F360802

General Info

Members Datasets Scaffolds Average Seq Length
249 164 246 273

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10128430|Ga0207686_101284302
Length 297
Sequence MPDQTSTARWRFRTRLAPVKVHHLNCGSLCPHGRRLLNGEGGLLEKGHIVCHCLAIETGEGLVLVDTGFGIEDARNPRQLGAIFGLMNAEPKVETTALKQLEALGFGADDVRQVVVTHLDPDHSGGLPDFPNAEVHVLSTELDAALQPSLKDKLRYPDAHWKHGPRWVRHDKGGDDWFGFESVRILPGLDAEVLLIPLFGHSRGHTGVALRTGEGWLLHCGDAYFNHGEIETPASCPPGLRFFQLLNADDGKARRRNRDRLQELAVRHGEEITLLCSHDPHELAREQAKAGAATPTG

Samples

Sample ID Description Type Environment
1 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
2 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
3 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 12.45
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000135 3300002239 Bacteria 10896
2 JGI24742J22300_10005289 3300002244 Bacteria 2121
3 Ga0070683_100040043 3300005329 Bacteria 4306
4 Ga0070683_100041215 3300005329 Bacteria 4246
5 Ga0070677_10000103 3300005333 Bacteria 27983
6 Ga0070682_100000099 3300005337 Bacteria 77574
7 Ga0068868_100086998 3300005338 Bacteria 2513
8 Ga0070691_10000330 3300005341 Bacteria 16763
9 Ga0070674_100000017 3300005356 Bacteria 90884
10 Ga0070674_100000090 3300005356 Bacteria 42115
11 Ga0070674_100518174 3300005356 Bacteria 996
12 Ga0070703_10011314 3300005406 Bacteria 2518
13 Ga0070714_100055958 3300005435 Bacteria 3373
14 Ga0070714_100616346 3300005435 Bacteria 1043
15 Ga0070711_100204237 3300005439 Bacteria 1527
16 Ga0070694_100530442 3300005444 Bacteria 940
17 Ga0070662_100000004 3300005457 Bacteria 195534
18 Ga0068867_100038374 3300005459 Bacteria 3487
19 Ga0070698_100000296 3300005471 Bacteria 50713
20 Ga0070679_100000243 3300005530 Bacteria 45435
21 Ga0070684_100003063 3300005535 Bacteria 12476
22 Ga0070684_100041448 3300005535 Bacteria 3969
23 Ga0070684_100068335 3300005535 Bacteria 3123
24 Ga0068853_100536550 3300005539 Bacteria 1107
25 Ga0070693_100001714 3300005547 Bacteria 9964
26 Ga0070665_100000138 3300005548 Bacteria 136562
27 Ga0070704_100153378 3300005549 Bacteria 1814
28 Ga0070664_100077230 3300005564 Bacteria 2863
29 Ga0068856_100014979 3300005614 Bacteria 7489
30 Ga0068864_100000053 3300005618 Bacteria 133049
31 Ga0068866_10000001 3300005718 Bacteria 519680
32 Ga0068866_10005814 3300005718 Bacteria 5117
33 Ga0068861_100104824 3300005719 Bacteria 2257
34 Ga0068863_100000342 3300005841 Bacteria 47536
35 Ga0068858_100000009 3300005842 Bacteria 237748
36 Ga0068858_100000065 3300005842 Bacteria 108233
37 Ga0068860_100007463 3300005843 Bacteria 10936
38 Ga0075363_100000912 3300006048 Bacteria 10417
39 Ga0070715_10000001 3300006163 Bacteria 693690
40 Ga0070712_100001933 3300006175 Bacteria 12678
41 Ga0075433_10000597 3300006852 Bacteria 23988
42 Ga0075429_100064363 3300006880 Unclassified 3194
43 Ga0075435_100171420 3300007076 Bacteria 1831
44 Ga0105240_10335500 3300009093 Bacteria 1719
45 Ga0111539_10732515 3300009094 Bacteria 1151
46 Ga0105245_10000020 3300009098 Bacteria 181774
47 Ga0105245_10013222 3300009098 Bacteria 7191
48 Ga0105243_10000127 3300009148 Bacteria 86196
49 Ga0105243_10275657 3300009148 Bacteria 1512
50 Ga0105242_10019161 3300009176 Bacteria 5360
51 Ga0105238_10000011 3300009551 Bacteria 261080
52 Ga0105249_10000080 3300009553 Bacteria 138080
53 Ga0157370_10004542 3300013104 Bacteria 15899
54 Ga0157374_10001066 3300013296 Bacteria 23793
55 Ga0157374_10119000 3300013296 Bacteria 2548
56 Ga0157375_10001213 3300013308 Bacteria 22205
57 Ga0157375_10036791 3300013308 Bacteria 4686
58 Ga0157375_10158692 3300013308 Bacteria 2403
59 Ga0157380_10000798 3300014326 Bacteria 19808
60 Ga0163161_10000021 3300017792 Bacteria 208779
