F360628

General Info

Members Datasets Scaffolds Average Seq Length
249 122 498 198

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10039194|Ga0075365_100391942
Length 235
Sequence MRRLLLPPLLVGLLALASCGDEEMAPSTSASGGKVEIAALGDSITAGSPLWDPEPAVREQLGSDADEQSQFEYWAEREDPSLAFNNCGIFGERTDEIARRLDACVATAGSGADVLIVQGGINDIAQGSSIDAAAANLQAMVEAGLDDGLEVAITDVLPWNNGHPGADAPIAELNEKIAAIAKREGVPLLPFHDTLEDPANPGTMKQQWTIDGDHPSVEGYRLLAEQAVLPNLPAG

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 9.64
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10039194 3300006038 Bacteria 3084
2 Ga0070658_10070606 3300005327 Bacteria 2860
3 Ga0070683_100015616 3300005329 Bacteria 6674
4 Ga0070683_100049931 3300005329 Bacteria 3871
5 Ga0070680_100008707 3300005336 Bacteria 7778
6 Ga0070680_100038387 3300005336 Bacteria 3873
7 Ga0070680_100376648 3300005336 Unclassified 1208
8 Ga0070680_100607894 3300005336 Bacteria 938
9 Ga0070680_100672823 3300005336 Bacteria 890
10 Ga0070682_100188640 3300005337 Bacteria 1446
11 Ga0070714_100005101 3300005435 Bacteria 9990
12 Ga0070714_100005294 3300005435 Bacteria 9835
13 Ga0070714_100052721 3300005435 Bacteria 3470
14 Ga0070714_100083115 3300005435 Bacteria 2791
15 Ga0070714_100179085 3300005435 Bacteria 1928
16 Ga0070714_100478127 3300005435 Bacteria 1186
17 Ga0070713_100455889 3300005436 Unclassified 1202
18 Ga0070710_10006517 3300005437 Bacteria 5612
19 Ga0070711_100333153 3300005439 Unclassified 1215
20 Ga0070694_100037264 3300005444 Bacteria 3225
21 Ga0070678_100772745 3300005456 Unclassified 870
22 Ga0070681_10082289 3300005458 Bacteria 3174
23 Ga0070681_10150477 3300005458 Bacteria 2254
24 Ga0070681_10280603 3300005458 Unclassified 1576
25 Ga0070679_100141162 3300005530 Bacteria 2388
26 Ga0070679_100148835 3300005530 Bacteria 2319
27 Ga0070679_100274563 3300005530 Bacteria 1639
28 Ga0070684_100242636 3300005535 Bacteria 1646
29 Ga0070695_100000053 3300005545 Bacteria 46304
30 Ga0070696_100272717 3300005546 Bacteria 1287
31 Ga0070693_100159693 3300005547 Bacteria 1435
32 Ga0068855_101186952 3300005563 Bacteria 794
33 Ga0070717_10018578 3300006028 Bacteria 5432
34 Ga0070717_10019937 3300006028 Bacteria 5266
35 Ga0070717_10026771 3300006028 Bacteria 4604
36 Ga0075365_10049040 3300006038 Bacteria 2781
37 Ga0075365_10176519 3300006038 Bacteria 1492
38 Ga0075365_10351117 3300006038 Bacteria 1040
39 Ga0075363_100046787 3300006048 Bacteria 2296
40 Ga0075364_10047076 3300006051 Bacteria 2808
41 Ga0075364_10131669 3300006051 Unclassified 1679
42 Ga0075364_10210589 3300006051 Viruses 1318
43 Ga0070715_10000838 3300006163 Bacteria 8440
44 Ga0070712_100452825 3300006175 Bacteria 1069
45 Ga0070712_100566134 3300006175 Bacteria 959
46 Ga0075434_100011651 3300006871 Bacteria 8304
47 Ga0105240_10023383 3300009093 Bacteria 8173
48 Ga0105240_10913758 3300009093 Bacteria 943
