F360550

General Info

Members Datasets Scaffolds Average Seq Length
249 175 249 151

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100807309|Ga0070662_1008073092
Length 177
Sequence MTSESPDDELERGTAIPGTAVQDPDPETQVQAEFEGLETDAPRVGIIMGSKSDMEVMEQAGKVLDERGIRYEIRVMSAHRQPEVVADYCRNAKMRGLSVIIAGAGLSAALPGVAAAHTELPVIGVPLSSKLSALGGLDALLSVAQMPPGVPVAAVGLDNAKNAGHLAVRILASAPHG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
102 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
103 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.43
Nodule 0
Rhizoplane 14.86
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10047849 3300003203 Bacteria 1454
2 JGI25406J46586_10054134 3300003203 Bacteria 1329
3 Ga0070690_100614146 3300005330 Bacteria 827
4 Ga0070680_100964170 3300005336 Unclassified 736
5 Ga0070682_100557357 3300005337 Bacteria 898
6 Ga0068868_101379431 3300005338 Bacteria 657
7 Ga0070691_10111770 3300005341 Bacteria 1367
8 Ga0070691_10290684 3300005341 Bacteria 890
9 Ga0070692_10024295 3300005345 Unclassified 2977
10 Ga0070709_10496816 3300005434 Bacteria 926
11 Ga0070713_100257378 3300005436 Bacteria 1594
12 Ga0070701_10019341 3300005438 Bacteria 3215
13 Ga0070705_100087482 3300005440 Bacteria 1931
14 Ga0070705_100647361 3300005440 Bacteria 823
15 Ga0070694_100021187 3300005444 Bacteria 4150
16 Ga0070708_100170602 3300005445 Bacteria 2031
17 Ga0070708_100406947 3300005445 Bacteria 1283
18 Ga0070663_100491175 3300005455 Bacteria 1018
19 Ga0070662_100807309 3300005457 Bacteria 798
20 Ga0070662_100943777 3300005457 Bacteria 737
21 Ga0070706_100032282 3300005467 Bacteria 4829
22 Ga0070698_100000037 3300005471 Bacteria 92307
23 Ga0070698_100572716 3300005471 Unclassified 1069
24 Ga0070699_100012280 3300005518 Bacteria 7388
25 Ga0070699_100166445 3300005518 Unclassified 1953
26 Ga0070697_100086823 3300005536 Bacteria 2582
27 Ga0070697_100143347 3300005536 Bacteria 2010
28 Ga0068853_100770507 3300005539 Bacteria 920
29 Ga0070686_100034915 3300005544 Bacteria 3102
30 Ga0070695_100070310 3300005545 Bacteria 2289
31 Ga0070695_100459112 3300005545 Bacteria 978
32 Ga0070696_100006234 3300005546 Bacteria 7980
33 Ga0070696_100517987 3300005546 Bacteria 951
34 Ga0070665_100000791 3300005548 Bacteria 41601
35 Ga0070704_100006416 3300005549 Bacteria 6934
36 Ga0070704_100152844 3300005549 Bacteria 1817
37 Ga0070664_100655619 3300005564 Bacteria 976
38 Ga0068857_101179779 3300005577 Bacteria 741
39 Ga0068856_100050634 3300005614 Bacteria 4095
40 Ga0070702_100037106 3300005615 Bacteria 2705
41 Ga0068864_101100562 3300005618 Bacteria 791
42 Ga0068861_100897696 3300005719 Unclassified 839
43 Ga0068861_101719419 3300005719 Bacteria 621
44 Ga0068863_100021738 3300005841 Bacteria 6120
45 Ga0068863_100590014 3300005841 Bacteria 1099
46 Ga0068862_100464752 3300005844 Unclassified 1195
47 Ga0081540_1000535 3300005983 Bacteria 36758
48 Ga0081540_1036239 3300005983 Bacteria 2633
49 Ga0081539_10002970 3300005985 Bacteria 22262
50 Ga0081539_10005211 3300005985 Bacteria 13472
51 Ga0081539_10396587 3300005985 Bacteria 574
52 Ga0075365_10220536 3300006038 Bacteria 1330
53 Ga0075365_10954201 3300006038 Unclassified 604
54 Ga0075364_10055656 3300006051 Bacteria 2588
55 Ga0075364_10138065 3300006051 Bacteria 1638
56 Ga0070716_100148715 3300006173 Bacteria 1504
57 Ga0070712_101303244 3300006175 Bacteria 633
58 Ga0075370_10168514 3300006353 Bacteria 1287
59 Ga0075428_100097843 3300006844 Bacteria 3199
60 Ga0075430_101432964 3300006846 Archaea 568
61 Ga0075431_101131512 3300006847 Bacteria 747
62 Ga0075434_100021626 3300006871 Bacteria 6255
63 Ga0075436_100002615 3300006914 Bacteria 12375
64 Ga0075435_100147464 3300007076 Bacteria 1977
65 Ga0099794_10010103 3300007265 Bacteria 3998