61 Ga0207653_10058687 3300025885 Bacteria 1294
62 Ga0207682_10000005 3300025893 Bacteria 95617
63 Ga0207692_10009557 3300025898 Bacteria 4056
64 Ga0207642_10000002 3300025899 Bacteria 658166
65 Ga0207642_10000525 3300025899 Bacteria 11747
66 Ga0207685_10000005 3300025905 Bacteria 289944
67 Ga0207693_10000735 3300025915 Bacteria 29546
68 Ga0207652_10000907 3300025921 Bacteria 27991
69 Ga0207694_10000004 3300025924 Bacteria 967075
70 Ga0207687_10000013 3300025927 Bacteria 299826
71 Ga0207687_10014235 3300025927 Bacteria 5203
72 Ga0207700_10040786 3300025928 Bacteria 3391
73 Ga0207664_10121623 3300025929 Bacteria 2185
74 Ga0207664_10191963 3300025929 Bacteria 1759
75 Ga0207706_10000012 3300025933 Bacteria 195475
76 Ga0207686_10128430 3300025934 Bacteria 1735
77 Ga0207709_10000176 3300025935 Bacteria 86175
78 Ga0207669_10000001 3300025937 Bacteria 377747
79 Ga0207669_10000096 3300025937 Bacteria 44213
80 Ga0207665_10093280 3300025939 Bacteria 2090
81 Ga0207661_10062244 3300025944 Bacteria 3018
82 Ga0207661_10155502 3300025944 Bacteria 1980
83 Ga0207661_10194831 3300025944 Bacteria 1778
84 Ga0207679_10057126 3300025945 Bacteria 2885
85 Ga0207712_10000007 3300025961 Bacteria 539589
86 Ga0207677_10000674 3300026023 Bacteria 20270
87 Ga0207703_10000018 3300026035 Bacteria 271377
88 Ga0207703_10000023 3300026035 Bacteria 222018
89 Ga0207702_10002267 3300026078 Bacteria 18444
90 Ga0207641_10000238 3300026088 Bacteria 71152
91 Ga0207648_10004426 3300026089 Bacteria 14414
92 Ga0207676_10000195 3300026095 Bacteria 52951
93 Ga0207675_100164190 3300026118 Bacteria 2120
94 Ga0207683_10162636 3300026121 Bacteria 2019
95 Ga0268266_10000047 3300028379 Bacteria 310996
96 Ga0268264_10005373 3300028381 Bacteria 10850
97 Ga0307509_10298682 3300031507 Bacteria 1360
98 Ga0373953_0022127 3300035117 Bacteria 2394
99 Ga0373954_0096096 3300035118 Bacteria 1427
100 Ga0373955_0256798 3300035172 Bacteria 1048
101 Ga0373937_0052146 3300036401 Bacteria 3750
102 Ga0395899_0000004 3300037312 Bacteria 874267
103 Ga0436364_0659506 3300037853 Bacteria 3008
104 Ga0451853_2719552 3300041512 Bacteria 1391
105 Ga0466963_0000105 3300044694 Bacteria 30285
106 Ga0466971_0121487 3300044719 Bacteria 1209
107 Ga0466960_0023447 3300044901 Bacteria 2771
108 Ga0466959_0002516 3300045049 Bacteria 11751
109 Ga0495592_0000899 3300046454 Bacteria 20622
110 Ga0495592_0101449 3300046454 Bacteria 2051
111 Ga0495592_0102068 3300046454 Bacteria 2043
112 Ga0495603_0006970 3300046455 Bacteria 6781
113 Ga0495603_0015040 3300046455 Bacteria 4678
114 Ga0495629_0043355 3300046459 Bacteria 3159
115 Ga0495629_0122724 3300046459 Bacteria 1810
116 Ga0495629_0179064 3300046459 Bacteria 1470
117 Ga0495641_0000228 3300046461 Bacteria 43671
118 Ga0495653_0034655 3300046463 Bacteria 3989
119 Ga0495653_0119109 3300046463 Bacteria 1885
120 Ga0495653_0136596 3300046463 Bacteria 1729
121 Ga0495653_0145548 3300046463 Bacteria 1661
122 Ga0495653_0247143 3300046463 Bacteria 1186
123 Ga0495582_0000726 3300046473 Bacteria 18153
124 Ga0495662_0000349 3300046476 Bacteria 20239
125 Ga0495608_0000222 3300046511 Bacteria 41114
126 Ga0495608_0049369 3300046511 Bacteria 2794
127 Ga0495608_0118695 3300046511 Bacteria 1697
128 Ga0495608_0142848 3300046511 Bacteria 1527
129 Ga0495608_0207807 3300046511 Bacteria 1232
130 Ga0495618_0000008 3300046514 Bacteria 204578
131 Ga0495618_0233108 3300046514 Bacteria 1159
132 Ga0495620_0000995 3300046515 Bacteria 17517
133 Ga0495628_0009129 3300046516 Bacteria 8480
134 Ga0495628_0036380 3300046516 Bacteria 3952
135 Ga0495628_0039581 3300046516 Bacteria 3770
136 Ga0495628_0124338 3300046516 Bacteria 1977
137 Ga0495630_0000121 3300046517 Bacteria 61852
