F360767

General Info

Members Datasets Scaffolds Average Seq Length
249 160 249 113

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_11519744|Ga0163161_115197442
Length 108
Sequence MDSPLALIEFPADDAERARDFWTGLLGLELEPRTAGEGEGWQTRSDGAAGDSFSLPYFEVRDLPAALTKVQTLGGTVIHPGERWAICKDSEGSPFALAEESARRLRGA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
96 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 8.84
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10100363 3300003203 Bacteria 864
2 Ga0070682_100464744 3300005337 Bacteria 972
3 Ga0068868_100410354 3300005338 Bacteria 1171
4 Ga0068868_101132426 3300005338 Bacteria 721
5 Ga0070687_100369045 3300005343 Bacteria 931
6 Ga0070668_100488701 3300005347 Unclassified 1064
7 Ga0070671_100913415 3300005355 Bacteria 767
8 Ga0070674_100026161 3300005356 Bacteria 3808
9 Ga0070674_100166310 3300005356 Bacteria 1678
10 Ga0070659_100017976 3300005366 Bacteria 5328
11 Ga0070659_100293602 3300005366 Bacteria 1354
12 Ga0070659_100666111 3300005366 Unclassified 898
13 Ga0070713_100444326 3300005436 Unclassified 1217
14 Ga0070701_10318271 3300005438 Unclassified 962
15 Ga0070711_100759982 3300005439 Bacteria 820
16 Ga0070700_100112798 3300005441 Bacteria 1810
17 Ga0070663_100172022 3300005455 Bacteria 1675
18 Ga0070678_101273283 3300005456 Bacteria 684
19 Ga0068867_100012643 3300005459 Bacteria 5969
20 Ga0070698_101501926 3300005471 Unclassified 625
21 Ga0070686_100548204 3300005544 Unclassified 904
22 Ga0070686_100851471 3300005544 Unclassified 738
23 Ga0070704_100369974 3300005549 Bacteria 1215
24 Ga0070704_100710341 3300005549 Unclassified 892
25 Ga0070704_100914641 3300005549 Bacteria 790
26 Ga0070704_101671783 3300005549 Bacteria 588
27 Ga0068854_100070187 3300005578 Bacteria 2560
28 Ga0068854_100989457 3300005578 Bacteria 744
29 Ga0068856_101979029 3300005614 Unclassified 593
30 Ga0070702_100052486 3300005615 Bacteria 2338
31 Ga0068852_100042668 3300005616 Bacteria 3841
32 Ga0068859_100452509 3300005617 Bacteria 1380
33 Ga0068866_10038732 3300005718 Bacteria 2350
34 Ga0068866_10146370 3300005718 Bacteria 1363
35 Ga0068866_10695853 3300005718 Bacteria 697
36 Ga0068861_100546348 3300005719 Bacteria 1055
37 Ga0068861_101202300 3300005719 Unclassified 733
38 Ga0068870_10355367 3300005840 Bacteria 941
39 Ga0068858_100211009 3300005842 Bacteria 1837
40 Ga0068858_100290294 3300005842 Bacteria 1559
41 Ga0068862_100100747 3300005844 Bacteria 2526
42 Ga0081455_10014394 3300005937 Bacteria 7760
43 Ga0081455_10215892 3300005937 Bacteria 1426
44 Ga0081540_1000553 3300005983 Bacteria 36267
45 Ga0081539_10002804 3300005985 Bacteria 23293
46 Ga0075365_10002829 3300006038 Bacteria 8699
47 Ga0075365_10020348 3300006038 Bacteria 4114
48 Ga0075364_10051655 3300006051 Bacteria 2686
49 Ga0075370_10647944 3300006353 Bacteria 641
50 Ga0068871_100086946 3300006358 Bacteria 2598
51 Ga0075431_101230695 3300006847 Bacteria 711
52 Ga0075433_10434196 3300006852 Bacteria 1158
53 Ga0075433_10808387 3300006852 Unclassified 819
54 Ga0075434_100405118 3300006871 Bacteria 1385
55 Ga0075429_100913446 3300006880 Bacteria 768
56 Ga0068865_100345855 3300006881 Bacteria 1203
57 Ga0068865_100629314 3300006881 Bacteria 910
58 Ga0097620_100452539 3300006931 Bacteria 1380
59 Ga0075435_100196795 3300007076 Unclassified 1707
60 Ga0075435_100296123 3300007076 Unclassified 1383
61 Ga0111539_10007427 3300009094 Bacteria 14048
62 Ga0111539_10370795 3300009094 Bacteria 1666
63 Ga0111539_10955111 3300009094 Bacteria 997
64 Ga0105245_10341694 3300009098 Bacteria 1481
65 Ga0114129_10055498 3300009147 Bacteria 5551
66 Ga0114129_10083896 3300009147 Bacteria 4424