66 Ga0105240_10471959 3300009093 Bacteria 1400
67 Ga0111539_11930128 3300009094 Bacteria 685
68 Ga0105245_11068812 3300009098 Bacteria 853
69 Ga0105247_11491259 3300009101 Bacteria 551
70 Ga0114129_11123267 3300009147 Bacteria 983
71 Ga0114129_12399450 3300009147 Bacteria 632
72 Ga0105243_10189095 3300009148 Bacteria 1797
73 Ga0105243_10236101 3300009148 Bacteria 1624
74 Ga0105243_10242088 3300009148 Bacteria 1606
75 Ga0105242_10001530 3300009176 Bacteria 18168
76 Ga0105237_11617236 3300009545 Bacteria 655
77 Ga0105238_11085075 3300009551 Bacteria 823
78 Ga0105249_10167992 3300009553 Bacteria 2125
79 Ga0105249_10915458 3300009553 Bacteria 944
80 Ga0105239_10394369 3300010375 Bacteria 1566
81 Ga0157378_10100271 3300013297 Bacteria 2643
82 Ga0157378_11119144 3300013297 Bacteria 825
83 Ga0157378_11610757 3300013297 Bacteria 695
84 Ga0163162_12363802 3300013306 Bacteria 611
85 Ga0157375_11189219 3300013308 Bacteria 894
86 Ga0157377_11223443 3300014745 Bacteria 583
87 Ga0157379_10025166 3300014968 Bacteria 5284
88 Ga0157379_10841317 3300014968 Bacteria 868
89 Ga0207653_10111226 3300025885 Bacteria 978
90 Ga0207699_10380531 3300025906 Bacteria 1002
91 Ga0207695_10334107 3300025913 Bacteria 1403
92 Ga0207657_10532818 3300025919 Bacteria 919
93 Ga0207652_11171628 3300025921 Bacteria 670
94 Ga0207646_10065633 3300025922 Unclassified 3241
95 Ga0207646_11055655 3300025922 Bacteria 716
96 Ga0207681_10726689 3300025923 Bacteria 827
97 Ga0207681_10954928 3300025923 Bacteria 719
98 Ga0207687_10682616 3300025927 Bacteria 871
99 Ga0207700_10916928 3300025928 Bacteria 784
100 Ga0207709_10220896 3300025935 Bacteria 1366
101 Ga0207669_11164261 3300025937 Bacteria 652
102 Ga0207704_10541170 3300025938 Bacteria 945
103 Ga0207689_10215555 3300025942 Bacteria 1586
104 Ga0207661_11015267 3300025944 Bacteria 764
105 Ga0207712_10356108 3300025961 Bacteria 1218
106 Ga0207668_10389732 3300025972 Bacteria 1175
107 Ga0207677_10019999 3300026023 Bacteria 4056
108 Ga0207677_10417648 3300026023 Bacteria 1142
109 Ga0207677_11117649 3300026023 Bacteria 719
110 Ga0207678_10299791 3300026067 Bacteria 1381
111 Ga0207641_10015778 3300026088 Bacteria 6189
112 Ga0207641_10365955 3300026088 Bacteria 1378
113 Ga0207648_10356651 3300026089 Bacteria 1319
114 Ga0207676_10884210 3300026095 Bacteria 875
115 Ga0207675_100067112 3300026118 Bacteria 3353
116 Ga0207675_100247219 3300026118 Bacteria 1725
117 Ga0207675_101197082 3300026118 Bacteria 780
118 Ga0209588_1000557 3300027671 Bacteria 9598
119 Ga0268266_10027682 3300028379 Bacteria 4819
120 Ga0268265_10233264 3300028380 Unclassified 1619
121 Ga0307408_100792611 3300031548 Bacteria 859
122 Ga0316579_10145190 3300031691 Bacteria 1144
123 Ga0316576_10058369 3300031727 Bacteria 2822
124 Ga0316578_10038180 3300031728 Bacteria 2768
125 Ga0307405_11750184 3300031731 Unclassified 552
126 Ga0316577_10056795 3300031733 Bacteria 2185
127 Ga0307413_10581393 3300031824 Bacteria 914
128 Ga0307410_10470559 3300031852 Bacteria 1029
129 Ga0307406_10117286 3300031901 Bacteria 1844
130 Ga0307409_100812784 3300031995 Bacteria 943
131 Ga0307416_101402046 3300032002 Bacteria 804
132 Ga0307416_103312094 3300032002 Bacteria 539
133 Ga0307415_100950540 3300032126 Bacteria 795
134 Ga0307415_101424968 3300032126 Bacteria 660
135 Ga0316585_10053720 3300032137 Bacteria 1295
136 Ga0316580_10007758 3300032139 Bacteria 3202
137 Ga0373958_0048050 3300034819 Bacteria 894
138 Ga0316574_0085418 3300035398 Bacteria 2008
139 Ga0316574_0135542 3300035398 Bacteria 1585
140 Ga0316582_0127393 3300036647 Bacteria 1707
141 Ga0316584_0118709 3300036712 Bacteria 1977
142 Ga0316584_0208403 3300036712 Bacteria 1439
143 Ga0395898_0261954 3300037466 Bacteria 1649