138 Ga0495630_0210922 3300046517 Bacteria 1482
139 Ga0495644_0000630 3300046523 Bacteria 14753
140 Ga0495652_0044654 3300046529 Bacteria 3814
141 Ga0495652_0186715 3300046529 Bacteria 1586
142 Ga0495652_0202189 3300046529 Bacteria 1507
143 Ga0495640_0039945 3300046533 Bacteria 3289
144 Ga0495586_0015966 3300046535 Bacteria 3995
145 Ga0495598_0004147 3300046537 Bacteria 3121
146 Ga0495645_0007267 3300046543 Bacteria 7706
147 Ga0495645_0175653 3300046543 Bacteria 1471
148 Ga0495633_0061262 3300046558 Bacteria 1762
149 Ga0495667_0086465 3300046559 Bacteria 2033
150 Ga0495656_0001289 3300046615 Bacteria 8153
151 Ga0495634_0000059 3300046642 Bacteria 88314
152 Ga0495634_0000962 3300046642 Bacteria 27234
153 Ga0495634_0026327 3300046642 Bacteria 4060
154 Ga0495634_0075754 3300046642 Bacteria 2209
155 Ga0495634_0147889 3300046642 Bacteria 1487
156 Ga0495635_0000062 3300046663 Bacteria 65631
157 Ga0495635_0021212 3300046663 Bacteria 4528
158 Ga0495635_0079604 3300046663 Bacteria 2242
159 Ga0495635_0130226 3300046663 Bacteria 1715
160 Ga0495657_0007440 3300046675 Bacteria 8459
161 Ga0495599_0002873 3300046678 Bacteria 10033
162 Ga0495599_0087189 3300046678 Bacteria 1949
163 Ga0495646_0132874 3300046680 Bacteria 1400
164 Ga0495658_0000034 3300046683 Bacteria 69176
165 Ga0495658_0158439 3300046683 Bacteria 1395
166 Ga0495669_0000310 3300046684 Bacteria 26921
167 Ga0495613_0000124 3300046689 Bacteria 75971
168 Ga0495613_0124638 3300046689 Bacteria 1848
169 Ga0495624_0028013 3300046690 Bacteria 3684
170 Ga0495670_0100473 3300046691 Bacteria 1489
171 Ga0495649_0001983 3300046694 Bacteria 14839
172 Ga0495600_0001066 3300046809 Bacteria 14880
173 Ga0495600_0108934 3300046809 Bacteria 1804
174 Ga0495600_0199805 3300046809 Bacteria 1284
175 Ga0495604_0000055 3300047317 Bacteria 100430
176 Ga0495604_0337617 3300047317 Bacteria 1004
177 Ga0495672_0052097 3300047320 Bacteria 2406
178 Ga0495676_0020018 3300047321 Bacteria 5878
179 Ga0495680_0000550 3300047322 Bacteria 42291
180 Ga0495680_0006596 3300047322 Bacteria 10768
181 Ga0495680_0016732 3300047322 Bacteria 6288
182 Ga0495680_0020516 3300047322 Bacteria 5558
183 Ga0495680_0126760 3300047322 Bacteria 1879
184 Ga0495680_0184048 3300047322 Bacteria 1506
185 Ga0495679_052561 3300047446 Bacteria 1218
186 Ga0495685_012883 3300047447 Bacteria 2834
187 Ga0495684_0008411 3300047471 Bacteria 7993
188 Ga0495684_0162845 3300047471 Bacteria 1663
189 Ga0495593_0207491 3300047673 Bacteria 984
190 Ga0495602_0164455 3300048088 Bacteria 1729
191 Ga0495602_0430600 3300048088 Bacteria 935
192 Ga0495614_0022504 3300048089 Bacteria 2720
193 Ga0495614_0212296 3300048089 Bacteria 878
194 Ga0496100_0000002 3300048903 Bacteria 489057
195 Ga0496101_0000001 3300048904 Bacteria 489057
196 Ga0496104_0000009 3300048907 Bacteria 488055
197 Ga0496104_0294495 3300048907 Bacteria 1535
198 Ga0496105_0000007 3300048908 Bacteria 339658
199 Ga0496106_0000084 3300048909 Bacteria 74135
200 Ga0496106_0000151 3300048909 Bacteria 51430
201 Ga0496107_0000003 3300048910 Bacteria 304038
202 Ga0496108_0000001 3300048911 Bacteria 919044
203 Ga0496108_0000587 3300048911 Bacteria 28462
204 Ga0496108_0039282 3300048911 Bacteria 3945
205 Ga0496109_0000004 3300048912 Bacteria 404818
206 Ga0496109_0003107 3300048912 Bacteria 13848
207 Ga0496110_0028120 3300048913 Bacteria 4826
208 Ga0496110_0039511 3300048913 Bacteria 4109
209 Ga0496110_0410411 3300048913 Bacteria 1235
210 Ga0496110_0415161 3300048913 Bacteria 1227
211 Ga0496111_0002911 3300048914 Bacteria 10458
212 Ga0496111_0086714 3300048914 Bacteria 2291
213 Ga0496111_0142207 3300048914 Bacteria 1778
214 Ga0496112_0000006 3300048915 Bacteria 365227
215 Ga0496112_0049307 3300048915 Bacteria 4127