67 Ga0114129_10474239 3300009147 Unclassified 1638
68 Ga0114129_10596765 3300009147 Bacteria 1431
69 Ga0114129_11597456 3300009147 Bacteria 798
70 Ga0114129_11686791 3300009147 Bacteria 774
71 Ga0105243_10024340 3300009148 Bacteria 4617
72 Ga0105243_10827684 3300009148 Bacteria 915
73 Ga0105243_11052798 3300009148 Bacteria 819
74 Ga0105237_11610212 3300009545 Bacteria 656
75 Ga0105238_11562395 3300009551 Bacteria 689
76 Ga0105249_10078101 3300009553 Bacteria 3071
77 Ga0105249_10685233 3300009553 Bacteria 1084
78 Ga0105249_11104375 3300009553 Unclassified 863
79 Ga0105249_11383837 3300009553 Bacteria 775
80 Ga0105239_10247150 3300010375 Bacteria 2003
81 Ga0105239_10661168 3300010375 Bacteria 1194
82 Ga0105239_12039339 3300010375 Bacteria 666
83 Ga0157369_10821492 3300013105 Bacteria 954
84 Ga0157378_11240168 3300013297 Bacteria 786
85 Ga0163162_10129953 3300013306 Bacteria 2627
86 Ga0163162_10136921 3300013306 Bacteria 2560
87 Ga0157375_10002217 3300013308 Bacteria 16813
88 Ga0157375_10672807 3300013308 Bacteria 1190
89 Ga0157375_11158864 3300013308 Bacteria 906
90 Ga0157380_10319701 3300014326 Bacteria 1438
91 Ga0157380_10837344 3300014326 Unclassified 940
92 Ga0157379_10003295 3300014968 Bacteria 13665
93 Ga0157379_11052234 3300014968 Bacteria 778
94 Ga0163161_11519744 3300017792 Bacteria 588
95 Ga0207692_10265603 3300025898 Bacteria 1033
96 Ga0207642_10022503 3300025899 Bacteria 2501
97 Ga0207642_10078608 3300025899 Bacteria 1595
98 Ga0207688_10198244 3300025901 Bacteria 1203
99 Ga0207645_10083299 3300025907 Bacteria 2051
100 Ga0207662_10319893 3300025918 Bacteria 1036
101 Ga0207690_10699171 3300025932 Unclassified 833
102 Ga0207690_10883011 3300025932 Bacteria 741
103 Ga0207706_10156729 3300025933 Bacteria 2002
104 Ga0207686_10289330 3300025934 Bacteria 1213
105 Ga0207709_10148205 3300025935 Bacteria 1622
106 Ga0207709_10343445 3300025935 Bacteria 1124
107 Ga0207669_10047216 3300025937 Bacteria 2549
108 Ga0207704_10220703 3300025938 Bacteria 1402
109 Ga0207665_10321872 3300025939 Bacteria 1160
110 Ga0207689_10030765 3300025942 Bacteria 4473
111 Ga0207679_10650502 3300025945 Bacteria 953
112 Ga0207712_10107245 3300025961 Bacteria 2088
113 Ga0207712_10174117 3300025961 Bacteria 1685
114 Ga0207712_10646957 3300025961 Bacteria 918
115 Ga0207712_10841765 3300025961 Unclassified 808
116 Ga0207668_10145135 3300025972 Bacteria 1830
117 Ga0207668_10330718 3300025972 Bacteria 1268
118 Ga0207640_10148970 3300025981 Bacteria 1717
119 Ga0207640_11560493 3300025981 Unclassified 594
120 Ga0207677_10807315 3300026023 Bacteria 840
121 Ga0207703_10641689 3300026035 Bacteria 1007
122 Ga0207703_10707701 3300026035 Bacteria 958
123 Ga0207678_10205502 3300026067 Bacteria 1685
124 Ga0207708_10125214 3300026075 Bacteria 2005
125 Ga0207702_10876483 3300026078 Bacteria 889
126 Ga0207702_12231670 3300026078 Unclassified 536
127 Ga0207648_10046716 3300026089 Bacteria 3796
128 Ga0207648_11452459 3300026089 Unclassified 645
129 Ga0207675_100017755 3300026118 Bacteria 6637
130 Ga0207675_100046026 3300026118 Bacteria 4076
131 Ga0207675_101530280 3300026118 Unclassified 688
132 Ga0207698_10669448 3300026142 Bacteria 1030
133 Ga0268266_10303174 3300028379 Bacteria 1491
134 Ga0268266_11240856 3300028379 Bacteria 721
135 Ga0268265_10113580 3300028380 Bacteria 2216
136 Ga0268264_10088045 3300028381 Bacteria 2671
137 Ga0307405_11260308 3300031731 Unclassified 642
138 Ga0316583_10110368 3300032133 Bacteria 959
139 Ga0316582_0425269 3300036647 Bacteria 915
140 Ga0395899_0159089 3300037312 Bacteria 1597
141 Ga0395900_0086870 3300037418 Bacteria 3214
142 Ga0395900_0410206 3300037418 Bacteria 1317
143 Ga0395900_0669878 3300037418 Bacteria 973