49 Ga0105245_10814689 3300009098 Bacteria 972
50 Ga0105237_10071105 3300009545 Bacteria 3475
51 Ga0157370_11074383 3300013104 Unclassified 727
52 Ga0157369_10121375 3300013105 Bacteria 2773
53 Ga0157372_10119081 3300013307 Bacteria 3031
54 Ga0157372_11279605 3300013307 Bacteria 847
55 Ga0182007_10095602 3300015262 Bacteria 980
56 Ga0206354_10834578 3300020081 Bacteria 1679
57 Ga0207692_10018508 3300025898 Bacteria 3129
58 Ga0207685_10003335 3300025905 Bacteria 3891
59 Ga0207705_10017340 3300025909 Bacteria 5156
60 Ga0207705_10181307 3300025909 Bacteria 1589
61 Ga0207707_10098258 3300025912 Bacteria 2559
62 Ga0207707_10253698 3300025912 Bacteria 1528
63 Ga0207695_10020978 3300025913 Bacteria 7465
64 Ga0207671_10042255 3300025914 Bacteria 3374
65 Ga0207671_10208682 3300025914 Bacteria 1527
66 Ga0207693_10001629 3300025915 Bacteria 19823
67 Ga0207693_10390322 3300025915 Bacteria 1088
68 Ga0207663_10006391 3300025916 Bacteria 6027
69 Ga0207660_10110830 3300025917 Bacteria 2065
70 Ga0207660_10111968 3300025917 Unclassified 2055
71 Ga0207660_10578352 3300025917 Bacteria 914
72 Ga0207660_10687435 3300025917 Bacteria 835
73 Ga0207657_10002870 3300025919 Bacteria 18525
74 Ga0207657_10009928 3300025919 Bacteria 9528
75 Ga0207649_10448402 3300025920 Bacteria 973
76 Ga0207652_10202620 3300025921 Bacteria 1786
77 Ga0207652_10220840 3300025921 Bacteria 1707
78 Ga0207652_10811902 3300025921 Bacteria 830
79 Ga0207694_10070312 3300025924 Bacteria 2734
80 Ga0207687_10402034 3300025927 Bacteria 1127
81 Ga0207700_10019769 3300025928 Bacteria 4556
82 Ga0207700_10589628 3300025928 Bacteria 989
83 Ga0207700_10685493 3300025928 Unclassified 914
84 Ga0207664_10050379 3300025929 Bacteria 3283
85 Ga0207664_10053362 3300025929 Bacteria 3199
86 Ga0207664_10054378 3300025929 Bacteria 3172
87 Ga0207664_10435264 3300025929 Bacteria 1169
88 Ga0207690_10033252 3300025932 Bacteria 3315
89 Ga0207690_10053978 3300025932 Bacteria 2699
90 Ga0207665_10000063 3300025939 Bacteria 69485
91 Ga0207667_10477873 3300025949 Bacteria 1265
92 Ga0207674_10167496 3300026116 Bacteria 2151
93 Ga0207698_10161744 3300026142 Bacteria 1959
94 Ga0373944_0144468 3300035089 Unclassified 835
95 Ga0373956_0018747 3300035119 Bacteria 2933
96 Ga0373955_0476999 3300035172 Bacteria 761
97 Ga0373931_0036950 3300035691 Bacteria 2549
98 Ga0373947_0128480 3300035725 Bacteria 1616
99 Ga0373937_0081657 3300036401 Bacteria 2991
100 Ga0373925_0486072 3300037068 Bacteria 1013
101 Ga0395900_0012701 3300037418 Bacteria 8606
102 Ga0395900_0946491 3300037418 Bacteria 783
103 Ga0395898_0028324 3300037466 Bacteria 5615
104 Ga0395905_0782218 3300037471 Bacteria 857
105 Ga0466969_0013179 3300044656 Bacteria 4356
106 Ga0466965_0017556 3300044683 Bacteria 3421
107 Ga0466966_0047120 3300044684 Bacteria 2750
108 Ga0466966_0213241 3300044684 Bacteria 1166