216 Ga0496112_0070023 3300048915 Bacteria 3466
217 Ga0496113_0035986 3300048916 Bacteria 3625
218 Ga0496113_0056089 3300048916 Bacteria 2956
219 Ga0496113_0474866 3300048916 Unclassified 1005
220 Ga0496113_0501748 3300048916 Bacteria 974
221 Ga0496113_0675152 3300048916 Bacteria 825
222 Ga0496114_0067222 3300048917 Bacteria 3006
223 Ga0496114_0335101 3300048917 Bacteria 1338
224 Ga0496115_0159697 3300048918 Bacteria 1863
225 Ga0496122_0000090 3300048925 Bacteria 205886
226 Ga0496122_0000564 3300048925 Bacteria 75907
227 Ga0496123_0008265 3300048926 Bacteria 9595
228 Ga0501042_0018304 3300049578 Bacteria 4848
229 Ga0501047_0004470 3300049581 Bacteria 13159
230 Ga0501075_0001068 3300049591 Bacteria 17616
231 Ga0501198_003291 3300049649 Bacteria 2203
232 Ga0501081_0158202 3300049743 Bacteria 1631
233 Ga0501035_0063785 3300049822 Bacteria 3276
234 nmdc:mga06r32_227675_c1 3300050510 Bacteria 1852
235 nmdc:mga0rr50_777450_c1 3300050513 Unclassified 817
236 Ga0495601_0000035 3300053077 Bacteria 92903
237 Ga0495601_0049256 3300053077 Bacteria 2656
238 Ga0495612_0001652 3300053078 Bacteria 9176
239 Ga0495612_0006638 3300053078 Bacteria 4745
240 Ga0495595_0092836 3300053084 Bacteria 1450
241 Ga0495619_0000025 3300053085 Bacteria 167905
242 Ga0495619_0000157 3300053085 Bacteria 49848
243 Ga0495619_0010051 3300053085 Bacteria 5956
244 Ga0495619_0034250 3300053085 Bacteria 3301
245 Ga0500614_000486 3300053123 Bacteria 10332
246 Ga0466962_0018252 3300061719 Bacteria 3375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2772190705 2772607329 226
2 3300048088 Ga0495602_0430600 Ga0495602_0430600_206_916 235
3 3300048925 Ga0496122_0000564 Ga0496122_0000564_64019_64753 238
4 3300009148 Ga0105243_10000127 Ga0105243_1000012740 239
5 3300048925 Ga0496122_0000090 Ga0496122_0000090_86778_87521 239
6 3300048926 Ga0496123_0008265 Ga0496123_0008265_1528_2271 239
7 3300050513 nmdc:mga0rr50_777450_c1 nmdc:mga0rr50_777450_c1_46_774 240
8 3300048918 Ga0496115_0159697 Ga0496115_0159697_1122_1853 242
9 3300049649 Ga0501198_003291 Ga0501198_003291_1249_2004 243
10 iso_pu_bacteria 2588254255 2590601070 246
11 3300025944 Ga0207661_10155502 Ga0207661_101555022 249
12 3300045049 Ga0466959_0002516 Ga0466959_0002516_6573_7340 249
13 3300046809 Ga0495600_0108934 Ga0495600_0108934_27_776 249
14 3300061719 Ga0466962_0018252 Ga0466962_0018252_99_866 249
15 iso_pu_bacteria 2585428045 2587679761 250
16 3300013308 Ga0157375_10158692 Ga0157375_101586921 252
17 3300025935 Ga0207709_10000176 Ga0207709_1000017640 253
18 3300048088 Ga0495602_0164455 Ga0495602_0164455_956_1717 253
19 3300046663 Ga0495635_0130226 Ga0495635_0130226_525_1319 255
20 3300047446 Ga0495679_052561 Ga0495679_052561_213_980 255
21 3300005471 Ga0070698_100000296 Ga0070698_10000029628 258
22 3300046463 Ga0495653_0145548 Ga0495653_0145548_451_1227 258
23 3300048916 Ga0496113_0056089 Ga0496113_0056089_73_873 258
24 3300046642 Ga0495634_0075754 Ga0495634_0075754_470_1249 259
25 3300046690 Ga0495624_0028013 Ga0495624_0028013_1373_2152 259
26 3300047471 Ga0495684_0162845 Ga0495684_0162845_443_1222 259
27 3300048089 Ga0495614_0212296 Ga0495614_0212296_34_813 259
28 3300048916 Ga0496113_0501748 Ga0496113_0501748_37_816 259
29 3300053085 Ga0495619_0010051 Ga0495619_0010051_1813_2595 259
30 3300046678 Ga0495599_0002873 Ga0495599_0002873_3451_4233 260
31 3300046809 Ga0495600_0199805 Ga0495600_0199805_65_847 260
32 3300047317 Ga0495604_0337617 Ga0495604_0337617_196_981 260
33 3300048916 Ga0496113_0675152 Ga0496113_0675152_11_793 260
34 3300053077 Ga0495601_0000035 Ga0495601_0000035_74910_75692 260
35 3300013104 Ga0157370_10004542 Ga0157370_1000454212 261