144 Ga0395898_0030501 3300037466 Bacteria 5396
145 Ga0395898_0089159 3300037466 Bacteria 2968
146 Ga0395898_0403196 3300037466 Bacteria 1304
147 Ga0395905_0015425 3300037471 Bacteria 7263
148 Ga0395901_0007454 3300038443 Bacteria 11043
149 Ga0395901_0021200 3300038443 Bacteria 6655
150 Ga0395901_0340000 3300038443 Bacteria 1551
151 Ga0436360_0995496 3300039438 Bacteria 531
152 Ga0451800_1185541 3300041459 Bacteria 976
153 Ga0451804_1174322 3300041463 Unclassified 646
154 Ga0451807_2137082 3300041486 Bacteria 514
155 Ga0451853_2335107 3300041512 Bacteria 1716
156 Ga0451853_3250686 3300041512 Bacteria 641
157 Ga0466960_0024678 3300044901 Bacteria 2715
158 Ga0466959_0257517 3300045049 Bacteria 1202
159 Ga0466958_0108599 3300045836 Bacteria 1731
160 Ga0466967_0420176 3300045976 Unclassified 1303
161 Ga0495653_0690909 3300046463 Bacteria 620
162 Ga0495653_0752984 3300046463 Bacteria 588
163 Ga0495653_0871225 3300046463 Unclassified 538
164 Ga0495639_0270655 3300046475 Bacteria 843
165 Ga0495662_0403363 3300046476 Bacteria 671
166 Ga0495628_0018580 3300046516 Bacteria 5756
167 Ga0495630_0165409 3300046517 Bacteria 1684
168 Ga0495645_0135964 3300046543 Bacteria 1719
169 Ga0495667_0123366 3300046559 Bacteria 1672
170 Ga0495634_0565348 3300046642 Unclassified 662
171 Ga0495625_0000095 3300046660 Bacteria 143468
172 Ga0495635_0079840 3300046663 Bacteria 2239
173 Ga0495646_0326631 3300046680 Bacteria 807
174 Ga0495658_0233436 3300046683 Bacteria 1154
175 Ga0495676_0011995 3300047321 Bacteria 7816
176 Ga0495676_0786938 3300047321 Bacteria 613
177 Ga0495680_0092769 3300047322 Bacteria 2261
178 Ga0495680_0391392 3300047322 Bacteria 961
179 Ga0495602_0425692 3300048088 Unclassified 942
180 Ga0496100_0000001 3300048903 Bacteria 530179
181 Ga0496100_0739286 3300048903 Bacteria 769
182 Ga0496100_0932128 3300048903 Unclassified 682
183 Ga0496101_0000028 3300048904 Bacteria 198664
184 Ga0496101_0524369 3300048904 Bacteria 936
185 Ga0496101_1557037 3300048904 Unclassified 514
186 Ga0496104_0728646 3300048907 Bacteria 899
187 Ga0496106_0000055 3300048909 Bacteria 91570
188 Ga0496106_0143344 3300048909 Bacteria 1880
189 Ga0496106_0567536 3300048909 Bacteria 910
190 Ga0496107_0000002 3300048910 Bacteria 320871
191 Ga0496108_0342216 3300048911 Bacteria 1305
192 Ga0496108_0795785 3300048911 Bacteria 816
193 Ga0496110_0418078 3300048913 Unclassified 1222
194 Ga0496110_1840800 3300048913 Unclassified 515
195 Ga0496111_0113339 3300048914 Bacteria 1998
196 Ga0496113_1003019 3300048916 Bacteria 657
197 Ga0496114_0396539 3300048917 Bacteria 1222
198 Ga0496115_0000016 3300048918 Bacteria 187067
199 Ga0501031_0246748 3300049568 Unclassified 1161
200 Ga0501033_0634504 3300049570 Bacteria 731
201 Ga0501033_0780795 3300049570 Unclassified 647
202 Ga0501033_1016588 3300049570 Bacteria 554
203 Ga0501036_0560689 3300049572 Unclassified 949
204 Ga0501040_0632702 3300049576 Bacteria 773
205 Ga0501041_0481182 3300049577 Unclassified 789
206 Ga0501046_1069186 3300049580 Unclassified 558
207 Ga0501048_0468988 3300049582 Bacteria 902
208 Ga0501071_0260489 3300049587 Unclassified 1310
209 Ga0501071_0283936 3300049587 Unclassified 1253
210 Ga0501072_0391666 3300049588 Unclassified 1102
211 Ga0501072_0808472 3300049588 Bacteria 734
212 Ga0501075_1128106 3300049591 Unclassified 595
213 Ga0501076_0249574 3300049592 Unclassified 1452
214 Ga0501076_0258419 3300049592 Bacteria 1426
215 Ga0501076_1502515 3300049592 Bacteria 553
216 Ga0501079_0521266 3300049741 Unclassified 934
217 Ga0501079_0538451 3300049741 Unclassified 918
218 Ga0501035_0445452 3300049822 Bacteria 1072
219 Ga0501045_0300291 3300049824 Bacteria 1195