144 Ga0395898_0305800 3300037466 Bacteria 1517
145 Ga0395905_1219990 3300037471 Bacteria 656
146 Ga0395901_0767324 3300038443 Bacteria 956
147 Ga0451837_1868597 3300041494 Bacteria 626
148 Ga0451839_1118039 3300041496 Bacteria 798
149 Ga0451853_0354843 3300041512 Bacteria 1327
150 Ga0466966_0881096 3300044684 Bacteria 540
151 Ga0466961_0677845 3300044693 Bacteria 618
152 Ga0466960_0000577 3300044901 Bacteria 12673
153 Ga0466960_0031746 3300044901 Bacteria 2439
154 Ga0466960_0037972 3300044901 Bacteria 2262
155 Ga0466960_0129555 3300044901 Bacteria 1330
156 Ga0466960_0312213 3300044901 Bacteria 888
157 Ga0466959_0938525 3300045049 Bacteria 577
158 Ga0451576_0033383 3300045051 Bacteria 5470
159 Ga0466958_1050462 3300045836 Bacteria 532
160 Ga0466967_0059815 3300045976 Bacteria 3374
161 Ga0495592_0249079 3300046454 Bacteria 1175
162 Ga0495629_0040949 3300046459 Bacteria 3259
163 Ga0495629_0042638 3300046459 Bacteria 3187
164 Ga0495651_0594003 3300046462 Bacteria 699
165 Ga0495650_0000070 3300046471 Bacteria 258497
166 Ga0495618_0060952 3300046514 Bacteria 2393
167 Ga0495620_0394491 3300046515 Bacteria 524
168 Ga0495628_0000207 3300046516 Bacteria 51605
169 Ga0495652_0000060 3300046529 Bacteria 111891
170 Ga0495652_0000061 3300046529 Bacteria 111729
171 Ga0495587_0007145 3300046536 Bacteria 7248
172 Ga0495587_0271028 3300046536 Bacteria 952
173 Ga0495609_0148256 3300046538 Bacteria 999
174 Ga0495599_0139962 3300046678 Bacteria 1501
175 Ga0495613_0997337 3300046689 Bacteria 538
176 Ga0495589_0168149 3300046794 Bacteria 1043
177 Ga0495676_0017504 3300047321 Bacteria 6335
178 Ga0495676_0583799 3300047321 Bacteria 729
179 Ga0495677_0145888 3300047445 Bacteria 910
180 Ga0495593_0084465 3300047673 Bacteria 1639
181 Ga0495602_0004076 3300048088 Bacteria 15212
182 Ga0496100_0241422 3300048903 Bacteria 1333
183 Ga0496101_0002401 3300048904 Bacteria 11491
184 Ga0496101_0037968 3300048904 Bacteria 3419
185 Ga0496101_0224056 3300048904 Bacteria 1460
186 Ga0496102_0000139 3300048905 Bacteria 98670
187 Ga0496102_0024511 3300048905 Bacteria 5365
188 Ga0496102_0063714 3300048905 Bacteria 3376
189 Ga0496102_0584882 3300048905 Bacteria 1039
190 Ga0496103_0000001 3300048906 Bacteria 643471
191 Ga0496103_0135140 3300048906 Bacteria 1576
192 Ga0496104_0003708 3300048907 Bacteria 13186
193 Ga0496104_0363106 3300048907 Bacteria 1360
194 Ga0496105_0300265 3300048908 Bacteria 1291
195 Ga0496105_0606282 3300048908 Bacteria 849
196 Ga0496106_0005771 3300048909 Bacteria 9152
197 Ga0496106_0037570 3300048909 Bacteria 3623
198 Ga0496106_0082260 3300048909 Bacteria 2475
199 Ga0496107_0007789 3300048910 Bacteria 7397
200 Ga0496108_0001538 3300048911 Bacteria 18255
201 Ga0496108_0083849 3300048911 Bacteria 2704
202 Ga0496108_0151317 3300048911 Bacteria 2002
203 Ga0496108_0308714 3300048911 Bacteria 1378
204 Ga0496108_0988236 3300048911 Bacteria 719
205 Ga0496109_0012293 3300048912 Bacteria 7389
206 Ga0496110_0086704 3300048913 Bacteria 2795
207 Ga0496110_1086527 3300048913 Bacteria 708
208 Ga0496111_0018273 3300048914 Bacteria 4854
209 Ga0496112_0010054 3300048915 Bacteria 8566
210 Ga0496112_0133422 3300048915 Bacteria 2454
211 Ga0496113_0002639 3300048916 Bacteria 10500
212 Ga0496114_0000010 3300048917 Bacteria 363396
213 Ga0496114_0107113 3300048917 Bacteria 2392
214 Ga0496114_0260408 3300048917 Bacteria 1527
215 Ga0496114_0392282 3300048917 Bacteria 1229
216 Ga0496114_0543414 3300048917 Bacteria 1027
217 Ga0496115_0000088 3300048918 Bacteria 86213
218 Ga0496115_0025003 3300048918 Bacteria 4646
219 Ga0496121_0000817 3300048924 Bacteria 56786
220 Ga0501034_0014809 3300049571 Bacteria 8022
221 Ga0501067_0041279 3300049583 Bacteria 2562