36 3300025893 Ga0207682_10000005 Ga0207682_1000000563 261
37 3300046642 Ga0495634_0000059 Ga0495634_0000059_67182_67973 261
38 3300048089 Ga0495614_0022504 Ga0495614_0022504_1703_2488 261
39 3300035117 Ga0373953_0022127 Ga0373953_0022127_20_811 262
40 3300046689 Ga0495613_0124638 Ga0495613_0124638_85_873 262
41 3300048913 Ga0496110_0039511 Ga0496110_0039511_3122_3910 262
42 3300005329 Ga0070683_100040043 Ga0070683_1000400438 263
43 3300005341 Ga0070691_10000330 Ga0070691_100003305 263
44 3300005435 Ga0070714_100616346 Ga0070714_1006163462 263
45 3300005535 Ga0070684_100003063 Ga0070684_10000306320 263
46 3300006048 Ga0075363_100000912 Ga0075363_1000009125 263
47 3300025944 Ga0207661_10194831 Ga0207661_101948312 263
48 3300044719 Ga0466971_0121487 Ga0466971_0121487_15_842 263
49 3300048917 Ga0496114_0335101 Ga0496114_0335101_26_826 265
50 3300005564 Ga0070664_100077230 Ga0070664_1000772302 266
51 3300009094 Ga0111539_10732515 Ga0111539_107325152 266
52 3300025945 Ga0207679_10057126 Ga0207679_100571265 266
53 3300046454 Ga0495592_0101449 Ga0495592_0101449_582_1382 266
54 3300046459 Ga0495629_0179064 Ga0495629_0179064_657_1457 266
55 3300046642 Ga0495634_0026327 Ga0495634_0026327_3056_3856 266
56 3300046663 Ga0495635_0021212 Ga0495635_0021212_1131_1931 266
57 3300047322 Ga0495680_0184048 Ga0495680_0184048_403_1203 266
58 3300048913 Ga0496110_0410411 Ga0496110_0410411_377_1177 266
59 3300048914 Ga0496111_0142207 Ga0496111_0142207_844_1644 266
60 3300050510 nmdc:mga06r32_227675_c1 nmdc:mga06r32_227675_c1_968_1768 266
61 3300053085 Ga0495619_0000157 Ga0495619_0000157_15644_16444 266
62 3300046511 Ga0495608_0207807 Ga0495608_0207807_233_1081 267
63 3300047471 Ga0495684_0008411 Ga0495684_0008411_3550_4353 267
64 3300007076 Ga0075435_100171420 Ga0075435_1001714202 268
65 3300046463 Ga0495653_0136596 Ga0495653_0136596_476_1285 269
66 3300046459 Ga0495629_0122724 Ga0495629_0122724_956_1768 270
67 3300046529 Ga0495652_0186715 Ga0495652_0186715_413_1234 270
68 3300046642 Ga0495634_0000962 Ga0495634_0000962_6573_7385 270
69 3300049581 Ga0501047_0004470 Ga0501047_0004470_1524_2348 270
70 3300049822 Ga0501035_0063785 Ga0501035_0063785_839_1663 270
71 3300031507 Ga0307509_10298682 Ga0307509_102986822 271
72 3300047321 Ga0495676_0020018 Ga0495676_0020018_4224_5057 271
73 3300005439 Ga0070711_100204237 Ga0070711_1002042371 272
74 3300006175 Ga0070712_100001933 Ga0070712_1000019333 272
75 3300006880 Ga0075429_100064363 Ga0075429_1000643633 272
76 3300025898 Ga0207692_10009557 Ga0207692_100095574 272
77 3300025915 Ga0207693_10000735 Ga0207693_1000073530 272
78 3300025929 Ga0207664_10121623 Ga0207664_101216232 272
79 3300025939 Ga0207665_10093280 Ga0207665_100932802 272
80 3300046511 Ga0495608_0142848 Ga0495608_0142848_430_1257 272
81 3300046529 Ga0495652_0202189 Ga0495652_0202189_353_1180 272
82 3300046533 Ga0495640_0039945 Ga0495640_0039945_2148_2975 272
83 3300046559 Ga0495667_0086465 Ga0495667_0086465_339_1166 272
84 3300046663 Ga0495635_0079604 Ga0495635_0079604_1337_2164 272
85 3300046675 Ga0495657_0007440 Ga0495657_0007440_573_1400 272
86 3300046680 Ga0495646_0132874 Ga0495646_0132874_388_1215 272
87 3300047322 Ga0495680_0016732 Ga0495680_0016732_52_879 272
88 3300048907 Ga0496104_0294495 Ga0496104_0294495_619_1446 272
89 3300048913 Ga0496110_0415161 Ga0496110_0415161_35_862 272
90 3300048915 Ga0496112_0049307 Ga0496112_0049307_266_1093 272
91 3300048916 Ga0496113_0474866 Ga0496113_0474866_149_976 272
92 3300046511 Ga0495608_0049369 Ga0495608_0049369_176_1015 273
93 3300046516 Ga0495628_0124338 Ga0495628_0124338_1003_1842 273
94 3300048911 Ga0496108_0000587 Ga0496108_0000587_17099_17938 273
95 3300048912 Ga0496109_0003107 Ga0496109_0003107_2545_3384 273
