F360550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 175 | 249 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100807309|Ga0070662_1008073092 |
| Length | 177 |
| Sequence | MTSESPDDELERGTAIPGTAVQDPDPETQVQAEFEGLETDAPRVGIIMGSKSDMEVMEQAGKVLDERGIRYEIRVMSAHRQPEVVADYCRNAKMRGLSVIIAGAGLSAALPGVAAAHTELPVIGVPLSSKLSALGGLDALLSVAQMPPGVPVAAVGLDNAKNAGHLAVRILASAPHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 91 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 92 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 97 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 101 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 102 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 103 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 111 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 116 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 148 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 160 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 161 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 162 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 164 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 175 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.43 |
| Nodule | 0 |
| Rhizoplane | 14.86 |
| Rhizosphere | 77.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10047849 | 3300003203 | Bacteria | 1454 |
| 2 | JGI25406J46586_10054134 | 3300003203 | Bacteria | 1329 |
| 3 | Ga0070690_100614146 | 3300005330 | Bacteria | 827 |
| 4 | Ga0070680_100964170 | 3300005336 | Unclassified | 736 |
| 5 | Ga0070682_100557357 | 3300005337 | Bacteria | 898 |
| 6 | Ga0068868_101379431 | 3300005338 | Bacteria | 657 |
| 7 | Ga0070691_10111770 | 3300005341 | Bacteria | 1367 |
| 8 | Ga0070691_10290684 | 3300005341 | Bacteria | 890 |
| 9 | Ga0070692_10024295 | 3300005345 | Unclassified | 2977 |
| 10 | Ga0070709_10496816 | 3300005434 | Bacteria | 926 |
| 11 | Ga0070713_100257378 | 3300005436 | Bacteria | 1594 |
| 12 | Ga0070701_10019341 | 3300005438 | Bacteria | 3215 |
| 13 | Ga0070705_100087482 | 3300005440 | Bacteria | 1931 |
| 14 | Ga0070705_100647361 | 3300005440 | Bacteria | 823 |
| 15 | Ga0070694_100021187 | 3300005444 | Bacteria | 4150 |
| 16 | Ga0070708_100170602 | 3300005445 | Bacteria | 2031 |
| 17 | Ga0070708_100406947 | 3300005445 | Bacteria | 1283 |
| 18 | Ga0070663_100491175 | 3300005455 | Bacteria | 1018 |
| 19 | Ga0070662_100807309 | 3300005457 | Bacteria | 798 |
| 20 | Ga0070662_100943777 | 3300005457 | Bacteria | 737 |
| 21 | Ga0070706_100032282 | 3300005467 | Bacteria | 4829 |
| 22 | Ga0070698_100000037 | 3300005471 | Bacteria | 92307 |
| 23 | Ga0070698_100572716 | 3300005471 | Unclassified | 1069 |
| 24 | Ga0070699_100012280 | 3300005518 | Bacteria | 7388 |
| 25 | Ga0070699_100166445 | 3300005518 | Unclassified | 1953 |
| 26 | Ga0070697_100086823 | 3300005536 | Bacteria | 2582 |
| 27 | Ga0070697_100143347 | 3300005536 | Bacteria | 2010 |
| 28 | Ga0068853_100770507 | 3300005539 | Bacteria | 920 |
| 29 | Ga0070686_100034915 | 3300005544 | Bacteria | 3102 |
| 30 | Ga0070695_100070310 | 3300005545 | Bacteria | 2289 |
| 31 | Ga0070695_100459112 | 3300005545 | Bacteria | 978 |
| 32 | Ga0070696_100006234 | 3300005546 | Bacteria | 7980 |
| 33 | Ga0070696_100517987 | 3300005546 | Bacteria | 951 |
| 34 | Ga0070665_100000791 | 3300005548 | Bacteria | 41601 |
| 35 | Ga0070704_100006416 | 3300005549 | Bacteria | 6934 |
| 36 | Ga0070704_100152844 | 3300005549 | Bacteria | 1817 |
| 37 | Ga0070664_100655619 | 3300005564 | Bacteria | 976 |
| 38 | Ga0068857_101179779 | 3300005577 | Bacteria | 741 |
| 39 | Ga0068856_100050634 | 3300005614 | Bacteria | 4095 |
| 40 | Ga0070702_100037106 | 3300005615 | Bacteria | 2705 |
| 41 | Ga0068864_101100562 | 3300005618 | Bacteria | 791 |
| 42 | Ga0068861_100897696 | 3300005719 | Unclassified | 839 |
| 43 | Ga0068861_101719419 | 3300005719 | Bacteria | 621 |
| 44 | Ga0068863_100021738 | 3300005841 | Bacteria | 6120 |
| 45 | Ga0068863_100590014 | 3300005841 | Bacteria | 1099 |
| 46 | Ga0068862_100464752 | 3300005844 | Unclassified | 1195 |
| 47 | Ga0081540_1000535 | 3300005983 | Bacteria | 36758 |
| 48 | Ga0081540_1036239 | 3300005983 | Bacteria | 2633 |
| 49 | Ga0081539_10002970 | 3300005985 | Bacteria | 22262 |
| 50 | Ga0081539_10005211 | 3300005985 | Bacteria | 13472 |
| 51 | Ga0081539_10396587 | 3300005985 | Bacteria | 574 |
| 52 | Ga0075365_10220536 | 3300006038 | Bacteria | 1330 |
| 53 | Ga0075365_10954201 | 3300006038 | Unclassified | 604 |
| 54 | Ga0075364_10055656 | 3300006051 | Bacteria | 2588 |