222 Ga0501067_0327084 3300049583 Bacteria 854
223 Ga0501070_0004811 3300049586 Bacteria 11544
224 Ga0501070_0053567 3300049586 Bacteria 3346
225 Ga0501070_0343719 3300049586 Bacteria 1212
226 Ga0501072_0296765 3300049588 Bacteria 1285
227 Ga0501079_1626705 3300049741 Bacteria 508
228 Ga0501212_051693 3300049851 Bacteria 697
229 nmdc:mga00v17_144396_c1 3300050491 Bacteria 1527
230 nmdc:mga00v17_212911_c1 3300050491 Bacteria 1251
231 nmdc:mga0yw44_260005_c1 3300050492 Bacteria 1157
232 nmdc:mga0yw44_424827_c1 3300050492 Bacteria 900
233 nmdc:mga06z11_691905_c1 3300050494 Unclassified 621
234 nmdc:mga04h51_386877_c1 3300050495 Bacteria 584
235 nmdc:mga07m45_235087_c1 3300050496 Bacteria 1066
236 nmdc:mga05p37_1043371_c1 3300050507 Bacteria 863
237 nmdc:mga0qj67_630133_c1 3300050509 Bacteria 856
238 nmdc:mga06r32_454700_c1 3300050510 Bacteria 1260
239 nmdc:mga08y16_1219124_c1 3300050511 Bacteria 722
240 nmdc:mga08y16_1527645_c1 3300050511 Bacteria 627
241 nmdc:mga0n895_325546_c1 3300050512 Bacteria 1557
242 nmdc:mga0rr50_55732_c1 3300050513 Bacteria 2950
243 nmdc:mga08x19_10321_c1 3300050514 Bacteria 5606
244 nmdc:mga08x19_405934_c1 3300050514 Bacteria 956
245 nmdc:mga08x19_427019_c1 3300050514 Bacteria 931
246 nmdc:mga0sz30_458961_c1 3300050516 Bacteria 572
247 Ga0500566_0003987 3300053094 Bacteria 8816
248 Ga0500614_123605 3300053123 Bacteria 763
249 Ga0500616_0005125 3300053153 Bacteria 9023

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_1868597 Ga0451837_1868597_257_613 118
2 3300005341 Ga0070691_10111770 Ga0070691_101117702 131
3 3300005345 Ga0070692_10024295 Ga0070692_100242952 131
4 3300005434 Ga0070709_10496816 Ga0070709_104968162 131
5 3300005436 Ga0070713_100257378 Ga0070713_1002573782 131
6 3300005438 Ga0070701_10019341 Ga0070701_100193413 131
7 3300005440 Ga0070705_100087482 Ga0070705_1000874822 131
8 3300005440 Ga0070705_100647361 Ga0070705_1006473612 131
9 3300005444 Ga0070694_100021187 Ga0070694_1000211872 131
10 3300005445 Ga0070708_100170602 Ga0070708_1001706022 131
11 3300005445 Ga0070708_100406947 Ga0070708_1004069472 131
12 3300005467 Ga0070706_100032282 Ga0070706_1000322825 131
13 3300005471 Ga0070698_100000037 Ga0070698_10000003751 131
14 3300005471 Ga0070698_100572716 Ga0070698_1005727162 131
15 3300005518 Ga0070699_100012280 Ga0070699_1000122806 131
16 3300005518 Ga0070699_100166445 Ga0070699_1001664451 131
17 3300005536 Ga0070697_100143347 Ga0070697_1001433474 131
18 3300005544 Ga0070686_100034915 Ga0070686_1000349154 131
19 3300005545 Ga0070695_100459112 Ga0070695_1004591122 131
20 3300005549 Ga0070704_100006416 Ga0070704_1000064165 131
21 3300005615 Ga0070702_100037106 Ga0070702_1000371064 131
22 3300005719 Ga0068861_100897696 Ga0068861_1008976961 131
23 3300005844 Ga0068862_100464752 Ga0068862_1004647522 131
24 3300006844 Ga0075428_100097843 Ga0075428_1000978432 131
25 3300006846 Ga0075430_101432964 Ga0075430_1014329642 131
26 3300006871 Ga0075434_100021626 Ga0075434_1000216268 131
27 3300006914 Ga0075436_100002615 Ga0075436_1000026154 131
28 3300007076 Ga0075435_100147464 Ga0075435_1001474642 131
29 3300007265 Ga0099794_10010103 Ga0099794_100101033 131
30 3300009147 Ga0114129_12399450 Ga0114129_123994502 131
31 3300013297 Ga0157378_10100271 Ga0157378_101002712 131
32 3300025885 Ga0207653_10111226 Ga0207653_101112262 131
33 3300025906 Ga0207699_10380531 Ga0207699_103805312 131
34 3300025922 Ga0207646_11055655 Ga0207646_110556552 131
35 3300025928 Ga0207700_10916928 Ga0207700_109169282 131
36 3300026118 Ga0207675_100067112 Ga0207675_1000671123 131
37 3300027671 Ga0209588_1000557 Ga0209588_10005579 131
38 3300028380 Ga0268265_10233264 Ga0268265_102332642 131
39 3300031691 Ga0316579_10145190 Ga0316579_101451902 131