220 nmdc:mga00v17_297506_c1 3300050491 Bacteria 1048
221 nmdc:mga00v17_61719_c1 3300050491 Bacteria 2304
222 nmdc:mga0yw44_201480_c1 3300050492 Bacteria 1314
223 nmdc:mga07m45_576407_c1 3300050496 Bacteria 650
224 nmdc:mga05p37_1354850_c1 3300050507 Bacteria 720
225 nmdc:mga05p37_144456_c1 3300050507 Bacteria 2914
226 nmdc:mga05p37_814099_c1 3300050507 Bacteria 1020
227 nmdc:mga0qj67_442388_c1 3300050509 Bacteria 1047
228 nmdc:mga06r32_55709_c1 3300050510 Bacteria 3794
229 nmdc:mga08y16_103390_c1 3300050511 Bacteria 2966
230 nmdc:mga08y16_383095_c1 3300050511 Unclassified 1441
231 nmdc:mga0n895_2037416_c1 3300050512 Bacteria 531
232 nmdc:mga0n895_219941_c1 3300050512 Bacteria 1928
233 nmdc:mga0n895_397294_c1 3300050512 Bacteria 1394
234 nmdc:mga0rr50_745564_c1 3300050513 Unclassified 836
235 nmdc:mga0a205_93705_c1 3300050515 Bacteria 2901
236 Ga0495601_0076236 3300053077 Unclassified 2147
237 Ga0495601_0229602 3300053077 Bacteria 1212
238 Ga0495612_0000553 3300053078 Bacteria 15041
239 Ga0495619_0000445 3300053085 Bacteria 27838
240 Ga0495619_0001777 3300053085 Bacteria 14331
241 Ga0495619_0055428 3300053085 Unclassified 2625
242 Ga0495619_0097379 3300053085 Bacteria 1999
243 Ga0500641_0014205 3300053096 Bacteria 2936
244 Ga0500556_0006607 3300053104 Bacteria 3297
245 Ga0500616_0002751 3300053153 Bacteria 14208
246 Ga0501082_0640680 3300060353 Unclassified 930
247 Ga0530510_0099035 3300061734 Bacteria 2131
248 Ga0530510_0173862 3300061734 Unclassified 1596
249 Ga0530510_0793993 3300061734 Bacteria 722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100026161 Ga0070674_1000261614 96
2 3300005459 Ga0068867_100012643 Ga0068867_1000126433 96
3 3300005718 Ga0068866_10695853 Ga0068866_106958532 96
4 3300005719 Ga0068861_101202300 Ga0068861_1012023002 96
5 3300006881 Ga0068865_100629314 Ga0068865_1006293142 96
6 3300009148 Ga0105243_10827684 Ga0105243_108276842 96
7 3300013297 Ga0157378_11240168 Ga0157378_112401682 96
8 3300025899 Ga0207642_10078608 Ga0207642_100786082 96
9 3300025935 Ga0207709_10343445 Ga0207709_103434453 96
10 3300025937 Ga0207669_10047216 Ga0207669_100472163 96
11 3300026089 Ga0207648_10046716 Ga0207648_100467163 96
12 3300026118 Ga0207675_101530280 Ga0207675_1015302802 96
13 3300010375 Ga0105239_10661168 Ga0105239_106611681 97
14 3300017792 Ga0163161_11519744 Ga0163161_115197442 100
15 3300005436 Ga0070713_100444326 Ga0070713_1004443262 107
16 3300032133 Ga0316583_10110368 Ga0316583_101103682 107
17 3300036647 Ga0316582_0425269 Ga0316582_0425269_136_468 107
18 3300046660 Ga0495625_0000095 Ga0495625_0000095_55850_56173 107
19 3300053096 Ga0500641_0014205 Ga0500641_0014205_2572_2895 107
20 3300005439 Ga0070711_100759982 Ga0070711_1007599822 108
21 3300007076 Ga0075435_100196795 Ga0075435_1001967952 108
22 3300009094 Ga0111539_10955111 Ga0111539_109551113 108
23 3300014968 Ga0157379_10003295 Ga0157379_1000329513 108
24 3300039438 Ga0436360_0995496 Ga0436360_0995496_11_343 108
25 3300046463 Ga0495653_0690909 Ga0495653_0690909_246_572 108
26 3300046516 Ga0495628_0018580 Ga0495628_0018580_4426_4752 108
27 3300046642 Ga0495634_0565348 Ga0495634_0565348_94_420 108
28 3300046680 Ga0495646_0326631 Ga0495646_0326631_417_743 108
29 3300048088 Ga0495602_0425692 Ga0495602_0425692_102_428 108
30 3300049588 Ga0501072_0808472 Ga0501072_0808472_43_369 108
31 3300050512 nmdc:mga0n895_2037416_c1 nmdc:mga0n895_2037416_c1_135_461 108
32 3300053078 Ga0495612_0000553 Ga0495612_0000553_4766_5092 108
33 3300053085 Ga0495619_0055428 Ga0495619_0055428_1123_1449 108
34 3300005544 Ga0070686_100548204 Ga0070686_1005482042 109
35 3300006038 Ga0075365_10002829 Ga0075365_100028292 109