109 Ga0466961_0002407 3300044693 Bacteria 11628
110 Ga0466961_0047878 3300044693 Unclassified 2733
111 Ga0466961_0276389 3300044693 Bacteria 1028
112 Ga0466961_0314790 3300044693 Bacteria 955
113 Ga0466963_0000328 3300044694 Bacteria 21561
114 Ga0466963_0001843 3300044694 Bacteria 11556
115 Ga0466963_0002019 3300044694 Bacteria 11147
116 Ga0466963_0005285 3300044694 Bacteria 7542
117 Ga0466963_0017479 3300044694 Unclassified 4471
118 Ga0466963_0020445 3300044694 Bacteria 4162
119 Ga0466963_0021377 3300044694 Bacteria 4081
120 Ga0466963_0025113 3300044694 Bacteria 3797
121 Ga0466963_0039139 3300044694 Bacteria 3104
122 Ga0466963_0050081 3300044694 Bacteria 2764
123 Ga0466963_0144691 3300044694 Bacteria 1648
124 Ga0466963_0160896 3300044694 Bacteria 1562
125 Ga0466963_0164567 3300044694 Bacteria 1545
126 Ga0466963_0188953 3300044694 Bacteria 1439
127 Ga0466963_0203345 3300044694 Bacteria 1385
128 Ga0466963_0647590 3300044694 Unclassified 746
129 Ga0466964_0001148 3300044706 Bacteria 8942
130 Ga0466964_0007845 3300044706 Bacteria 3996
131 Ga0466964_0032771 3300044706 Bacteria 2066
132 Ga0466964_0044461 3300044706 Bacteria 1804
133 Ga0466964_0064940 3300044706 Unclassified 1528
134 Ga0466964_0197633 3300044706 Bacteria 963
135 Ga0466964_0296267 3300044706 Bacteria 814
136 Ga0466971_0002252 3300044719 Bacteria 8164
137 Ga0466971_0003324 3300044719 Bacteria 6865
138 Ga0466971_0008112 3300044719 Bacteria 4579
139 Ga0466971_0009085 3300044719 Bacteria 4345
140 Ga0466968_0057563 3300044735 Bacteria 1671
141 Ga0466968_0188085 3300044735 Bacteria 963
142 Ga0466968_0192154 3300044735 Bacteria 953
143 Ga0466957_0001257 3300044842 Bacteria 13198
144 Ga0466957_0003793 3300044842 Bacteria 8352
145 Ga0466957_0008129 3300044842 Bacteria 5955
146 Ga0466957_0016659 3300044842 Bacteria 4299
147 Ga0466957_0018990 3300044842 Bacteria 4041
148 Ga0466957_0076350 3300044842 Bacteria 2080
149 Ga0466957_0079023 3300044842 Unclassified 2046
150 Ga0466959_0003682 3300045049 Bacteria 10108
151 Ga0466959_0163472 3300045049 Bacteria 1564
152 Ga0466958_0001330 3300045836 Bacteria 11664
153 Ga0466958_0001492 3300045836 Bacteria 11176
154 Ga0466958_0005788 3300045836 Bacteria 6684
155 Ga0466958_0053786 3300045836 Bacteria 2441
156 Ga0466958_0110403 3300045836 Unclassified 1716
157 Ga0466958_0114544 3300045836 Bacteria 1684
158 Ga0466958_0128408 3300045836 Unclassified 1590
159 Ga0466958_0315007 3300045836 Bacteria 1005
160 Ga0466958_0328285 3300045836 Unclassified 984
161 Ga0466967_0000108 3300045976 Bacteria 30356
162 Ga0466967_0000448 3300045976 Bacteria 19731
163 Ga0466967_0002361 3300045976 Bacteria 11685
164 Ga0466967_0036999 3300045976 Bacteria 4172
165 Ga0466967_0049606 3300045976 Unclassified 3671
166 Ga0466967_0058863 3300045976 Bacteria 3397