40 3300031727 Ga0316576_10058369 Ga0316576_100583693 131
41 3300031728 Ga0316578_10038180 Ga0316578_100381802 131
42 3300031733 Ga0316577_10056795 Ga0316577_100567953 131
43 3300032137 Ga0316585_10053720 Ga0316585_100537202 131
44 3300032139 Ga0316580_10007758 Ga0316580_100077585 131
45 3300035398 Ga0316574_0135542 Ga0316574_0135542_784_1191 131
46 3300036647 Ga0316582_0127393 Ga0316582_0127393_84_491 131
47 3300036712 Ga0316584_0118709 Ga0316584_0118709_1125_1532 131
48 3300036712 Ga0316584_0208403 Ga0316584_0208403_333_740 131
49 3300045051 Ga0451576_0033383 Ga0451576_0033383_2824_3219 131
50 3300046538 Ga0495609_0148256 Ga0495609_0148256_289_687 131
51 3300046689 Ga0495613_0997337 Ga0495613_0997337_92_487 131
52 3300050509 nmdc:mga0qj67_630133_c1 nmdc:mga0qj67_630133_c1_228_626 131
53 3300050512 nmdc:mga0n895_325546_c1 nmdc:mga0n895_325546_c1_566_961 131
54 3300050513 nmdc:mga0rr50_55732_c1 nmdc:mga0rr50_55732_c1_1223_1618 131
55 3300050514 nmdc:mga08x19_10321_c1 nmdc:mga08x19_10321_c1_2393_2788 131
56 3300050514 nmdc:mga08x19_405934_c1 nmdc:mga08x19_405934_c1_196_591 131
57 3300050514 nmdc:mga08x19_427019_c1 nmdc:mga08x19_427019_c1_64_459 131
58 3300035398 Ga0316574_0085418 Ga0316574_0085418_745_1155 132
59 3300005536 Ga0070697_100086823 Ga0070697_1000868232 135
60 3300005545 Ga0070695_100070310 Ga0070695_1000703102 135
61 3300005546 Ga0070696_100006234 Ga0070696_1000062342 135
62 3300005549 Ga0070704_100152844 Ga0070704_1001528442 135
63 3300025922 Ga0207646_10065633 Ga0207646_100656331 135
64 3300005336 Ga0070680_100964170 Ga0070680_1009641701 136
65 3300006175 Ga0070712_101303244 Ga0070712_1013032441 139
66 3300009148 Ga0105243_10189095 Ga0105243_101890952 139
67 3300013297 Ga0157378_11119144 Ga0157378_111191441 139
68 3300048904 Ga0496101_0002401 Ga0496101_0002401_7607_8086 139
69 3300048905 Ga0496102_0024511 Ga0496102_0024511_489_968 139
70 3300048909 Ga0496106_0005771 Ga0496106_0005771_1295_1774 139
71 3300048910 Ga0496107_0007789 Ga0496107_0007789_6681_7160 139
72 3300048917 Ga0496114_0392282 Ga0496114_0392282_107_586 139
73 3300048918 Ga0496115_0025003 Ga0496115_0025003_861_1340 139
74 3300025919 Ga0207657_10532818 Ga0207657_105328182 143
75 3300009093 Ga0105240_10471959 Ga0105240_104719592 145
76 3300009176 Ga0105242_10001530 Ga0105242_1000153017 145
77 3300041496 Ga0451839_1118039 Ga0451839_1118039_137_577 145
78 3300041512 Ga0451853_0354843 Ga0451853_0354843_683_1120 145
79 3300046454 Ga0495592_0249079 Ga0495592_0249079_547_984 145
80 3300046459 Ga0495629_0040949 Ga0495629_0040949_1628_2065 145
81 3300046515 Ga0495620_0394491 Ga0495620_0394491_35_472 145
82 3300046536 Ga0495587_0007145 Ga0495587_0007145_1143_1580 145
83 3300046678 Ga0495599_0139962 Ga0495599_0139962_187_624 145
84 3300048905 Ga0496102_0000139 Ga0496102_0000139_16_453 145
85 3300048906 Ga0496103_0000001 Ga0496103_0000001_125632_126069 145
86 3300044684 Ga0466966_0881096 Ga0466966_0881096_23_496 147
87 3300025923 Ga0207681_10726689 Ga0207681_107266892 148
88 3300009101 Ga0105247_11491259 Ga0105247_114912591 150
89 3300005841 Ga0068863_100021738 Ga0068863_1000217382 151
90 3300025913 Ga0207695_10334107 Ga0207695_103341072 151
91 3300026088 Ga0207641_10015778 Ga0207641_100157786 151
92 3300031548 Ga0307408_100792611 Ga0307408_1007926112 152
93 3300031824 Ga0307413_10581393 Ga0307413_105813931 152
94 3300031901 Ga0307406_10117286 Ga0307406_101172862 152
95 3300032002 Ga0307416_101402046 Ga0307416_1014020462 152
96 3300032126 Ga0307415_101424968 Ga0307415_1014249681 152
97 3300045836 Ga0466958_1050462 Ga0466958_1050462_31_489 152
98 3300046462 Ga0495651_0594003 Ga0495651_0594003_13_471 152
99 3300003203 JGI25406J46586_10054134 JGI25406J46586_100541341 153