| 55 | Ga0075364_10138065 | 3300006051 | Bacteria | 1638 |
| 56 | Ga0070716_100148715 | 3300006173 | Bacteria | 1504 |
| 57 | Ga0070712_101303244 | 3300006175 | Bacteria | 633 |
| 58 | Ga0075370_10168514 | 3300006353 | Bacteria | 1287 |
| 59 | Ga0075428_100097843 | 3300006844 | Bacteria | 3199 |
| 60 | Ga0075430_101432964 | 3300006846 | Archaea | 568 |
| 61 | Ga0075431_101131512 | 3300006847 | Bacteria | 747 |
| 62 | Ga0075434_100021626 | 3300006871 | Bacteria | 6255 |
| 63 | Ga0075436_100002615 | 3300006914 | Bacteria | 12375 |
| 64 | Ga0075435_100147464 | 3300007076 | Bacteria | 1977 |
| 65 | Ga0099794_10010103 | 3300007265 | Bacteria | 3998 |
| 66 | Ga0105240_10471959 | 3300009093 | Bacteria | 1400 |
| 67 | Ga0111539_11930128 | 3300009094 | Bacteria | 685 |
| 68 | Ga0105245_11068812 | 3300009098 | Bacteria | 853 |
| 69 | Ga0105247_11491259 | 3300009101 | Bacteria | 551 |
| 70 | Ga0114129_11123267 | 3300009147 | Bacteria | 983 |
| 71 | Ga0114129_12399450 | 3300009147 | Bacteria | 632 |
| 72 | Ga0105243_10189095 | 3300009148 | Bacteria | 1797 |
| 73 | Ga0105243_10236101 | 3300009148 | Bacteria | 1624 |
| 74 | Ga0105243_10242088 | 3300009148 | Bacteria | 1606 |
| 75 | Ga0105242_10001530 | 3300009176 | Bacteria | 18168 |
| 76 | Ga0105237_11617236 | 3300009545 | Bacteria | 655 |
| 77 | Ga0105238_11085075 | 3300009551 | Bacteria | 823 |
| 78 | Ga0105249_10167992 | 3300009553 | Bacteria | 2125 |
| 79 | Ga0105249_10915458 | 3300009553 | Bacteria | 944 |
| 80 | Ga0105239_10394369 | 3300010375 | Bacteria | 1566 |
| 81 | Ga0157378_10100271 | 3300013297 | Bacteria | 2643 |
| 82 | Ga0157378_11119144 | 3300013297 | Bacteria | 825 |
| 83 | Ga0157378_11610757 | 3300013297 | Bacteria | 695 |
| 84 | Ga0163162_12363802 | 3300013306 | Bacteria | 611 |
| 85 | Ga0157375_11189219 | 3300013308 | Bacteria | 894 |
| 86 | Ga0157377_11223443 | 3300014745 | Bacteria | 583 |
| 87 | Ga0157379_10025166 | 3300014968 | Bacteria | 5284 |
| 88 | Ga0157379_10841317 | 3300014968 | Bacteria | 868 |
| 89 | Ga0207653_10111226 | 3300025885 | Bacteria | 978 |
| 90 | Ga0207699_10380531 | 3300025906 | Bacteria | 1002 |
| 91 | Ga0207695_10334107 | 3300025913 | Bacteria | 1403 |
| 92 | Ga0207657_10532818 | 3300025919 | Bacteria | 919 |
| 93 | Ga0207652_11171628 | 3300025921 | Bacteria | 670 |
| 94 | Ga0207646_10065633 | 3300025922 | Unclassified | 3241 |
| 95 | Ga0207646_11055655 | 3300025922 | Bacteria | 716 |
| 96 | Ga0207681_10726689 | 3300025923 | Bacteria | 827 |
| 97 | Ga0207681_10954928 | 3300025923 | Bacteria | 719 |
| 98 | Ga0207687_10682616 | 3300025927 | Bacteria | 871 |
| 99 | Ga0207700_10916928 | 3300025928 | Bacteria | 784 |
| 100 | Ga0207709_10220896 | 3300025935 | Bacteria | 1366 |
| 101 | Ga0207669_11164261 | 3300025937 | Bacteria | 652 |
| 102 | Ga0207704_10541170 | 3300025938 | Bacteria | 945 |
| 103 | Ga0207689_10215555 | 3300025942 | Bacteria | 1586 |
| 104 | Ga0207661_11015267 | 3300025944 | Bacteria | 764 |
| 105 | Ga0207712_10356108 | 3300025961 | Bacteria | 1218 |
| 106 | Ga0207668_10389732 | 3300025972 | Bacteria | 1175 |
| 107 | Ga0207677_10019999 | 3300026023 | Bacteria | 4056 |
| 108 | Ga0207677_10417648 | 3300026023 | Bacteria | 1142 |
| 109 | Ga0207677_11117649 | 3300026023 | Bacteria | 719 |
| 110 | Ga0207678_10299791 | 3300026067 | Bacteria | 1381 |
| 111 | Ga0207641_10015778 | 3300026088 | Bacteria | 6189 |
| 112 | Ga0207641_10365955 | 3300026088 | Bacteria | 1378 |
| 113 | Ga0207648_10356651 | 3300026089 | Bacteria | 1319 |
| 114 | Ga0207676_10884210 | 3300026095 | Bacteria | 875 |
| 115 | Ga0207675_100067112 | 3300026118 | Bacteria | 3353 |
| 116 | Ga0207675_100247219 | 3300026118 | Bacteria | 1725 |
| 117 | Ga0207675_101197082 | 3300026118 | Bacteria | 780 |
| 118 | Ga0209588_1000557 | 3300027671 | Bacteria | 9598 |
| 119 | Ga0268266_10027682 | 3300028379 | Bacteria | 4819 |
| 120 | Ga0268265_10233264 | 3300028380 | Unclassified | 1619 |
| 121 | Ga0307408_100792611 | 3300031548 | Bacteria | 859 |
| 122 | Ga0316579_10145190 | 3300031691 | Bacteria | 1144 |
| 123 | Ga0316576_10058369 | 3300031727 | Bacteria | 2822 |
| 124 | Ga0316578_10038180 | 3300031728 | Bacteria | 2768 |
| 125 | Ga0307405_11750184 | 3300031731 | Unclassified | 552 |
| 126 | Ga0316577_10056795 | 3300031733 | Bacteria | 2185 |
| 127 | Ga0307413_10581393 | 3300031824 | Bacteria | 914 |
| 128 | Ga0307410_10470559 | 3300031852 | Bacteria | 1029 |
| 129 | Ga0307406_10117286 | 3300031901 | Bacteria | 1844 |
| 130 | Ga0307409_100812784 | 3300031995 | Bacteria | 943 |
| 131 | Ga0307416_101402046 | 3300032002 | Bacteria | 804 |