167 Ga0466967_0068207 3300045976 Bacteria 3175
168 Ga0466967_0200630 3300045976 Unclassified 1889
169 Ga0466967_0257216 3300045976 Bacteria 1669
170 Ga0466967_0364089 3300045976 Bacteria 1401
171 Ga0466967_0518470 3300045976 Bacteria 1171
172 Ga0466967_0529960 3300045976 Bacteria 1158
173 Ga0466967_0914085 3300045976 Unclassified 873
174 Ga0495592_0082830 3300046454 Bacteria 2317
175 Ga0495603_0003082 3300046455 Bacteria 9901
176 Ga0495651_0151590 3300046462 Bacteria 1670
177 Ga0495653_0082366 3300046463 Bacteria 2375
178 Ga0495664_0034048 3300046477 Bacteria 2995
179 Ga0495664_0449764 3300046477 Bacteria 771
180 Ga0495594_0212635 3300046499 Bacteria 1103
181 Ga0495608_0043621 3300046511 Bacteria 2996
182 Ga0495618_0314803 3300046514 Bacteria 970
183 Ga0495628_0065736 3300046516 Bacteria 2835
184 Ga0495628_0124625 3300046516 Bacteria 1974
185 Ga0495628_0138267 3300046516 Bacteria 1860
186 Ga0495652_0177291 3300046529 Bacteria 1639
187 Ga0495652_0209799 3300046529 Bacteria 1471
188 Ga0495640_0222410 3300046533 Bacteria 1190
189 Ga0495645_0097590 3300046543 Bacteria 2092
190 Ga0495645_0233942 3300046543 Bacteria 1229
191 Ga0495667_0017829 3300046559 Bacteria 4797
192 Ga0495634_0329745 3300046642 Bacteria 917
193 Ga0495635_0040842 3300046663 Bacteria 3205
194 Ga0495635_0147413 3300046663 Bacteria 1602
195 Ga0495588_0281780 3300046674 Bacteria 876
196 Ga0495657_0002823 3300046675 Bacteria 14428
197 Ga0495657_0180530 3300046675 Bacteria 1296
198 Ga0495599_0069818 3300046678 Bacteria 2192
199 Ga0495623_0115740 3300046679 Bacteria 1620
200 Ga0495646_0195158 3300046680 Bacteria 1105
201 Ga0495613_0240074 3300046689 Bacteria 1267
202 Ga0495604_0048101 3300047317 Bacteria 3318
203 Ga0495604_0369493 3300047317 Bacteria 950
204 Ga0495674_0450159 3300047319 Bacteria 1035
205 Ga0495674_0650857 3300047319 Bacteria 831
206 Ga0495676_0143138 3300047321 Bacteria 1711
207 Ga0495680_0024974 3300047322 Bacteria 4948
208 Ga0495675_0084453 3300047444 Unclassified 1998
209 Ga0495602_0363575 3300048088 Bacteria 1041
210 Ga0495602_0389429 3300048088 Bacteria 996
211 Ga0496101_0070993 3300048904 Bacteria 2552
212 Ga0496102_0007922 3300048905 Bacteria 9082
213 Ga0496102_0246880 3300048905 Bacteria 1683
214 Ga0496103_0008081 3300048906 Bacteria 6247
215 Ga0496103_0119778 3300048906 Bacteria 1676
216 Ga0496103_0623875 3300048906 Archaea 686
217 Ga0496104_0001057 3300048907 Bacteria 23472
218 Ga0496104_0040019 3300048907 Bacteria 4392
219 Ga0496104_0347084 3300048907 Bacteria 1397
220 Ga0496105_0035223 3300048908 Bacteria 4119
221 Ga0496105_0564400 3300048908 Bacteria 887
222 Ga0496106_0153659 3300048909 Bacteria 1816
223 Ga0496108_0019910 3300048911 Bacteria 5511
224 Ga0496109_0044790 3300048912 Bacteria 4014
225 Ga0496109_0054619 3300048912 Bacteria 3643
226 Ga0496109_0798699 3300048912 Unclassified 882