96 3300005435 Ga0070714_100055958 Ga0070714_1000559584 275
97 3300025928 Ga0207700_10040786 Ga0207700_100407862 275
98 3300025929 Ga0207664_10191963 Ga0207664_101919632 275
99 3300046476 Ga0495662_0000349 Ga0495662_0000349_13976_14803 275
100 3300005356 Ga0070674_100518174 Ga0070674_1005181741 276
101 3300005459 Ga0068867_100038374 Ga0068867_1000383745 276
102 3300006163 Ga0070715_10000001 Ga0070715_10000001406 276
103 3300025905 Ga0207685_10000005 Ga0207685_10000005326 276
104 3300026089 Ga0207648_10004426 Ga0207648_100044265 276
105 3300044901 Ga0466960_0023447 Ga0466960_0023447_122_952 276
106 3300046517 Ga0495630_0000121 Ga0495630_0000121_11934_12764 276
107 3300048914 Ga0496111_0086714 Ga0496111_0086714_635_1465 276
108 3300005329 Ga0070683_100041215 Ga0070683_1000412152 277
109 3300005337 Ga0070682_100000099 Ga0070682_10000009971 277
110 3300005356 Ga0070674_100000017 Ga0070674_10000001713 277
111 3300005406 Ga0070703_10011314 Ga0070703_100113145 277
112 3300005530 Ga0070679_100000243 Ga0070679_10000024320 277
113 3300005535 Ga0070684_100068335 Ga0070684_1000683354 277
114 3300005539 Ga0068853_100536550 Ga0068853_1005365501 277
115 3300005548 Ga0070665_100000138 Ga0070665_1000001384 277
116 3300005614 Ga0068856_100014979 Ga0068856_1000149794 277
117 3300005718 Ga0068866_10000001 Ga0068866_10000001438 277
118 3300005719 Ga0068861_100104824 Ga0068861_1001048241 277
119 3300005842 Ga0068858_100000009 Ga0068858_100000009153 277
120 3300005843 Ga0068860_100007463 Ga0068860_10000746315 277
121 3300009093 Ga0105240_10335500 Ga0105240_103355002 277
122 3300009098 Ga0105245_10013222 Ga0105245_100132228 277
123 3300009551 Ga0105238_10000011 Ga0105238_10000011234 277
124 3300013308 Ga0157375_10001213 Ga0157375_1000121324 277
125 3300014326 Ga0157380_10000798 Ga0157380_100007984 277
126 3300017792 Ga0163161_10000021 Ga0163161_10000021203 277
127 3300025885 Ga0207653_10058687 Ga0207653_100586872 277
128 3300025899 Ga0207642_10000002 Ga0207642_10000002157 277
129 3300025921 Ga0207652_10000907 Ga0207652_100009072 277
130 3300025924 Ga0207694_10000004 Ga0207694_10000004388 277
131 3300025927 Ga0207687_10014235 Ga0207687_100142356 277
132 3300025937 Ga0207669_10000001 Ga0207669_10000001385 277
133 3300025944 Ga0207661_10062244 Ga0207661_100622444 277
134 3300026035 Ga0207703_10000023 Ga0207703_1000002360 277
135 3300026078 Ga0207702_10002267 Ga0207702_1000226719 277
136 3300026118 Ga0207675_100164190 Ga0207675_1001641905 277
137 3300026121 Ga0207683_10162636 Ga0207683_101626362 277
138 3300028379 Ga0268266_10000047 Ga0268266_10000047150 277
139 3300028381 Ga0268264_10005373 Ga0268264_100053732 277
140 3300041512 Ga0451853_2719552 Ga0451853_2719552_103_936 277
141 3300046454 Ga0495592_0000899 Ga0495592_0000899_4647_5480 277
142 3300046454 Ga0495592_0102068 Ga0495592_0102068_849_1682 277
143 3300046455 Ga0495603_0015040 Ga0495603_0015040_1324_2160 277
144 3300046461 Ga0495641_0000228 Ga0495641_0000228_30358_31191 277
145 3300046463 Ga0495653_0034655 Ga0495653_0034655_2549_3382 277
146 3300046463 Ga0495653_0119109 Ga0495653_0119109_241_1074 277
147 3300046473 Ga0495582_0000726 Ga0495582_0000726_16987_17820 277
148 3300046511 Ga0495608_0000222 Ga0495608_0000222_12984_13817 277
149 3300046514 Ga0495618_0000008 Ga0495618_0000008_25463_26296 277
150 3300046516 Ga0495628_0009129 Ga0495628_0009129_4837_5670 277
151 3300046516 Ga0495628_0039581 Ga0495628_0039581_1778_2611 277
152 3300046517 Ga0495630_0210922 Ga0495630_0210922_352_1185 277
153 3300046523 Ga0495644_0000630 Ga0495644_0000630_1441_2274 277
154 3300046535 Ga0495586_0015966 Ga0495586_0015966_700_1536 277