| 132 | Ga0307416_103312094 | 3300032002 | Bacteria | 539 |
| 133 | Ga0307415_100950540 | 3300032126 | Bacteria | 795 |
| 134 | Ga0307415_101424968 | 3300032126 | Bacteria | 660 |
| 135 | Ga0316585_10053720 | 3300032137 | Bacteria | 1295 |
| 136 | Ga0316580_10007758 | 3300032139 | Bacteria | 3202 |
| 137 | Ga0373958_0048050 | 3300034819 | Bacteria | 894 |
| 138 | Ga0316574_0085418 | 3300035398 | Bacteria | 2008 |
| 139 | Ga0316574_0135542 | 3300035398 | Bacteria | 1585 |
| 140 | Ga0316582_0127393 | 3300036647 | Bacteria | 1707 |
| 141 | Ga0316584_0118709 | 3300036712 | Bacteria | 1977 |
| 142 | Ga0316584_0208403 | 3300036712 | Bacteria | 1439 |
| 143 | Ga0395898_0261954 | 3300037466 | Bacteria | 1649 |
| 144 | Ga0395898_0305800 | 3300037466 | Bacteria | 1517 |
| 145 | Ga0395905_1219990 | 3300037471 | Bacteria | 656 |
| 146 | Ga0395901_0767324 | 3300038443 | Bacteria | 956 |
| 147 | Ga0451837_1868597 | 3300041494 | Bacteria | 626 |
| 148 | Ga0451839_1118039 | 3300041496 | Bacteria | 798 |
| 149 | Ga0451853_0354843 | 3300041512 | Bacteria | 1327 |
| 150 | Ga0466966_0881096 | 3300044684 | Bacteria | 540 |
| 151 | Ga0466961_0677845 | 3300044693 | Bacteria | 618 |
| 152 | Ga0466960_0000577 | 3300044901 | Bacteria | 12673 |
| 153 | Ga0466960_0031746 | 3300044901 | Bacteria | 2439 |
| 154 | Ga0466960_0037972 | 3300044901 | Bacteria | 2262 |
| 155 | Ga0466960_0129555 | 3300044901 | Bacteria | 1330 |
| 156 | Ga0466960_0312213 | 3300044901 | Bacteria | 888 |
| 157 | Ga0466959_0938525 | 3300045049 | Bacteria | 577 |
| 158 | Ga0451576_0033383 | 3300045051 | Bacteria | 5470 |
| 159 | Ga0466958_1050462 | 3300045836 | Bacteria | 532 |
| 160 | Ga0466967_0059815 | 3300045976 | Bacteria | 3374 |
| 161 | Ga0495592_0249079 | 3300046454 | Bacteria | 1175 |
| 162 | Ga0495629_0040949 | 3300046459 | Bacteria | 3259 |
| 163 | Ga0495629_0042638 | 3300046459 | Bacteria | 3187 |
| 164 | Ga0495651_0594003 | 3300046462 | Bacteria | 699 |
| 165 | Ga0495650_0000070 | 3300046471 | Bacteria | 258497 |
| 166 | Ga0495618_0060952 | 3300046514 | Bacteria | 2393 |
| 167 | Ga0495620_0394491 | 3300046515 | Bacteria | 524 |
| 168 | Ga0495628_0000207 | 3300046516 | Bacteria | 51605 |
| 169 | Ga0495652_0000060 | 3300046529 | Bacteria | 111891 |
| 170 | Ga0495652_0000061 | 3300046529 | Bacteria | 111729 |
| 171 | Ga0495587_0007145 | 3300046536 | Bacteria | 7248 |
| 172 | Ga0495587_0271028 | 3300046536 | Bacteria | 952 |
| 173 | Ga0495609_0148256 | 3300046538 | Bacteria | 999 |
| 174 | Ga0495599_0139962 | 3300046678 | Bacteria | 1501 |
| 175 | Ga0495613_0997337 | 3300046689 | Bacteria | 538 |
| 176 | Ga0495589_0168149 | 3300046794 | Bacteria | 1043 |
| 177 | Ga0495676_0017504 | 3300047321 | Bacteria | 6335 |
| 178 | Ga0495676_0583799 | 3300047321 | Bacteria | 729 |
| 179 | Ga0495677_0145888 | 3300047445 | Bacteria | 910 |
| 180 | Ga0495593_0084465 | 3300047673 | Bacteria | 1639 |
| 181 | Ga0495602_0004076 | 3300048088 | Bacteria | 15212 |
| 182 | Ga0496100_0241422 | 3300048903 | Bacteria | 1333 |
| 183 | Ga0496101_0002401 | 3300048904 | Bacteria | 11491 |
| 184 | Ga0496101_0037968 | 3300048904 | Bacteria | 3419 |
| 185 | Ga0496101_0224056 | 3300048904 | Bacteria | 1460 |
| 186 | Ga0496102_0000139 | 3300048905 | Bacteria | 98670 |
| 187 | Ga0496102_0024511 | 3300048905 | Bacteria | 5365 |
| 188 | Ga0496102_0063714 | 3300048905 | Bacteria | 3376 |
| 189 | Ga0496102_0584882 | 3300048905 | Bacteria | 1039 |
| 190 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 191 | Ga0496103_0135140 | 3300048906 | Bacteria | 1576 |
| 192 | Ga0496104_0003708 | 3300048907 | Bacteria | 13186 |
| 193 | Ga0496104_0363106 | 3300048907 | Bacteria | 1360 |
| 194 | Ga0496105_0300265 | 3300048908 | Bacteria | 1291 |
| 195 | Ga0496105_0606282 | 3300048908 | Bacteria | 849 |
| 196 | Ga0496106_0005771 | 3300048909 | Bacteria | 9152 |
| 197 | Ga0496106_0037570 | 3300048909 | Bacteria | 3623 |
| 198 | Ga0496106_0082260 | 3300048909 | Bacteria | 2475 |
| 199 | Ga0496107_0007789 | 3300048910 | Bacteria | 7397 |
| 200 | Ga0496108_0001538 | 3300048911 | Bacteria | 18255 |
| 201 | Ga0496108_0083849 | 3300048911 | Bacteria | 2704 |
| 202 | Ga0496108_0151317 | 3300048911 | Bacteria | 2002 |
| 203 | Ga0496108_0308714 | 3300048911 | Bacteria | 1378 |
| 204 | Ga0496108_0988236 | 3300048911 | Bacteria | 719 |
| 205 | Ga0496109_0012293 | 3300048912 | Bacteria | 7389 |
| 206 | Ga0496110_0086704 | 3300048913 | Bacteria | 2795 |
| 207 | Ga0496110_1086527 | 3300048913 | Bacteria | 708 |
| 208 | Ga0496111_0018273 | 3300048914 | Bacteria | 4854 |