227 Ga0496111_0256614 3300048914 Unclassified 1297
228 Ga0496111_0721767 3300048914 Bacteria 724
229 Ga0496112_0013687 3300048915 Bacteria 7498
230 Ga0496112_0036156 3300048915 Bacteria 4816
231 Ga0496112_0091515 3300048915 Bacteria 3010
232 Ga0496113_0088674 3300048916 Bacteria 2380
233 Ga0496113_0126684 3300048916 Bacteria 2000
234 Ga0496115_0018206 3300048918 Bacteria 5388
235 nmdc:mga00v17_12342_c1 3300050491 Bacteria 4713
236 nmdc:mga00v17_50236_c1 3300050491 Bacteria 2533
237 nmdc:mga0yw44_43693_c1 3300050492 Bacteria 2677
238 nmdc:mga0n895_42609_c1 3300050512 Unclassified 4417
239 Ga0495601_0204629 3300053077 Bacteria 1289
240 Ga0495601_0308860 3300053077 Bacteria 1030
241 Ga0495612_0081790 3300053078 Bacteria 1358
242 Ga0495595_0003083 3300053084 Bacteria 6592
243 Ga0495595_0037435 3300053084 Bacteria 2205
244 Ga0495619_0079962 3300053085 Bacteria 2199
245 Ga0466962_0000976 3300061719 Bacteria 13020
246 Ga0466962_0001432 3300061719 Bacteria 11120
247 Ga0466962_0006941 3300061719 Bacteria 5429
248 Ga0466962_0018230 3300061719 Bacteria 3377
249 Ga0466962_0026281 3300061719 Bacteria 2795
250 Ga0075365_10039194
251 Ga0070658_10070606
252 Ga0070683_100015616
253 Ga0070683_100049931
254 Ga0070680_100008707
255 Ga0070680_100038387
256 Ga0070680_100376648
257 Ga0070680_100607894
258 Ga0070680_100672823
259 Ga0070682_100188640
260 Ga0070714_100005101
261 Ga0070714_100005294
262 Ga0070714_100052721
263 Ga0070714_100083115
264 Ga0070714_100179085
265 Ga0070714_100478127
266 Ga0070713_100455889
267 Ga0070710_10006517
268 Ga0070711_100333153
269 Ga0070694_100037264
270 Ga0070678_100772745
271 Ga0070681_10082289
272 Ga0070681_10150477
273 Ga0070681_10280603
274 Ga0070679_100141162
275 Ga0070679_100148835
276 Ga0070679_100274563
277 Ga0070684_100242636
278 Ga0070695_100000053
279 Ga0070696_100272717
280 Ga0070693_100159693
281 Ga0068855_101186952
282 Ga0070717_10018578
283 Ga0070717_10019937
284 Ga0070717_10026771
285 Ga0075365_10049040
286 Ga0075365_10176519
287 Ga0075365_10351117
288 Ga0075363_100046787
289 Ga0075364_10047076
290 Ga0075364_10131669
291 Ga0075364_10210589
292 Ga0070715_10000838
293 Ga0070712_100452825
294 Ga0070712_100566134
295 Ga0075434_100011651
296 Ga0105240_10023383
297 Ga0105240_10913758
298 Ga0105245_10814689
299 Ga0105237_10071105
300 Ga0157370_11074383
301 Ga0157369_10121375
302 Ga0157372_10119081
303 Ga0157372_11279605
304 Ga0182007_10095602
305 Ga0206354_10834578
306 Ga0207692_10018508
307 Ga0207685_10003335
308 Ga0207705_10017340
309 Ga0207705_10181307
310 Ga0207707_10098258
311 Ga0207707_10253698
312 Ga0207695_10020978
313 Ga0207671_10042255
314 Ga0207671_10208682
315 Ga0207693_10001629
316 Ga0207693_10390322
317 Ga0207663_10006391
318 Ga0207660_10110830
319 Ga0207660_10111968
320 Ga0207660_10578352
321 Ga0207660_10687435
322 Ga0207657_10002870