100 3300005546 Ga0070696_100517987 Ga0070696_1005179872 153
101 3300005983 Ga0081540_1000535 Ga0081540_10005359 153
102 3300005985 Ga0081539_10005211 Ga0081539_100052115 153
103 3300006847 Ga0075431_101131512 Ga0075431_1011315122 153
104 3300009094 Ga0111539_11930128 Ga0111539_119301281 153
105 3300009147 Ga0114129_11123267 Ga0114129_111232672 153
106 3300009148 Ga0105243_10236101 Ga0105243_102361012 153
107 3300009545 Ga0105237_11617236 Ga0105237_116172362 153
108 3300010375 Ga0105239_10394369 Ga0105239_103943692 153
109 3300013306 Ga0163162_12363802 Ga0163162_123638021 153
110 3300013308 Ga0157375_11189219 Ga0157375_111892192 153
111 3300014968 Ga0157379_10025166 Ga0157379_100251665 153
112 3300014968 Ga0157379_10841317 Ga0157379_108413171 153
113 3300025923 Ga0207681_10954928 Ga0207681_109549282 153
114 3300025935 Ga0207709_10220896 Ga0207709_102208962 153
115 3300025937 Ga0207669_11164261 Ga0207669_111642611 153
116 3300025938 Ga0207704_10541170 Ga0207704_105411701 153
117 3300026118 Ga0207675_101197082 Ga0207675_1011970822 153
118 3300031852 Ga0307410_10470559 Ga0307410_104705592 153
119 3300031995 Ga0307409_100812784 Ga0307409_1008127842 153
120 3300032126 Ga0307415_100950540 Ga0307415_1009505401 153
121 3300044693 Ga0466961_0677845 Ga0466961_0677845_12_485 153
122 3300046516 Ga0495628_0000207 Ga0495628_0000207_49359_49856 153
123 3300046529 Ga0495652_0000060 Ga0495652_0000060_44620_45117 153
124 3300046529 Ga0495652_0000061 Ga0495652_0000061_67000_67497 153
125 3300046536 Ga0495587_0271028 Ga0495587_0271028_315_812 153
126 3300047321 Ga0495676_0017504 Ga0495676_0017504_3881_4393 153
127 3300048088 Ga0495602_0004076 Ga0495602_0004076_9645_10142 153
128 3300048906 Ga0496103_0135140 Ga0496103_0135140_324_797 153
129 3300049586 Ga0501070_0004811 Ga0501070_0004811_5532_5999 153
130 3300049741 Ga0501079_1626705 Ga0501079_1626705_23_490 153
131 3300050507 nmdc:mga05p37_1043371_c1 nmdc:mga05p37_1043371_c1_281_754 153
132 3300050510 nmdc:mga06r32_454700_c1 nmdc:mga06r32_454700_c1_194_667 153
133 3300050511 nmdc:mga08y16_1527645_c1 nmdc:mga08y16_1527645_c1_44_517 153
134 3300006051 Ga0075364_10138065 Ga0075364_101380652 154
135 3300006173 Ga0070716_100148715 Ga0070716_1001487152 154
136 3300025921 Ga0207652_11171628 Ga0207652_111716282 154
137 3300037466 Ga0395898_0261954 Ga0395898_0261954_56_535 154
138 3300037466 Ga0395898_0305800 Ga0395898_0305800_396_875 154
139 3300037471 Ga0395905_1219990 Ga0395905_1219990_90_569 154
140 3300038443 Ga0395901_0767324 Ga0395901_0767324_387_866 154
141 3300044901 Ga0466960_0000577 Ga0466960_0000577_1421_1900 154
142 3300045049 Ga0466959_0938525 Ga0466959_0938525_20_499 154
143 3300045976 Ga0466967_0059815 Ga0466967_0059815_2040_2504 154
144 3300046459 Ga0495629_0042638 Ga0495629_0042638_2014_2505 154
145 3300046514 Ga0495618_0060952 Ga0495618_0060952_380_895 154
146 3300047321 Ga0495676_0583799 Ga0495676_0583799_68_532 154
147 3300047445 Ga0495677_0145888 Ga0495677_0145888_303_767 154
148 3300047673 Ga0495593_0084465 Ga0495593_0084465_529_1026 154
149 3300048904 Ga0496101_0037968 Ga0496101_0037968_1598_2077 154
150 3300048913 Ga0496110_1086527 Ga0496110_1086527_136_615 154
151 3300048917 Ga0496114_0000010 Ga0496114_0000010_45345_45845 154
152 3300048918 Ga0496115_0000088 Ga0496115_0000088_75668_76168 154
153 3300049571 Ga0501034_0014809 Ga0501034_0014809_1404_1883 154
154 3300049583 Ga0501067_0041279 Ga0501067_0041279_1883_2362 154
155 3300049586 Ga0501070_0053567 Ga0501070_0053567_2217_2723 154
156 3300049588 Ga0501072_0296765 Ga0501072_0296765_685_1194 154
157 3300050491 nmdc:mga00v17_144396_c1 nmdc:mga00v17_144396_c1_151_642 154
158 3300050492 nmdc:mga0yw44_424827_c1 nmdc:mga0yw44_424827_c1_67_558 154