| 209 | Ga0496112_0010054 | 3300048915 | Bacteria | 8566 |
| 210 | Ga0496112_0133422 | 3300048915 | Bacteria | 2454 |
| 211 | Ga0496113_0002639 | 3300048916 | Bacteria | 10500 |
| 212 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 213 | Ga0496114_0107113 | 3300048917 | Bacteria | 2392 |
| 214 | Ga0496114_0260408 | 3300048917 | Bacteria | 1527 |
| 215 | Ga0496114_0392282 | 3300048917 | Bacteria | 1229 |
| 216 | Ga0496114_0543414 | 3300048917 | Bacteria | 1027 |
| 217 | Ga0496115_0000088 | 3300048918 | Bacteria | 86213 |
| 218 | Ga0496115_0025003 | 3300048918 | Bacteria | 4646 |
| 219 | Ga0496121_0000817 | 3300048924 | Bacteria | 56786 |
| 220 | Ga0501034_0014809 | 3300049571 | Bacteria | 8022 |
| 221 | Ga0501067_0041279 | 3300049583 | Bacteria | 2562 |
| 222 | Ga0501067_0327084 | 3300049583 | Bacteria | 854 |
| 223 | Ga0501070_0004811 | 3300049586 | Bacteria | 11544 |
| 224 | Ga0501070_0053567 | 3300049586 | Bacteria | 3346 |
| 225 | Ga0501070_0343719 | 3300049586 | Bacteria | 1212 |
| 226 | Ga0501072_0296765 | 3300049588 | Bacteria | 1285 |
| 227 | Ga0501079_1626705 | 3300049741 | Bacteria | 508 |
| 228 | Ga0501212_051693 | 3300049851 | Bacteria | 697 |
| 229 | nmdc:mga00v17_144396_c1 | 3300050491 | Bacteria | 1527 |
| 230 | nmdc:mga00v17_212911_c1 | 3300050491 | Bacteria | 1251 |
| 231 | nmdc:mga0yw44_260005_c1 | 3300050492 | Bacteria | 1157 |
| 232 | nmdc:mga0yw44_424827_c1 | 3300050492 | Bacteria | 900 |
| 233 | nmdc:mga06z11_691905_c1 | 3300050494 | Unclassified | 621 |
| 234 | nmdc:mga04h51_386877_c1 | 3300050495 | Bacteria | 584 |
| 235 | nmdc:mga07m45_235087_c1 | 3300050496 | Bacteria | 1066 |
| 236 | nmdc:mga05p37_1043371_c1 | 3300050507 | Bacteria | 863 |
| 237 | nmdc:mga0qj67_630133_c1 | 3300050509 | Bacteria | 856 |
| 238 | nmdc:mga06r32_454700_c1 | 3300050510 | Bacteria | 1260 |
| 239 | nmdc:mga08y16_1219124_c1 | 3300050511 | Bacteria | 722 |
| 240 | nmdc:mga08y16_1527645_c1 | 3300050511 | Bacteria | 627 |
| 241 | nmdc:mga0n895_325546_c1 | 3300050512 | Bacteria | 1557 |
| 242 | nmdc:mga0rr50_55732_c1 | 3300050513 | Bacteria | 2950 |
| 243 | nmdc:mga08x19_10321_c1 | 3300050514 | Bacteria | 5606 |
| 244 | nmdc:mga08x19_405934_c1 | 3300050514 | Bacteria | 956 |
| 245 | nmdc:mga08x19_427019_c1 | 3300050514 | Bacteria | 931 |
| 246 | nmdc:mga0sz30_458961_c1 | 3300050516 | Bacteria | 572 |
| 247 | Ga0500566_0003987 | 3300053094 | Bacteria | 8816 |
| 248 | Ga0500614_123605 | 3300053123 | Bacteria | 763 |
| 249 | Ga0500616_0005125 | 3300053153 | Bacteria | 9023 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041494 | Ga0451837_1868597 | Ga0451837_1868597_257_613 | 118 |
| 2 | 3300005341 | Ga0070691_10111770 | Ga0070691_101117702 | 131 |
| 3 | 3300005345 | Ga0070692_10024295 | Ga0070692_100242952 | 131 |
| 4 | 3300005434 | Ga0070709_10496816 | Ga0070709_104968162 | 131 |
| 5 | 3300005436 | Ga0070713_100257378 | Ga0070713_1002573782 | 131 |
| 6 | 3300005438 | Ga0070701_10019341 | Ga0070701_100193413 | 131 |
| 7 | 3300005440 | Ga0070705_100087482 | Ga0070705_1000874822 | 131 |
| 8 | 3300005440 | Ga0070705_100647361 | Ga0070705_1006473612 | 131 |
| 9 | 3300005444 | Ga0070694_100021187 | Ga0070694_1000211872 | 131 |
| 10 | 3300005445 | Ga0070708_100170602 | Ga0070708_1001706022 | 131 |
| 11 | 3300005445 | Ga0070708_100406947 | Ga0070708_1004069472 | 131 |
| 12 | 3300005467 | Ga0070706_100032282 | Ga0070706_1000322825 | 131 |
| 13 | 3300005471 | Ga0070698_100000037 | Ga0070698_10000003751 | 131 |
| 14 | 3300005471 | Ga0070698_100572716 | Ga0070698_1005727162 | 131 |
| 15 | 3300005518 | Ga0070699_100012280 | Ga0070699_1000122806 | 131 |
| 16 | 3300005518 | Ga0070699_100166445 | Ga0070699_1001664451 | 131 |
| 17 | 3300005536 | Ga0070697_100143347 | Ga0070697_1001433474 | 131 |
| 18 | 3300005544 | Ga0070686_100034915 | Ga0070686_1000349154 | 131 |
| 19 | 3300005545 | Ga0070695_100459112 | Ga0070695_1004591122 | 131 |
| 20 | 3300005549 | Ga0070704_100006416 | Ga0070704_1000064165 | 131 |
| 21 | 3300005615 | Ga0070702_100037106 | Ga0070702_1000371064 | 131 |
| 22 | 3300005719 | Ga0068861_100897696 | Ga0068861_1008976961 | 131 |
| 23 | 3300005844 | Ga0068862_100464752 | Ga0068862_1004647522 | 131 |
| 24 | 3300006844 | Ga0075428_100097843 | Ga0075428_1000978432 | 131 |
| 25 | 3300006846 | Ga0075430_101432964 | Ga0075430_1014329642 | 131 |
| 26 | 3300006871 | Ga0075434_100021626 | Ga0075434_1000216268 | 131 |
| 27 | 3300006914 | Ga0075436_100002615 | Ga0075436_1000026154 | 131 |
| 28 | 3300007076 | Ga0075435_100147464 | Ga0075435_1001474642 | 131 |