323 Ga0207657_10009928
324 Ga0207649_10448402
325 Ga0207652_10202620
326 Ga0207652_10220840
327 Ga0207652_10811902
328 Ga0207694_10070312
329 Ga0207687_10402034
330 Ga0207700_10019769
331 Ga0207700_10589628
332 Ga0207700_10685493
333 Ga0207664_10050379
334 Ga0207664_10053362
335 Ga0207664_10054378
336 Ga0207664_10435264
337 Ga0207690_10033252
338 Ga0207690_10053978
339 Ga0207665_10000063
340 Ga0207667_10477873
341 Ga0207674_10167496
342 Ga0207698_10161744
343 Ga0373944_0144468
344 Ga0373956_0018747
345 Ga0373955_0476999
346 Ga0373931_0036950
347 Ga0373947_0128480
348 Ga0373937_0081657
349 Ga0373925_0486072
350 Ga0395900_0012701
351 Ga0395900_0946491
352 Ga0395898_0028324
353 Ga0395905_0782218
354 Ga0466969_0013179
355 Ga0466965_0017556
356 Ga0466966_0047120
357 Ga0466966_0213241
358 Ga0466961_0002407
359 Ga0466961_0047878
360 Ga0466961_0276389
361 Ga0466961_0314790
362 Ga0466963_0000328
363 Ga0466963_0001843
364 Ga0466963_0002019
365 Ga0466963_0005285
366 Ga0466963_0017479
367 Ga0466963_0020445
368 Ga0466963_0021377
369 Ga0466963_0025113
370 Ga0466963_0039139
371 Ga0466963_0050081
372 Ga0466963_0144691
373 Ga0466963_0160896
374 Ga0466963_0164567
375 Ga0466963_0188953
376 Ga0466963_0203345
377 Ga0466963_0647590
378 Ga0466964_0001148
379 Ga0466964_0007845
380 Ga0466964_0032771
381 Ga0466964_0044461
382 Ga0466964_0064940
383 Ga0466964_0197633
384 Ga0466964_0296267
385 Ga0466971_0002252
386 Ga0466971_0003324
387 Ga0466971_0008112
388 Ga0466971_0009085
389 Ga0466968_0057563
390 Ga0466968_0188085
391 Ga0466968_0192154
392 Ga0466957_0001257
393 Ga0466957_0003793
394 Ga0466957_0008129
395 Ga0466957_0016659
396 Ga0466957_0018990
397 Ga0466957_0076350
398 Ga0466957_0079023
399 Ga0466959_0003682
400 Ga0466959_0163472
401 Ga0466958_0001330
402 Ga0466958_0001492
403 Ga0466958_0005788
404 Ga0466958_0053786
405 Ga0466958_0110403
406 Ga0466958_0114544
407 Ga0466958_0128408
408 Ga0466958_0315007
409 Ga0466958_0328285
410 Ga0466967_0000108
411 Ga0466967_0000448
412 Ga0466967_0002361
413 Ga0466967_0036999
414 Ga0466967_0049606
415 Ga0466967_0058863
416 Ga0466967_0068207
417 Ga0466967_0200630
418 Ga0466967_0257216
419 Ga0466967_0364089
420 Ga0466967_0518470
421 Ga0466967_0529960
422 Ga0466967_0914085
423 Ga0495592_0082830
424 Ga0495603_0003082
425 Ga0495651_0151590
426 Ga0495653_0082366
427 Ga0495664_0034048
428 Ga0495664_0449764
429 Ga0495594_0212635
430 Ga0495608_0043621
431 Ga0495618_0314803
432 Ga0495628_0065736
433 Ga0495628_0124625
434 Ga0495628_0138267
435 Ga0495652_0177291
436 Ga0495652_0209799
437 Ga0495640_0222410
438 Ga0495645_0097590
439 Ga0495645_0233942
440 Ga0495667_0017829
441 Ga0495634_0329745
442 Ga0495635_0040842
443 Ga0495635_0147413
444 Ga0495588_0281780
445 Ga0495657_0002823
446 Ga0495657_0180530
447 Ga0495599_0069818
448 Ga0495623_0115740