36 3300006051 Ga0075364_10051655 Ga0075364_100516552 109
37 3300013306 Ga0163162_10129953 Ga0163162_101299535 109
38 3300013308 Ga0157375_10002217 Ga0157375_100022176 109
39 3300041512 Ga0451853_3250686 Ga0451853_3250686_51_380 109
40 3300048903 Ga0496100_0932128 Ga0496100_0932128_110_439 109
41 3300048904 Ga0496101_1557037 Ga0496101_1557037_66_395 109
42 3300049568 Ga0501031_0246748 Ga0501031_0246748_727_1086 109
43 3300049570 Ga0501033_0634504 Ga0501033_0634504_305_664 109
44 3300049582 Ga0501048_0468988 Ga0501048_0468988_118_477 109
45 3300049587 Ga0501071_0260489 Ga0501071_0260489_14_373 109
46 3300049588 Ga0501072_0391666 Ga0501072_0391666_590_949 109
47 3300049592 Ga0501076_0249574 Ga0501076_0249574_233_592 109
48 3300049592 Ga0501076_1502515 Ga0501076_1502515_143_481 109
49 3300049741 Ga0501079_0538451 Ga0501079_0538451_147_506 109
50 3300049822 Ga0501035_0445452 Ga0501035_0445452_684_1043 109
51 3300049824 Ga0501045_0300291 Ga0501045_0300291_671_1030 109
52 3300050491 nmdc:mga00v17_61719_c1 nmdc:mga00v17_61719_c1_460_789 109
53 3300060353 Ga0501082_0640680 Ga0501082_0640680_420_779 109
54 3300061734 Ga0530510_0099035 Ga0530510_0099035_1595_1954 109
55 3300003203 JGI25406J46586_10100363 JGI25406J46586_101003632 110
56 3300005337 Ga0070682_100464744 Ga0070682_1004647441 110
57 3300005338 Ga0068868_100410354 Ga0068868_1004103541 110
58 3300005338 Ga0068868_101132426 Ga0068868_1011324261 110
59 3300005343 Ga0070687_100369045 Ga0070687_1003690451 110
60 3300005347 Ga0070668_100488701 Ga0070668_1004887012 110
61 3300005355 Ga0070671_100913415 Ga0070671_1009134151 110
62 3300005356 Ga0070674_100166310 Ga0070674_1001663102 110
63 3300005366 Ga0070659_100017976 Ga0070659_1000179765 110
64 3300005366 Ga0070659_100293602 Ga0070659_1002936022 110
65 3300005366 Ga0070659_100666111 Ga0070659_1006661112 110
66 3300005438 Ga0070701_10318271 Ga0070701_103182711 110
67 3300005441 Ga0070700_100112798 Ga0070700_1001127982 110
68 3300005455 Ga0070663_100172022 Ga0070663_1001720223 110
69 3300005456 Ga0070678_101273283 Ga0070678_1012732831 110
70 3300005471 Ga0070698_101501926 Ga0070698_1015019261 110
71 3300005544 Ga0070686_100851471 Ga0070686_1008514712 110
72 3300005549 Ga0070704_100369974 Ga0070704_1003699742 110
73 3300005549 Ga0070704_100710341 Ga0070704_1007103412 110
74 3300005549 Ga0070704_100914641 Ga0070704_1009146411 110
75 3300005549 Ga0070704_101671783 Ga0070704_1016717831 110
76 3300005578 Ga0068854_100070187 Ga0068854_1000701872 110
77 3300005578 Ga0068854_100989457 Ga0068854_1009894571 110
78 3300005614 Ga0068856_101979029 Ga0068856_1019790291 110
79 3300005615 Ga0070702_100052486 Ga0070702_1000524862 110
80 3300005616 Ga0068852_100042668 Ga0068852_1000426684 110
81 3300005617 Ga0068859_100452509 Ga0068859_1004525092 110
82 3300005718 Ga0068866_10038732 Ga0068866_100387322 110
83 3300005718 Ga0068866_10146370 Ga0068866_101463701 110
84 3300005719 Ga0068861_100546348 Ga0068861_1005463482 110
85 3300005840 Ga0068870_10355367 Ga0068870_103553672 110
86 3300005842 Ga0068858_100211009 Ga0068858_1002110091 110
87 3300005842 Ga0068858_100290294 Ga0068858_1002902942 110
88 3300005844 Ga0068862_100100747 Ga0068862_1001007472 110
89 3300005937 Ga0081455_10014394 Ga0081455_100143947 110
90 3300005937 Ga0081455_10215892 Ga0081455_102158922 110
91 3300005983 Ga0081540_1000553 Ga0081540_10005533 110
92 3300005985 Ga0081539_10002804 Ga0081539_1000280426 110
93 3300006038 Ga0075365_10020348 Ga0075365_100203485 110
94 3300006353 Ga0075370_10647944 Ga0075370_106479442 110
95 3300006358 Ga0068871_100086946 Ga0068871_1000869462 110
96 3300006847 Ga0075431_101230695 Ga0075431_1012306952 110