| 29 | 3300007265 | Ga0099794_10010103 | Ga0099794_100101033 | 131 |
| 30 | 3300009147 | Ga0114129_12399450 | Ga0114129_123994502 | 131 |
| 31 | 3300013297 | Ga0157378_10100271 | Ga0157378_101002712 | 131 |
| 32 | 3300025885 | Ga0207653_10111226 | Ga0207653_101112262 | 131 |
| 33 | 3300025906 | Ga0207699_10380531 | Ga0207699_103805312 | 131 |
| 34 | 3300025922 | Ga0207646_11055655 | Ga0207646_110556552 | 131 |
| 35 | 3300025928 | Ga0207700_10916928 | Ga0207700_109169282 | 131 |
| 36 | 3300026118 | Ga0207675_100067112 | Ga0207675_1000671123 | 131 |
| 37 | 3300027671 | Ga0209588_1000557 | Ga0209588_10005579 | 131 |
| 38 | 3300028380 | Ga0268265_10233264 | Ga0268265_102332642 | 131 |
| 39 | 3300031691 | Ga0316579_10145190 | Ga0316579_101451902 | 131 |
| 40 | 3300031727 | Ga0316576_10058369 | Ga0316576_100583693 | 131 |
| 41 | 3300031728 | Ga0316578_10038180 | Ga0316578_100381802 | 131 |
| 42 | 3300031733 | Ga0316577_10056795 | Ga0316577_100567953 | 131 |
| 43 | 3300032137 | Ga0316585_10053720 | Ga0316585_100537202 | 131 |
| 44 | 3300032139 | Ga0316580_10007758 | Ga0316580_100077585 | 131 |
| 45 | 3300035398 | Ga0316574_0135542 | Ga0316574_0135542_784_1191 | 131 |
| 46 | 3300036647 | Ga0316582_0127393 | Ga0316582_0127393_84_491 | 131 |
| 47 | 3300036712 | Ga0316584_0118709 | Ga0316584_0118709_1125_1532 | 131 |
| 48 | 3300036712 | Ga0316584_0208403 | Ga0316584_0208403_333_740 | 131 |
| 49 | 3300045051 | Ga0451576_0033383 | Ga0451576_0033383_2824_3219 | 131 |
| 50 | 3300046538 | Ga0495609_0148256 | Ga0495609_0148256_289_687 | 131 |
| 51 | 3300046689 | Ga0495613_0997337 | Ga0495613_0997337_92_487 | 131 |
| 52 | 3300050509 | nmdc:mga0qj67_630133_c1 | nmdc:mga0qj67_630133_c1_228_626 | 131 |
| 53 | 3300050512 | nmdc:mga0n895_325546_c1 | nmdc:mga0n895_325546_c1_566_961 | 131 |
| 54 | 3300050513 | nmdc:mga0rr50_55732_c1 | nmdc:mga0rr50_55732_c1_1223_1618 | 131 |
| 55 | 3300050514 | nmdc:mga08x19_10321_c1 | nmdc:mga08x19_10321_c1_2393_2788 | 131 |
| 56 | 3300050514 | nmdc:mga08x19_405934_c1 | nmdc:mga08x19_405934_c1_196_591 | 131 |
| 57 | 3300050514 | nmdc:mga08x19_427019_c1 | nmdc:mga08x19_427019_c1_64_459 | 131 |
| 58 | 3300035398 | Ga0316574_0085418 | Ga0316574_0085418_745_1155 | 132 |
| 59 | 3300005536 | Ga0070697_100086823 | Ga0070697_1000868232 | 135 |
| 60 | 3300005545 | Ga0070695_100070310 | Ga0070695_1000703102 | 135 |
| 61 | 3300005546 | Ga0070696_100006234 | Ga0070696_1000062342 | 135 |
| 62 | 3300005549 | Ga0070704_100152844 | Ga0070704_1001528442 | 135 |
| 63 | 3300025922 | Ga0207646_10065633 | Ga0207646_100656331 | 135 |
| 64 | 3300005336 | Ga0070680_100964170 | Ga0070680_1009641701 | 136 |
| 65 | 3300006175 | Ga0070712_101303244 | Ga0070712_1013032441 | 139 |
| 66 | 3300009148 | Ga0105243_10189095 | Ga0105243_101890952 | 139 |
| 67 | 3300013297 | Ga0157378_11119144 | Ga0157378_111191441 | 139 |
| 68 | 3300048904 | Ga0496101_0002401 | Ga0496101_0002401_7607_8086 | 139 |
| 69 | 3300048905 | Ga0496102_0024511 | Ga0496102_0024511_489_968 | 139 |
| 70 | 3300048909 | Ga0496106_0005771 | Ga0496106_0005771_1295_1774 | 139 |
| 71 | 3300048910 | Ga0496107_0007789 | Ga0496107_0007789_6681_7160 | 139 |
| 72 | 3300048917 | Ga0496114_0392282 | Ga0496114_0392282_107_586 | 139 |
| 73 | 3300048918 | Ga0496115_0025003 | Ga0496115_0025003_861_1340 | 139 |
| 74 | 3300025919 | Ga0207657_10532818 | Ga0207657_105328182 | 143 |
| 75 | 3300009093 | Ga0105240_10471959 | Ga0105240_104719592 | 145 |
| 76 | 3300009176 | Ga0105242_10001530 | Ga0105242_1000153017 | 145 |
| 77 | 3300041496 | Ga0451839_1118039 | Ga0451839_1118039_137_577 | 145 |
| 78 | 3300041512 | Ga0451853_0354843 | Ga0451853_0354843_683_1120 | 145 |
| 79 | 3300046454 | Ga0495592_0249079 | Ga0495592_0249079_547_984 | 145 |
| 80 | 3300046459 | Ga0495629_0040949 | Ga0495629_0040949_1628_2065 | 145 |
| 81 | 3300046515 | Ga0495620_0394491 | Ga0495620_0394491_35_472 | 145 |
| 82 | 3300046536 | Ga0495587_0007145 | Ga0495587_0007145_1143_1580 | 145 |
| 83 | 3300046678 | Ga0495599_0139962 | Ga0495599_0139962_187_624 | 145 |
| 84 | 3300048905 | Ga0496102_0000139 | Ga0496102_0000139_16_453 | 145 |
| 85 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_125632_126069 | 145 |
| 86 | 3300044684 | Ga0466966_0881096 | Ga0466966_0881096_23_496 | 147 |
| 87 | 3300025923 | Ga0207681_10726689 | Ga0207681_107266892 | 148 |
| 88 | 3300009101 | Ga0105247_11491259 | Ga0105247_114912591 | 150 |
| 89 | 3300005841 | Ga0068863_100021738 | Ga0068863_1000217382 | 151 |
| 90 | 3300025913 | Ga0207695_10334107 | Ga0207695_103341072 | 151 |