449 Ga0495646_0195158
450 Ga0495613_0240074
451 Ga0495604_0048101
452 Ga0495604_0369493
453 Ga0495674_0450159
454 Ga0495674_0650857
455 Ga0495676_0143138
456 Ga0495680_0024974
457 Ga0495675_0084453
458 Ga0495602_0363575
459 Ga0495602_0389429
460 Ga0496101_0070993
461 Ga0496102_0007922
462 Ga0496102_0246880
463 Ga0496103_0008081
464 Ga0496103_0119778
465 Ga0496103_0623875
466 Ga0496104_0001057
467 Ga0496104_0040019
468 Ga0496104_0347084
469 Ga0496105_0035223
470 Ga0496105_0564400
471 Ga0496106_0153659
472 Ga0496108_0019910
473 Ga0496109_0044790
474 Ga0496109_0054619
475 Ga0496109_0798699
476 Ga0496111_0256614
477 Ga0496111_0721767
478 Ga0496112_0013687
479 Ga0496112_0036156
480 Ga0496112_0091515
481 Ga0496113_0088674
482 Ga0496113_0126684
483 Ga0496115_0018206
484 nmdc:mga00v17_12342_c1
485 nmdc:mga00v17_50236_c1
486 nmdc:mga0yw44_43693_c1
487 nmdc:mga0n895_42609_c1
488 Ga0495601_0204629
489 Ga0495601_0308860
490 Ga0495612_0081790
491 Ga0495595_0003083
492 Ga0495595_0037435
493 Ga0495619_0079962
494 Ga0466962_0000976
495 Ga0466962_0001432
496 Ga0466962_0006941
497 Ga0466962_0018230
498 Ga0466962_0026281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

39

222

0.84

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

37

227

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rsh-assembly3.cif.gz_C structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2 0.9099 2 186
4rsh-assembly3.cif.gz_C structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2 0.8655 2 186
7pzg-assembly1.cif.gz_AAA phocaeicola vulgatus sialic acid esterase at 1.44 angstrom resolution 0.8395 2 186
7pzh-assembly4.cif.gz_GGG phocaeicola vulgatus sialic acid esterase at 2.06 angstrom resolution 0.8342 2 184
3p94-assembly1.cif.gz_A crystal structure of a gdsl-like lipase (bdi_0976) from parabacteroides distasonis atcc 8503 at 1.93 a resolution 0.8263 2 186
ID Description Score Start End Superfamily
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8729 2 189 3.40.50.1110
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8587 2 189 3.40.50.1110
4rw0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.827 1 186 3.40.50.1110
af_A0A2R8QJS0_198_300_3.40.50.12700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8233 87 186 3.40.50.12700
af_K7LR54_5_125_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8202 90 160 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A7W1GJ37-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9836 1 186
AF-A0A7W0UDS1-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9816 1 156
AF-A0A7J9YNV5-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9796 1 186 GO:0004622
AF-A0A7W0ANF9-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9793 2 185 GO:0004622
AF-A0A7V9VNY5-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9783 2 186 GO:0004622

Map