ga0500618_000024_99439_99822 127
243 3300053138 Ga0500564_000141 Ga0500564_000141_13530_13913 127
244 3300053139 Ga0500568_0044235 Ga0500568_0044235_1251_1634 127
245 3300053151 Ga0500604_0157828 Ga0500604_0157828_139_522 127
246 3300053153 Ga0500616_0014866 Ga0500616_0014866_1314_1697 127
247 3300053156 Ga0500622_0005847 Ga0500622_0005847_6481_6864 127
248 3300053156 Ga0500622_0031798 Ga0500622_0031798_1207_1590 127
249 3300053158 Ga0500627_0063916 Ga0500627_0063916_664_1047 127
250 3300053730 Ga0500645_000149 Ga0500645_000149_11857_12276 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

117

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.9263 3 118
3hv2-assembly1.cif.gz_B crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 0.9204 1 124
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9177 3 118
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.914 3 122
1udr-assembly1.cif.gz_C chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4) 0.9111 3 122
ID Description Score Start End Superfamily
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9381 5 81 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9347 3 84 3.40.50.2300
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9263 3 118 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9236 3 84 3.40.50.2300
3hv2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9204 1 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2U8WP21-F1-model_v4 Response regulator 0.9864 1 127 GO:0000160
AF-A0A2V4W669-F1-model_v4 deleted 0.9846 1 127
AF-A0A2P7R055-F1-model_v4 Response regulator 0.9806 1 127 GO:0000160
AF-A0A1Y5EDY5-F1-model_v4 Response regulatory domain-containing protein 0.9795 1 121 GO:0000160
AF-A0A1Y5EHQ1-F1-model_v4 Response regulatory domain-containing protein 0.9794 1 115 GO:0000160

Feature Viewer

pLDDT pTM Quality
86.6 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map