97 3300006852 Ga0075433_10434196 Ga0075433_104341962 110
98 3300006852 Ga0075433_10808387 Ga0075433_108083872 110
99 3300006871 Ga0075434_100405118 Ga0075434_1004051182 110
100 3300006880 Ga0075429_100913446 Ga0075429_1009134462 110
101 3300006881 Ga0068865_100345855 Ga0068865_1003458553 110
102 3300006931 Ga0097620_100452539 Ga0097620_1004525392 110
103 3300007076 Ga0075435_100296123 Ga0075435_1002961231 110
104 3300009094 Ga0111539_10007427 Ga0111539_100074276 110
105 3300009094 Ga0111539_10370795 Ga0111539_103707953 110
106 3300009098 Ga0105245_10341694 Ga0105245_103416943 110
107 3300009147 Ga0114129_10055498 Ga0114129_100554985 110
108 3300009147 Ga0114129_10083896 Ga0114129_100838966 110
109 3300009147 Ga0114129_10474239 Ga0114129_104742392 110
110 3300009147 Ga0114129_10596765 Ga0114129_105967652 110
111 3300009147 Ga0114129_11597456 Ga0114129_115974562 110
112 3300009147 Ga0114129_11686791 Ga0114129_116867912 110
113 3300009148 Ga0105243_10024340 Ga0105243_100243408 110
114 3300009148 Ga0105243_11052798 Ga0105243_110527982 110
115 3300009545 Ga0105237_11610212 Ga0105237_116102122 110
116 3300009551 Ga0105238_11562395 Ga0105238_115623951 110
117 3300009553 Ga0105249_10078101 Ga0105249_100781014 110
118 3300009553 Ga0105249_10685233 Ga0105249_106852332 110
119 3300009553 Ga0105249_11104375 Ga0105249_111043751 110
120 3300009553 Ga0105249_11383837 Ga0105249_113838371 110
121 3300010375 Ga0105239_10247150 Ga0105239_102471502 110
122 3300010375 Ga0105239_12039339 Ga0105239_120393391 110
123 3300013105 Ga0157369_10821492 Ga0157369_108214922 110
124 3300013306 Ga0163162_10136921 Ga0163162_101369212 110
125 3300013308 Ga0157375_10672807 Ga0157375_106728073 110
126 3300013308 Ga0157375_11158864 Ga0157375_111588642 110
127 3300014326 Ga0157380_10319701 Ga0157380_103197012 110
128 3300014326 Ga0157380_10837344 Ga0157380_108373442 110
129 3300014968 Ga0157379_11052234 Ga0157379_110522341 110
130 3300025898 Ga0207692_10265603 Ga0207692_102656031 110
131 3300025899 Ga0207642_10022503 Ga0207642_100225032 110
132 3300025901 Ga0207688_10198244 Ga0207688_101982442 110
133 3300025907 Ga0207645_10083299 Ga0207645_100832993 110
134 3300025918 Ga0207662_10319893 Ga0207662_103198931 110
135 3300025932 Ga0207690_10699171 Ga0207690_106991712 110
136 3300025932 Ga0207690_10883011 Ga0207690_108830112 110
137 3300025933 Ga0207706_10156729 Ga0207706_101567291 110
138 3300025934 Ga0207686_10289330 Ga0207686_102893302 110
139 3300025935 Ga0207709_10148205 Ga0207709_101482053 110
140 3300025938 Ga0207704_10220703 Ga0207704_102207033 110
141 3300025939 Ga0207665_10321872 Ga0207665_103218721 110
142 3300025942 Ga0207689_10030765 Ga0207689_100307654 110
143 3300025945 Ga0207679_10650502 Ga0207679_106505022 110
144 3300025961 Ga0207712_10107245 Ga0207712_101072454 110
145 3300025961 Ga0207712_10174117 Ga0207712_101741171 110
146 3300025961 Ga0207712_10646957 Ga0207712_106469571 110
147 3300025961 Ga0207712_10841765 Ga0207712_108417652 110
148 3300025972 Ga0207668_10145135 Ga0207668_101451351 110
149 3300025972 Ga0207668_10330718 Ga0207668_103307182 110
150 3300025981 Ga0207640_10148970 Ga0207640_101489702 110
151 3300025981 Ga0207640_11560493 Ga0207640_115604932 110
152 3300026023 Ga0207677_10807315 Ga0207677_108073151 110
153 3300026035 Ga0207703_10641689 Ga0207703_106416892 110
154 3300026035 Ga0207703_10707701 Ga0207703_107077012 110
155 3300026067 Ga0207678_10205502 Ga0207678_102055022 110
156 3300026075 Ga0207708_10125214 Ga0207708_101252142 110
157 3300026078 Ga0207702_10876483 Ga0207702_108764832 110
158 3300026078 Ga0207702_12231670 Ga0207702_122316701 110
159 3300026089 Ga0207648_11452459 Ga0207648_114524591 110