159 3300053094 Ga0500566_0003987 Ga0500566_0003987_298_789 154
160 3300005330 Ga0070690_100614146 Ga0070690_1006141462 155
161 3300005338 Ga0068868_101379431 Ga0068868_1013794312 155
162 3300005341 Ga0070691_10290684 Ga0070691_102906842 155
163 3300005457 Ga0070662_100943777 Ga0070662_1009437772 155
164 3300005618 Ga0068864_101100562 Ga0068864_1011005622 155
165 3300005719 Ga0068861_101719419 Ga0068861_1017194191 155
166 3300005841 Ga0068863_100590014 Ga0068863_1005900142 155
167 3300005983 Ga0081540_1036239 Ga0081540_10362392 155
168 3300009098 Ga0105245_11068812 Ga0105245_110688122 155
169 3300009148 Ga0105243_10242088 Ga0105243_102420882 155
170 3300014745 Ga0157377_11223443 Ga0157377_112234431 155
171 3300025927 Ga0207687_10682616 Ga0207687_106826162 155
172 3300026023 Ga0207677_10019999 Ga0207677_100199994 155
173 3300026023 Ga0207677_11117649 Ga0207677_111176492 155
174 3300026088 Ga0207641_10365955 Ga0207641_103659552 155
175 3300026095 Ga0207676_10884210 Ga0207676_108842102 155
176 3300026118 Ga0207675_100247219 Ga0207675_1002472192 155
177 3300031731 Ga0307405_11750184 Ga0307405_117501841 155
178 3300032002 Ga0307416_103312094 Ga0307416_1033120941 155
179 3300034819 Ga0373958_0048050 Ga0373958_0048050_236_715 155
180 3300044901 Ga0466960_0031746 Ga0466960_0031746_1214_1693 155
181 3300044901 Ga0466960_0037972 Ga0466960_0037972_787_1263 155
182 3300044901 Ga0466960_0129555 Ga0466960_0129555_669_1148 155
183 3300048903 Ga0496100_0241422 Ga0496100_0241422_715_1194 155
184 3300048904 Ga0496101_0224056 Ga0496101_0224056_241_720 155
185 3300048905 Ga0496102_0584882 Ga0496102_0584882_145_624 155
186 3300048907 Ga0496104_0363106 Ga0496104_0363106_630_1109 155
187 3300048908 Ga0496105_0300265 Ga0496105_0300265_180_659 155
188 3300048909 Ga0496106_0082260 Ga0496106_0082260_1228_1707 155
189 3300048911 Ga0496108_0083849 Ga0496108_0083849_688_1173 155
190 3300048911 Ga0496108_0151317 Ga0496108_0151317_1279_1758 155
191 3300048911 Ga0496108_0308714 Ga0496108_0308714_320_796 155
192 3300048915 Ga0496112_0133422 Ga0496112_0133422_176_655 155
193 3300048917 Ga0496114_0107113 Ga0496114_0107113_162_641 155
194 3300049583 Ga0501067_0327084 Ga0501067_0327084_275_754 155
195 3300053153 Ga0500616_0005125 Ga0500616_0005125_2946_3422 155
196 3300005577 Ga0068857_101179779 Ga0068857_1011797791 156
197 3300005614 Ga0068856_100050634 Ga0068856_1000506342 156
198 3300009553 Ga0105249_10915458 Ga0105249_109154582 156
199 3300013297 Ga0157378_11610757 Ga0157378_116107572 156
200 3300025942 Ga0207689_10215555 Ga0207689_102155553 156
201 3300025961 Ga0207712_10356108 Ga0207712_103561082 156
202 3300026023 Ga0207677_10417648 Ga0207677_104176481 156
203 3300044901 Ga0466960_0312213 Ga0466960_0312213_316_804 156
204 3300046471 Ga0495650_0000070 Ga0495650_0000070_93802_94293 156
205 3300048905 Ga0496102_0063714 Ga0496102_0063714_1364_1846 156
206 3300048907 Ga0496104_0003708 Ga0496104_0003708_3668_4150 156
207 3300048908 Ga0496105_0606282 Ga0496105_0606282_66_548 156
208 3300048909 Ga0496106_0037570 Ga0496106_0037570_244_726 156
209 3300048911 Ga0496108_0001538 Ga0496108_0001538_5422_5904 156
210 3300048912 Ga0496109_0012293 Ga0496109_0012293_6136_6618 156
211 3300048913 Ga0496110_0086704 Ga0496110_0086704_480_962 156
212 3300048914 Ga0496111_0018273 Ga0496111_0018273_62_544 156
213 3300048915 Ga0496112_0010054 Ga0496112_0010054_2224_2706 156
214 3300048916 Ga0496113_0002639 Ga0496113_0002639_4148_4630 156
215 3300048917 Ga0496114_0260408 Ga0496114_0260408_300_782 156
216 3300049851 Ga0501212_051693 Ga0501212_051693_182_655 156
217 3300050511 nmdc:mga08y16_1219124_c1 nmdc:mga08y16_1219124_c1_224_694 156