| 91 | 3300026088 | Ga0207641_10015778 | Ga0207641_100157786 | 151 |
| 92 | 3300031548 | Ga0307408_100792611 | Ga0307408_1007926112 | 152 |
| 93 | 3300031824 | Ga0307413_10581393 | Ga0307413_105813931 | 152 |
| 94 | 3300031901 | Ga0307406_10117286 | Ga0307406_101172862 | 152 |
| 95 | 3300032002 | Ga0307416_101402046 | Ga0307416_1014020462 | 152 |
| 96 | 3300032126 | Ga0307415_101424968 | Ga0307415_1014249681 | 152 |
| 97 | 3300045836 | Ga0466958_1050462 | Ga0466958_1050462_31_489 | 152 |
| 98 | 3300046462 | Ga0495651_0594003 | Ga0495651_0594003_13_471 | 152 |
| 99 | 3300003203 | JGI25406J46586_10054134 | JGI25406J46586_100541341 | 153 |
| 100 | 3300005546 | Ga0070696_100517987 | Ga0070696_1005179872 | 153 |
| 101 | 3300005983 | Ga0081540_1000535 | Ga0081540_10005359 | 153 |
| 102 | 3300005985 | Ga0081539_10005211 | Ga0081539_100052115 | 153 |
| 103 | 3300006847 | Ga0075431_101131512 | Ga0075431_1011315122 | 153 |
| 104 | 3300009094 | Ga0111539_11930128 | Ga0111539_119301281 | 153 |
| 105 | 3300009147 | Ga0114129_11123267 | Ga0114129_111232672 | 153 |
| 106 | 3300009148 | Ga0105243_10236101 | Ga0105243_102361012 | 153 |
| 107 | 3300009545 | Ga0105237_11617236 | Ga0105237_116172362 | 153 |
| 108 | 3300010375 | Ga0105239_10394369 | Ga0105239_103943692 | 153 |
| 109 | 3300013306 | Ga0163162_12363802 | Ga0163162_123638021 | 153 |
| 110 | 3300013308 | Ga0157375_11189219 | Ga0157375_111892192 | 153 |
| 111 | 3300014968 | Ga0157379_10025166 | Ga0157379_100251665 | 153 |
| 112 | 3300014968 | Ga0157379_10841317 | Ga0157379_108413171 | 153 |
| 113 | 3300025923 | Ga0207681_10954928 | Ga0207681_109549282 | 153 |
| 114 | 3300025935 | Ga0207709_10220896 | Ga0207709_102208962 | 153 |
| 115 | 3300025937 | Ga0207669_11164261 | Ga0207669_111642611 | 153 |
| 116 | 3300025938 | Ga0207704_10541170 | Ga0207704_105411701 | 153 |
| 117 | 3300026118 | Ga0207675_101197082 | Ga0207675_1011970822 | 153 |
| 118 | 3300031852 | Ga0307410_10470559 | Ga0307410_104705592 | 153 |
| 119 | 3300031995 | Ga0307409_100812784 | Ga0307409_1008127842 | 153 |
| 120 | 3300032126 | Ga0307415_100950540 | Ga0307415_1009505401 | 153 |
| 121 | 3300044693 | Ga0466961_0677845 | Ga0466961_0677845_12_485 | 153 |
| 122 | 3300046516 | Ga0495628_0000207 | Ga0495628_0000207_49359_49856 | 153 |
| 123 | 3300046529 | Ga0495652_0000060 | Ga0495652_0000060_44620_45117 | 153 |
| 124 | 3300046529 | Ga0495652_0000061 | Ga0495652_0000061_67000_67497 | 153 |
| 125 | 3300046536 | Ga0495587_0271028 | Ga0495587_0271028_315_812 | 153 |
| 126 | 3300047321 | Ga0495676_0017504 | Ga0495676_0017504_3881_4393 | 153 |
| 127 | 3300048088 | Ga0495602_0004076 | Ga0495602_0004076_9645_10142 | 153 |
| 128 | 3300048906 | Ga0496103_0135140 | Ga0496103_0135140_324_797 | 153 |
| 129 | 3300049586 | Ga0501070_0004811 | Ga0501070_0004811_5532_5999 | 153 |
| 130 | 3300049741 | Ga0501079_1626705 | Ga0501079_1626705_23_490 | 153 |
| 131 | 3300050507 | nmdc:mga05p37_1043371_c1 | nmdc:mga05p37_1043371_c1_281_754 | 153 |
| 132 | 3300050510 | nmdc:mga06r32_454700_c1 | nmdc:mga06r32_454700_c1_194_667 | 153 |
| 133 | 3300050511 | nmdc:mga08y16_1527645_c1 | nmdc:mga08y16_1527645_c1_44_517 | 153 |
| 134 | 3300006051 | Ga0075364_10138065 | Ga0075364_101380652 | 154 |
| 135 | 3300006173 | Ga0070716_100148715 | Ga0070716_1001487152 | 154 |
| 136 | 3300025921 | Ga0207652_11171628 | Ga0207652_111716282 | 154 |
| 137 | 3300037466 | Ga0395898_0261954 | Ga0395898_0261954_56_535 | 154 |
| 138 | 3300037466 | Ga0395898_0305800 | Ga0395898_0305800_396_875 | 154 |
| 139 | 3300037471 | Ga0395905_1219990 | Ga0395905_1219990_90_569 | 154 |
| 140 | 3300038443 | Ga0395901_0767324 | Ga0395901_0767324_387_866 | 154 |
| 141 | 3300044901 | Ga0466960_0000577 | Ga0466960_0000577_1421_1900 | 154 |
| 142 | 3300045049 | Ga0466959_0938525 | Ga0466959_0938525_20_499 | 154 |
| 143 | 3300045976 | Ga0466967_0059815 | Ga0466967_0059815_2040_2504 | 154 |
| 144 | 3300046459 | Ga0495629_0042638 | Ga0495629_0042638_2014_2505 | 154 |
| 145 | 3300046514 | Ga0495618_0060952 | Ga0495618_0060952_380_895 | 154 |
| 146 | 3300047321 | Ga0495676_0583799 | Ga0495676_0583799_68_532 | 154 |
| 147 | 3300047445 | Ga0495677_0145888 | Ga0495677_0145888_303_767 | 154 |
| 148 | 3300047673 | Ga0495593_0084465 | Ga0495593_0084465_529_1026 | 154 |
| 149 | 3300048904 | Ga0496101_0037968 | Ga0496101_0037968_1598_2077 | 154 |
| 150 | 3300048913 | Ga0496110_1086527 | Ga0496110_1086527_136_615 | 154 |
| 151 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_45345_45845 | 154 |
| 152 | 3300048918 | Ga0496115_0000088 | Ga0496115_0000088_75668_76168 | 154 |