160 3300026118 Ga0207675_100017755 Ga0207675_1000177551 110
161 3300026118 Ga0207675_100046026 Ga0207675_1000460263 110
162 3300026142 Ga0207698_10669448 Ga0207698_106694482 110
163 3300028379 Ga0268266_10303174 Ga0268266_103031743 110
164 3300028379 Ga0268266_11240856 Ga0268266_112408562 110
165 3300028380 Ga0268265_10113580 Ga0268265_101135802 110
166 3300028381 Ga0268264_10088045 Ga0268264_100880453 110
167 3300031731 Ga0307405_11260308 Ga0307405_112603082 110
168 3300037312 Ga0395899_0159089 Ga0395899_0159089_119_517 110
169 3300037418 Ga0395900_0086870 Ga0395900_0086870_731_1129 110
170 3300037418 Ga0395900_0410206 Ga0395900_0410206_643_984 110
171 3300037418 Ga0395900_0669878 Ga0395900_0669878_159_491 110
172 3300037466 Ga0395898_0030501 Ga0395898_0030501_4746_5087 110
173 3300037466 Ga0395898_0089159 Ga0395898_0089159_1786_2184 110
174 3300037466 Ga0395898_0403196 Ga0395898_0403196_408_740 110
175 3300037471 Ga0395905_0015425 Ga0395905_0015425_3657_4055 110
176 3300038443 Ga0395901_0007454 Ga0395901_0007454_9861_10259 110
177 3300038443 Ga0395901_0021200 Ga0395901_0021200_3133_3474 110
178 3300038443 Ga0395901_0340000 Ga0395901_0340000_462_794 110
179 3300041459 Ga0451800_1185541 Ga0451800_1185541_374_706 110
180 3300041463 Ga0451804_1174322 Ga0451804_1174322_53_385 110
181 3300041486 Ga0451807_2137082 Ga0451807_2137082_169_501 110
182 3300041512 Ga0451853_2335107 Ga0451853_2335107_757_1089 110
183 3300044901 Ga0466960_0024678 Ga0466960_0024678_1226_1567 110
184 3300045049 Ga0466959_0257517 Ga0466959_0257517_337_681 110
185 3300045836 Ga0466958_0108599 Ga0466958_0108599_502_846 110
186 3300045976 Ga0466967_0420176 Ga0466967_0420176_172_513 110
187 3300046463 Ga0495653_0752984 Ga0495653_0752984_216_563 110
188 3300046463 Ga0495653_0871225 Ga0495653_0871225_24_365 110
189 3300046475 Ga0495639_0270655 Ga0495639_0270655_289_627 110
190 3300046476 Ga0495662_0403363 Ga0495662_0403363_19_360 110
191 3300046517 Ga0495630_0165409 Ga0495630_0165409_229_570 110
192 3300046543 Ga0495645_0135964 Ga0495645_0135964_285_626 110
193 3300046559 Ga0495667_0123366 Ga0495667_0123366_99_440 110
194 3300046663 Ga0495635_0079840 Ga0495635_0079840_1076_1417 110
195 3300046683 Ga0495658_0233436 Ga0495658_0233436_516_857 110
196 3300047321 Ga0495676_0011995 Ga0495676_0011995_5175_5507 110
197 3300047321 Ga0495676_0786938 Ga0495676_0786938_148_480 110
198 3300047322 Ga0495680_0092769 Ga0495680_0092769_1823_2164 110
199 3300047322 Ga0495680_0391392 Ga0495680_0391392_416_763 110
200 3300048903 Ga0496100_0000001 Ga0496100_0000001_133924_134262 110
201 3300048903 Ga0496100_0739286 Ga0496100_0739286_22_372 110
202 3300048904 Ga0496101_0000028 Ga0496101_0000028_133913_134251 110
203 3300048904 Ga0496101_0524369 Ga0496101_0524369_527_877 110
204 3300048907 Ga0496104_0728646 Ga0496104_0728646_120_461 110
205 3300048909 Ga0496106_0000055 Ga0496106_0000055_26843_27181 110
206 3300048909 Ga0496106_0143344 Ga0496106_0143344_281_631 110
207 3300048909 Ga0496106_0567536 Ga0496106_0567536_447_788 110
208 3300048910 Ga0496107_0000002 Ga0496107_0000002_114226_114564 110
209 3300048911 Ga0496108_0342216 Ga0496108_0342216_480_821 110
210 3300048911 Ga0496108_0795785 Ga0496108_0795785_149_490 110
211 3300048913 Ga0496110_0418078 Ga0496110_0418078_352_693 110
212 3300048913 Ga0496110_1840800 Ga0496110_1840800_162_503 110
213 3300048914 Ga0496111_0113339 Ga0496111_0113339_1289_1630 110
214 3300048916 Ga0496113_1003019 Ga0496113_1003019_240_578 110
215 3300048917 Ga0496114_0396539 Ga0496114_0396539_750_1082 110
216 3300048918 Ga0496115_0000016 Ga0496115_0000016_94035_94367 110