218 3300006038 Ga0075365_10220536 Ga0075365_102205362 157
219 3300006038 Ga0075365_10954201 Ga0075365_109542011 157
220 3300006051 Ga0075364_10055656 Ga0075364_100556562 157
221 3300006353 Ga0075370_10168514 Ga0075370_101685142 157
222 3300050491 nmdc:mga00v17_212911_c1 nmdc:mga00v17_212911_c1_483_968 157
223 3300050492 nmdc:mga0yw44_260005_c1 nmdc:mga0yw44_260005_c1_386_871 157
224 3300050494 nmdc:mga06z11_691905_c1 nmdc:mga06z11_691905_c1_26_511 157
225 3300050495 nmdc:mga04h51_386877_c1 nmdc:mga04h51_386877_c1_45_530 157
226 3300050496 nmdc:mga07m45_235087_c1 nmdc:mga07m45_235087_c1_203_688 157
227 3300050516 nmdc:mga0sz30_458961_c1 nmdc:mga0sz30_458961_c1_49_534 157
228 3300003203 JGI25406J46586_10047849 JGI25406J46586_100478492 159
229 3300005337 Ga0070682_100557357 Ga0070682_1005573572 159
230 3300005455 Ga0070663_100491175 Ga0070663_1004911752 159
231 3300005457 Ga0070662_100807309 Ga0070662_1008073092 159
232 3300005539 Ga0068853_100770507 Ga0068853_1007705071 159
233 3300005548 Ga0070665_100000791 Ga0070665_10000079137 159
234 3300005564 Ga0070664_100655619 Ga0070664_1006556192 159
235 3300005985 Ga0081539_10002970 Ga0081539_100029702 159
236 3300005985 Ga0081539_10396587 Ga0081539_103965871 159
237 3300009551 Ga0105238_11085075 Ga0105238_110850752 159
238 3300009553 Ga0105249_10167992 Ga0105249_101679922 159
239 3300025944 Ga0207661_11015267 Ga0207661_110152672 159
240 3300025972 Ga0207668_10389732 Ga0207668_103897322 159
241 3300026067 Ga0207678_10299791 Ga0207678_102997912 159
242 3300026089 Ga0207648_10356651 Ga0207648_103566512 159
243 3300028379 Ga0268266_10027682 Ga0268266_100276825 159
244 3300046794 Ga0495589_0168149 Ga0495589_0168149_32_514 159
245 3300048911 Ga0496108_0988236 Ga0496108_0988236_214_696 159
246 3300048917 Ga0496114_0543414 Ga0496114_0543414_281_763 159
247 3300048924 Ga0496121_0000817 Ga0496121_0000817_44925_45437 159
248 3300049586 Ga0501070_0343719 Ga0501070_0343719_247_729 159
249 3300053123 Ga0500614_123605 Ga0500614_123605_223_735 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

43

176

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o4v-assembly1.cif.gz_A crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution 0.9553 28 157
1xmp-assembly1.cif.gz_G crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution 0.9465 28 157
2ywx-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from methanocaldococcus jannaschii 0.9462 30 157
4ay4-assembly1.cif.gz_D crystal structure of bacillus anthracis pure 0.946 28 157
3lp6-assembly1.cif.gz_C crystal structure of rv3275c-e60a from mycobacterium tuberculosis at 1.7a resolution 0.9432 24 157
ID Description Score Start End Superfamily
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9476 34 157 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9462 30 157 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9244 26 157 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9207 20 157 3.40.50.1970
4ja0C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9016 29 159 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A7X8GA15-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9671 27 157 GO:0004638
GO:0006189
GO:0034023
AF-A0A3D0NNP3-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.966 28 157 GO:0006189
GO:0034023
AF-A0A4P9X6U5-F1-model_v4 Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) 0.9659 26 157 GO:0004638
GO:0005524
GO:0006189
GO:0046872
AF-A0A2V1KCK0-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9655 28 157 GO:0006189
GO:0034023
AF-C7NFG1-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9655 28 157 GO:0006189
GO:0016829
GO:0034023

Feature Viewer

pLDDT pTM Quality
82.08 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map