155 3300046537 Ga0495598_0004147 Ga0495598_0004147_679_1512 277
156 3300046543 Ga0495645_0175653 Ga0495645_0175653_510_1343 277
157 3300046558 Ga0495633_0061262 Ga0495633_0061262_665_1498 277
158 3300046642 Ga0495634_0147889 Ga0495634_0147889_340_1173 277
159 3300046663 Ga0495635_0000062 Ga0495635_0000062_55678_56511 277
160 3300046683 Ga0495658_0000034 Ga0495658_0000034_68010_68843 277
161 3300046689 Ga0495613_0000124 Ga0495613_0000124_62264_63097 277
162 3300046691 Ga0495670_0100473 Ga0495670_0100473_466_1299 277
163 3300046694 Ga0495649_0001983 Ga0495649_0001983_1892_2725 277
164 3300046809 Ga0495600_0001066 Ga0495600_0001066_8354_9187 277
165 3300047317 Ga0495604_0000055 Ga0495604_0000055_78167_79000 277
166 3300047322 Ga0495680_0000550 Ga0495680_0000550_14047_14880 277
167 3300047322 Ga0495680_0006596 Ga0495680_0006596_9314_10147 277
168 3300047447 Ga0495685_012883 Ga0495685_012883_596_1432 277
169 3300048915 Ga0496112_0000006 Ga0496112_0000006_263025_263858 277
170 3300048916 Ga0496113_0035986 Ga0496113_0035986_192_1025 277
171 3300048917 Ga0496114_0067222 Ga0496114_0067222_1452_2285 277
172 3300049591 Ga0501075_0001068 Ga0501075_0001068_12693_13526 277
173 3300049743 Ga0501081_0158202 Ga0501081_0158202_691_1524 277
174 3300053078 Ga0495612_0001652 Ga0495612_0001652_5375_6208 277
175 3300053123 Ga0500614_000486 Ga0500614_000486_45_878 277
176 3300005333 Ga0070677_10000103 Ga0070677_1000010310 278
177 3300005549 Ga0070704_100153378 Ga0070704_1001533782 278
178 3300005841 Ga0068863_100000342 Ga0068863_10000034224 278
179 3300009098 Ga0105245_10000020 Ga0105245_1000002034 278
180 3300009553 Ga0105249_10000080 Ga0105249_1000008057 278
181 3300013296 Ga0157374_10001066 Ga0157374_1000106633 278
182 3300013296 Ga0157374_10119000 Ga0157374_101190002 278
183 3300013308 Ga0157375_10036791 Ga0157375_100367913 278
184 3300025927 Ga0207687_10000013 Ga0207687_1000001376 278
185 3300025961 Ga0207712_10000007 Ga0207712_10000007450 278
186 3300026088 Ga0207641_10000238 Ga0207641_1000023858 278
187 3300035118 Ga0373954_0096096 Ga0373954_0096096_130_966 278
188 3300035172 Ga0373955_0256798 Ga0373955_0256798_78_914 278
189 3300036401 Ga0373937_0052146 Ga0373937_0052146_2370_3206 278
190 3300044694 Ga0466963_0000105 Ga0466963_0000105_21015_21851 278
191 3300046511 Ga0495608_0118695 Ga0495608_0118695_206_1042 278
192 3300046515 Ga0495620_0000995 Ga0495620_0000995_14625_15461 278
193 3300046684 Ga0495669_0000310 Ga0495669_0000310_17376_18212 278
194 3300047320 Ga0495672_0052097 Ga0495672_0052097_1196_2032 278
195 3300048903 Ga0496100_0000002 Ga0496100_0000002_453942_454778 278
196 3300048904 Ga0496101_0000001 Ga0496101_0000001_453942_454778 278
197 3300048907 Ga0496104_0000009 Ga0496104_0000009_313837_314673 278
198 3300048908 Ga0496105_0000007 Ga0496105_0000007_173383_174219 278
199 3300048909 Ga0496106_0000084 Ga0496106_0000084_34252_35088 278
200 3300048909 Ga0496106_0000151 Ga0496106_0000151_26305_27141 278
201 3300048910 Ga0496107_0000003 Ga0496107_0000003_102685_103521 278
202 3300048911 Ga0496108_0000001 Ga0496108_0000001_749369_750205 278
203 3300048912 Ga0496109_0000004 Ga0496109_0000004_3180_4016 278
204 3300053084 Ga0495595_0092836 Ga0495595_0092836_582_1418 278
205 3300053085 Ga0495619_0034250 Ga0495619_0034250_2094_2930 278
206 3300005338 Ga0068868_100086998 Ga0068868_1000869983 279
207 3300005444 Ga0070694_100530442 Ga0070694_1005304421 279
208 3300005457 Ga0070662_100000004 Ga0070662_100000004174 279
209 3300005535 Ga0070684_100041448 Ga0070684_1000414483 279
210 3300005547 Ga0070693_100001714 Ga0070693_1000017143 279
211 3300005842 Ga0068858_100000065 Ga0068858_10000006559 279
212 3300025933 Ga0207706_10000012 Ga0207706_1000001244 279