217 3300049570 Ga0501033_0780795 Ga0501033_0780795_87_422 110
218 3300049570 Ga0501033_1016588 Ga0501033_1016588_169_519 110
219 3300049572 Ga0501036_0560689 Ga0501036_0560689_386_736 110
220 3300049576 Ga0501040_0632702 Ga0501040_0632702_110_460 110
221 3300049577 Ga0501041_0481182 Ga0501041_0481182_309_659 110
222 3300049580 Ga0501046_1069186 Ga0501046_1069186_195_536 110
223 3300049587 Ga0501071_0283936 Ga0501071_0283936_272_622 110
224 3300049591 Ga0501075_1128106 Ga0501075_1128106_61_411 110
225 3300049592 Ga0501076_0258419 Ga0501076_0258419_667_1017 110
226 3300049741 Ga0501079_0521266 Ga0501079_0521266_458_808 110
227 3300050491 nmdc:mga00v17_297506_c1 nmdc:mga00v17_297506_c1_694_1038 110
228 3300050492 nmdc:mga0yw44_201480_c1 nmdc:mga0yw44_201480_c1_544_876 110
229 3300050496 nmdc:mga07m45_576407_c1 nmdc:mga07m45_576407_c1_234_566 110
230 3300050507 nmdc:mga05p37_1354850_c1 nmdc:mga05p37_1354850_c1_14_355 110
231 3300050507 nmdc:mga05p37_144456_c1 nmdc:mga05p37_144456_c1_1673_2017 110
232 3300050507 nmdc:mga05p37_814099_c1 nmdc:mga05p37_814099_c1_486_836 110
233 3300050509 nmdc:mga0qj67_442388_c1 nmdc:mga0qj67_442388_c1_93_443 110
234 3300050510 nmdc:mga06r32_55709_c1 nmdc:mga06r32_55709_c1_449_799 110
235 3300050511 nmdc:mga08y16_103390_c1 nmdc:mga08y16_103390_c1_1115_1465 110
236 3300050511 nmdc:mga08y16_383095_c1 nmdc:mga08y16_383095_c1_374_718 110
237 3300050512 nmdc:mga0n895_219941_c1 nmdc:mga0n895_219941_c1_1484_1834 110
238 3300050512 nmdc:mga0n895_397294_c1 nmdc:mga0n895_397294_c1_684_1022 110
239 3300050513 nmdc:mga0rr50_745564_c1 nmdc:mga0rr50_745564_c1_409_747 110
240 3300050515 nmdc:mga0a205_93705_c1 nmdc:mga0a205_93705_c1_2379_2729 110
241 3300053077 Ga0495601_0076236 Ga0495601_0076236_142_486 110
242 3300053077 Ga0495601_0229602 Ga0495601_0229602_212_553 110
243 3300053085 Ga0495619_0000445 Ga0495619_0000445_2193_2534 110
244 3300053085 Ga0495619_0001777 Ga0495619_0001777_10978_11319 110
245 3300053085 Ga0495619_0097379 Ga0495619_0097379_907_1254 110
246 3300053104 Ga0500556_0006607 Ga0500556_0006607_2858_3199 110
247 3300053153 Ga0500616_0002751 Ga0500616_0002751_5263_5604 110
248 3300061734 Ga0530510_0173862 Ga0530510_0173862_516_866 110
249 3300061734 Ga0530510_0793993 Ga0530510_0793993_221_562 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

90

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

98

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly2.cif.gz_B structure of hypothetical protein sa1046 from s. aureus. 0.7839 1 108
4pav-assembly2.cif.gz_B structure of hypothetical protein sa1046 from s. aureus. 0.7654 1 108
1r9c-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.7648 4 106
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.7587 1 107
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.7542 1 108
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8451 62 110 3.30.720.110
4rt5B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8085 63 107 3.10.180.10
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7822 65 108 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7515 59 106 3.30.720.120
af_P36161_55_479_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7508 82 97 2.130.10.10
ID Description Score Start End GO Terms
AF-S4YB19-F1-model_v4 Uncharacterized protein 0.9182 62 109
AF-A0A7T9RAA9-F1-model_v4 deleted 0.8606 5 107
AF-A0A534AGY9-F1-model_v4 VOC family protein 0.8581 65 110
AF-A0A835LPB9-F1-model_v4 Lactoylglutathione lyase 0.8551 62 110 GO:0004462
GO:0005737
GO:0019243
AF-A0A533B4A4-F1-model_v4 Glyoxalase 0.8353 57 110

Feature Viewer

pLDDT pTM Quality
90.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map