| 153 | 3300049571 | Ga0501034_0014809 | Ga0501034_0014809_1404_1883 | 154 |
| 154 | 3300049583 | Ga0501067_0041279 | Ga0501067_0041279_1883_2362 | 154 |
| 155 | 3300049586 | Ga0501070_0053567 | Ga0501070_0053567_2217_2723 | 154 |
| 156 | 3300049588 | Ga0501072_0296765 | Ga0501072_0296765_685_1194 | 154 |
| 157 | 3300050491 | nmdc:mga00v17_144396_c1 | nmdc:mga00v17_144396_c1_151_642 | 154 |
| 158 | 3300050492 | nmdc:mga0yw44_424827_c1 | nmdc:mga0yw44_424827_c1_67_558 | 154 |
| 159 | 3300053094 | Ga0500566_0003987 | Ga0500566_0003987_298_789 | 154 |
| 160 | 3300005330 | Ga0070690_100614146 | Ga0070690_1006141462 | 155 |
| 161 | 3300005338 | Ga0068868_101379431 | Ga0068868_1013794312 | 155 |
| 162 | 3300005341 | Ga0070691_10290684 | Ga0070691_102906842 | 155 |
| 163 | 3300005457 | Ga0070662_100943777 | Ga0070662_1009437772 | 155 |
| 164 | 3300005618 | Ga0068864_101100562 | Ga0068864_1011005622 | 155 |
| 165 | 3300005719 | Ga0068861_101719419 | Ga0068861_1017194191 | 155 |
| 166 | 3300005841 | Ga0068863_100590014 | Ga0068863_1005900142 | 155 |
| 167 | 3300005983 | Ga0081540_1036239 | Ga0081540_10362392 | 155 |
| 168 | 3300009098 | Ga0105245_11068812 | Ga0105245_110688122 | 155 |
| 169 | 3300009148 | Ga0105243_10242088 | Ga0105243_102420882 | 155 |
| 170 | 3300014745 | Ga0157377_11223443 | Ga0157377_112234431 | 155 |
| 171 | 3300025927 | Ga0207687_10682616 | Ga0207687_106826162 | 155 |
| 172 | 3300026023 | Ga0207677_10019999 | Ga0207677_100199994 | 155 |
| 173 | 3300026023 | Ga0207677_11117649 | Ga0207677_111176492 | 155 |
| 174 | 3300026088 | Ga0207641_10365955 | Ga0207641_103659552 | 155 |
| 175 | 3300026095 | Ga0207676_10884210 | Ga0207676_108842102 | 155 |
| 176 | 3300026118 | Ga0207675_100247219 | Ga0207675_1002472192 | 155 |
| 177 | 3300031731 | Ga0307405_11750184 | Ga0307405_117501841 | 155 |
| 178 | 3300032002 | Ga0307416_103312094 | Ga0307416_1033120941 | 155 |
| 179 | 3300034819 | Ga0373958_0048050 | Ga0373958_0048050_236_715 | 155 |
| 180 | 3300044901 | Ga0466960_0031746 | Ga0466960_0031746_1214_1693 | 155 |
| 181 | 3300044901 | Ga0466960_0037972 | Ga0466960_0037972_787_1263 | 155 |
| 182 | 3300044901 | Ga0466960_0129555 | Ga0466960_0129555_669_1148 | 155 |
| 183 | 3300048903 | Ga0496100_0241422 | Ga0496100_0241422_715_1194 | 155 |
| 184 | 3300048904 | Ga0496101_0224056 | Ga0496101_0224056_241_720 | 155 |
| 185 | 3300048905 | Ga0496102_0584882 | Ga0496102_0584882_145_624 | 155 |
| 186 | 3300048907 | Ga0496104_0363106 | Ga0496104_0363106_630_1109 | 155 |
| 187 | 3300048908 | Ga0496105_0300265 | Ga0496105_0300265_180_659 | 155 |
| 188 | 3300048909 | Ga0496106_0082260 | Ga0496106_0082260_1228_1707 | 155 |
| 189 | 3300048911 | Ga0496108_0083849 | Ga0496108_0083849_688_1173 | 155 |
| 190 | 3300048911 | Ga0496108_0151317 | Ga0496108_0151317_1279_1758 | 155 |
| 191 | 3300048911 | Ga0496108_0308714 | Ga0496108_0308714_320_796 | 155 |
| 192 | 3300048915 | Ga0496112_0133422 | Ga0496112_0133422_176_655 | 155 |
| 193 | 3300048917 | Ga0496114_0107113 | Ga0496114_0107113_162_641 | 155 |
| 194 | 3300049583 | Ga0501067_0327084 | Ga0501067_0327084_275_754 | 155 |
| 195 | 3300053153 | Ga0500616_0005125 | Ga0500616_0005125_2946_3422 | 155 |
| 196 | 3300005577 | Ga0068857_101179779 | Ga0068857_1011797791 | 156 |
| 197 | 3300005614 | Ga0068856_100050634 | Ga0068856_1000506342 | 156 |
| 198 | 3300009553 | Ga0105249_10915458 | Ga0105249_109154582 | 156 |
| 199 | 3300013297 | Ga0157378_11610757 | Ga0157378_116107572 | 156 |
| 200 | 3300025942 | Ga0207689_10215555 | Ga0207689_102155553 | 156 |
| 201 | 3300025961 | Ga0207712_10356108 | Ga0207712_103561082 | 156 |
| 202 | 3300026023 | Ga0207677_10417648 | Ga0207677_104176481 | 156 |
| 203 | 3300044901 | Ga0466960_0312213 | Ga0466960_0312213_316_804 | 156 |
| 204 | 3300046471 | Ga0495650_0000070 | Ga0495650_0000070_93802_94293 | 156 |
| 205 | 3300048905 | Ga0496102_0063714 | Ga0496102_0063714_1364_1846 | 156 |
| 206 | 3300048907 | Ga0496104_0003708 | Ga0496104_0003708_3668_4150 | 156 |
| 207 | 3300048908 | Ga0496105_0606282 | Ga0496105_0606282_66_548 | 156 |
| 208 | 3300048909 | Ga0496106_0037570 | Ga0496106_0037570_244_726 | 156 |
| 209 | 3300048911 | Ga0496108_0001538 | Ga0496108_0001538_5422_5904 | 156 |
| 210 | 3300048912 | Ga0496109_0012293 | Ga0496109_0012293_6136_6618 | 156 |
| 211 | 3300048913 | Ga0496110_0086704 | Ga0496110_0086704_480_962 | 156 |
| 212 | 3300048914 | Ga0496111_0018273 | Ga0496111_0018273_62_544 | 156 |
| 213 | 3300048915 | Ga0496112_0010054 | Ga0496112_0010054_2224_2706 | 156 |