213 3300025934 Ga0207686_10128430 Ga0207686_101284302 279
214 3300026023 Ga0207677_10000674 Ga0207677_100006742 279
215 3300026035 Ga0207703_10000018 Ga0207703_1000001859 279
216 3300037312 Ga0395899_0000004 Ga0395899_0000004_678217_679122 279
217 3300037853 Ga0436364_0659506 Ga0436364_0659506_1850_2698 279
218 3300046463 Ga0495653_0247143 Ga0495653_0247143_63_902 279
219 3300046516 Ga0495628_0036380 Ga0495628_0036380_2130_2969 279
220 3300046615 Ga0495656_0001289 Ga0495656_0001289_272_1111 279
221 3300046683 Ga0495658_0158439 Ga0495658_0158439_150_989 279
222 3300047322 Ga0495680_0020516 Ga0495680_0020516_3538_4377 279
223 3300047322 Ga0495680_0126760 Ga0495680_0126760_140_982 279
224 3300047673 Ga0495593_0207491 Ga0495593_0207491_81_920 279
225 3300048911 Ga0496108_0039282 Ga0496108_0039282_68_907 279
226 3300048913 Ga0496110_0028120 Ga0496110_0028120_3586_4425 279
227 3300048914 Ga0496111_0002911 Ga0496111_0002911_7341_8180 279
228 3300048915 Ga0496112_0070023 Ga0496112_0070023_2199_3038 279
229 3300049578 Ga0501042_0018304 Ga0501042_0018304_1165_2007 279
230 3300053077 Ga0495601_0049256 Ga0495601_0049256_1077_1916 279
231 3300053078 Ga0495612_0006638 Ga0495612_0006638_2213_3052 279
232 3300053085 Ga0495619_0000025 Ga0495619_0000025_144085_144978 279
233 3300005356 Ga0070674_100000090 Ga0070674_1000000906 280
234 3300005618 Ga0068864_100000053 Ga0068864_100000053122 280
235 3300005718 Ga0068866_10005814 Ga0068866_100058146 280
236 3300006852 Ga0075433_10000597 Ga0075433_1000059732 280
237 3300009148 Ga0105243_10275657 Ga0105243_102756571 280
238 3300009176 Ga0105242_10019161 Ga0105242_100191616 280
239 3300025899 Ga0207642_10000525 Ga0207642_1000052513 280
240 3300025937 Ga0207669_10000096 Ga0207669_100000967 280
241 3300026095 Ga0207676_10000195 Ga0207676_1000019552 280
242 3300046455 Ga0495603_0006970 Ga0495603_0006970_912_1802 280
243 3300046459 Ga0495629_0043355 Ga0495629_0043355_746_1594 280
244 3300046514 Ga0495618_0233108 Ga0495618_0233108_217_1065 280
245 3300046529 Ga0495652_0044654 Ga0495652_0044654_1505_2353 280
246 3300046543 Ga0495645_0007267 Ga0495645_0007267_4495_5343 280
247 3300046678 Ga0495599_0087189 Ga0495599_0087189_889_1737 280
248 3300002239 JGI24034J26672_10000135 JGI24034J26672_100001352 282
249 3300002244 JGI24742J22300_10005289 JGI24742J22300_100052891 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

47

266

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8399 3 265
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.8232 3 268
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8208 3 267
5eh9-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8198 3 267
5eht-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8187 3 268
ID Description Score Start End Superfamily
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9478 1 271 3.60.15.10
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9407 1 271 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8247 2 265 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7937 2 265 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7809 2 263 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A507W876-F1-model_v4 MBL fold metallo-hydrolase 0.9905 2 268 GO:0016787
AF-A0A4R6RQZ9-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9848 2 281 GO:0016787
AF-A0A1Y5GVN2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9774 2 270
AF-A0A6M2BRX8-F1-model_v4 MBL fold metallo-hydrolase 0.9771 1 271 GO:0016787
AF-A0A4R6RQZ9-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9745 2 281 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.19 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map