| 214 | 3300048916 | Ga0496113_0002639 | Ga0496113_0002639_4148_4630 | 156 |
| 215 | 3300048917 | Ga0496114_0260408 | Ga0496114_0260408_300_782 | 156 |
| 216 | 3300049851 | Ga0501212_051693 | Ga0501212_051693_182_655 | 156 |
| 217 | 3300050511 | nmdc:mga08y16_1219124_c1 | nmdc:mga08y16_1219124_c1_224_694 | 156 |
| 218 | 3300006038 | Ga0075365_10220536 | Ga0075365_102205362 | 157 |
| 219 | 3300006038 | Ga0075365_10954201 | Ga0075365_109542011 | 157 |
| 220 | 3300006051 | Ga0075364_10055656 | Ga0075364_100556562 | 157 |
| 221 | 3300006353 | Ga0075370_10168514 | Ga0075370_101685142 | 157 |
| 222 | 3300050491 | nmdc:mga00v17_212911_c1 | nmdc:mga00v17_212911_c1_483_968 | 157 |
| 223 | 3300050492 | nmdc:mga0yw44_260005_c1 | nmdc:mga0yw44_260005_c1_386_871 | 157 |
| 224 | 3300050494 | nmdc:mga06z11_691905_c1 | nmdc:mga06z11_691905_c1_26_511 | 157 |
| 225 | 3300050495 | nmdc:mga04h51_386877_c1 | nmdc:mga04h51_386877_c1_45_530 | 157 |
| 226 | 3300050496 | nmdc:mga07m45_235087_c1 | nmdc:mga07m45_235087_c1_203_688 | 157 |
| 227 | 3300050516 | nmdc:mga0sz30_458961_c1 | nmdc:mga0sz30_458961_c1_49_534 | 157 |
| 228 | 3300003203 | JGI25406J46586_10047849 | JGI25406J46586_100478492 | 159 |
| 229 | 3300005337 | Ga0070682_100557357 | Ga0070682_1005573572 | 159 |
| 230 | 3300005455 | Ga0070663_100491175 | Ga0070663_1004911752 | 159 |
| 231 | 3300005457 | Ga0070662_100807309 | Ga0070662_1008073092 | 159 |
| 232 | 3300005539 | Ga0068853_100770507 | Ga0068853_1007705071 | 159 |
| 233 | 3300005548 | Ga0070665_100000791 | Ga0070665_10000079137 | 159 |
| 234 | 3300005564 | Ga0070664_100655619 | Ga0070664_1006556192 | 159 |
| 235 | 3300005985 | Ga0081539_10002970 | Ga0081539_100029702 | 159 |
| 236 | 3300005985 | Ga0081539_10396587 | Ga0081539_103965871 | 159 |
| 237 | 3300009551 | Ga0105238_11085075 | Ga0105238_110850752 | 159 |
| 238 | 3300009553 | Ga0105249_10167992 | Ga0105249_101679922 | 159 |
| 239 | 3300025944 | Ga0207661_11015267 | Ga0207661_110152672 | 159 |
| 240 | 3300025972 | Ga0207668_10389732 | Ga0207668_103897322 | 159 |
| 241 | 3300026067 | Ga0207678_10299791 | Ga0207678_102997912 | 159 |
| 242 | 3300026089 | Ga0207648_10356651 | Ga0207648_103566512 | 159 |
| 243 | 3300028379 | Ga0268266_10027682 | Ga0268266_100276825 | 159 |
| 244 | 3300046794 | Ga0495589_0168149 | Ga0495589_0168149_32_514 | 159 |
| 245 | 3300048911 | Ga0496108_0988236 | Ga0496108_0988236_214_696 | 159 |
| 246 | 3300048917 | Ga0496114_0543414 | Ga0496114_0543414_281_763 | 159 |
| 247 | 3300048924 | Ga0496121_0000817 | Ga0496121_0000817_44925_45437 | 159 |
| 248 | 3300049586 | Ga0501070_0343719 | Ga0501070_0343719_247_729 | 159 |
| 249 | 3300053123 | Ga0500614_123605 | Ga0500614_123605_223_735 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o4v-assembly1.cif.gz_A | crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution | 0.9553 | 28 | 157 |
| 1xmp-assembly1.cif.gz_G | crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution | 0.9465 | 28 | 157 |
| 2ywx-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from methanocaldococcus jannaschii | 0.9462 | 30 | 157 |
| 4ay4-assembly1.cif.gz_D | crystal structure of bacillus anthracis pure | 0.946 | 28 | 157 |
| 3lp6-assembly1.cif.gz_C | crystal structure of rv3275c-e60a from mycobacterium tuberculosis at 1.7a resolution | 0.9432 | 24 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SJ42_1_162_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9476 | 34 | 157 | 3.40.50.1970 |
| 2ywxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9462 | 30 | 157 | 3.40.50.1970 |
| 5cvtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9244 | 26 | 157 | 3.40.50.1970 |
| af_P21264_391_571_3.40.50.1970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9207 | 20 | 157 | 3.40.50.1970 |
| 4ja0C02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9016 | 29 | 159 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8GA15-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9671 | 27 | 157 |
GO:0004638
GO:0006189 GO:0034023 |
| AF-A0A3D0NNP3-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.966 | 28 | 157 |
GO:0006189
GO:0034023 |
| AF-A0A4P9X6U5-F1-model_v4 | Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) | 0.9659 | 26 | 157 |
GO:0004638
GO:0005524 GO:0006189 GO:0046872 |
| AF-A0A2V1KCK0-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9655 | 28 | 157 |
GO:0006189
GO:0034023 |
| AF-C7NFG1-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) | 0.9655 | 28 | 157 |
GO:0006189
GO:0016829 GO:0034023 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar